Skip to main content

Full text of "Census of the exact sciences in Sanskrit; Series A Volume 5"

See other formats


Census of the Exact Sciences 
in Sanskrit 

Series A, Volume 5 


DAVID PINGREE 




Digitized by the Internet Archive 
in 2018 with funding from 
University of Alberta Libraries 


https://archive.org/details/censusofexactsci05ping 


c 

/ 


'O r' 

.hU 


1 ^ 




Census of the Exact Sciences fWi^ 

in 

Sanskrit 

Series A, Volume 5 





>1 




\r 


^ P^-i^ -# W-'-»^'<r*i*'ft*'» 

'?'f ' t-3 ^ . ' .>— > '»* i c ‘V 

vv 1l \ui ^ <^X'**^--**^^. 










■n/ (* j^-i 


8'iDii»i'>8 Bexa 1o 8U0n93 i^; ^ 
ni ® 

Z ainiiloV\A iidhaE '' **^s. 





>«?-■ 


H 


'V 


’■ -. ^ 

•4t^. ■’ » * o'. 


kri..i.S^ •■ « 



Census of the Exact Sciences 
in 

Sanskrit 

Series A, Volume 5 


David Pingree 


American Philosophical Society 
Independence Square Philadelphia 





Memoirs of the American Philosophical Society 
Held at Philadelphia 
For Promoting Useful Knowledge 
Volume 213 


Copyright ® 1994 by the American Philosophical Society for its Memoirs series, Volume 213 


Publication of this book has been supported by a grant from 

the National Endowment for the Humanities, an independent federal agency. 


Library of Congress Number: 94-72374 
International Standard Book Number: 0-87169-213-9 
US ISSN 0065-9738 


CONTENTS 

PAGE 

Introduction . vii 

Abbreviations of Journals and Serials. viii 

Bibliography... ix 

List of Catalogs of Sanskrit Manuscripts and Books. xxv 

Census of the Exact Sciences in Sanskrit. 3 


V 












INTRODUCTION 


This, the fifth volume of Series A of CESS, makes its 
appearance more than a decade after its predecessor. 
The long delay was due to the need to utilize the 
computer in its preparation. I was by great good 
fortune—whether due to benefic stars or to Providence 
I am unable to determine—rescued from the necessity of 
attempting the daunting task of mastering the modern 
language of scholarship by the efforts of a brilliant 
Graduate Student, Kim Plofker, who transformed my 
handwritten pages with extraordinary accuracy into 
the camera-ready copy that is the mater of the bulky 
volume you are reading. I am extremely grateful for 
her lengthy toil on this project, and for her making far 
easier the preparation of the next volume, which will 
be the last in Series A, and of the subsequent volumes 
of Series B, which will be devoted to the bibliography 
of jyotihsastra arranged according to the titles of the 
books. 

Volume five of Series A contains entries on authors 
whose names begin with the Sanskrit semivowels {y, r, 
/, and v), on pp. 317-756. This material is preceded by 
additional abbreviations of journals and serials (p. viii), 
additional bibliography (pp. ix-xxiv), and additional 
manuscript catalogs (pp. xxv-xxvi), as well as entries 
supplemental to those in volumes one to four of Series 
A (pp. 3-317). Clearly the long delay in producing 
this volume has contributed substantially to its bulk; 


many new catalogs have been published in this period, 
and I have been able to investigate many other texts 
which deserve inclusion in CESS because they contain 
significant amounts of matter germane to jyotisa. This 
realization will encourage me not to allow as much 
time to lapse before the appearance of volume six. 

The date after which new material was not entered 
into the present volume was the Spring of 1992. Not 
only has everything that came to my notice since 
then been set aside for the next volume; I have also 
refrained from entering here most of the manuscripts 
on dharmasastra in the Candra Shum Shere collection 
in the Bodleian Library at Oxford and those on jyotisa 
at the Wellcome Institute in London; my forthcoming 
catalogs of those two collections will be utilized in 
compiling volume six. For that volume I will also 
cease to include the published books of modern Indian 
astrologers. They have become far too prolific for me 
to be able to record all of the results of their labors. 

I end this introduction with a renewed plea to the 
readers of CESS to inform me of any errors of fact 
or omissions that they may notice. My objective is 
to be as complete and as accurate as possible, and 
I will greatly appreciate any assistance offered me in 
attempting to attain that goal. 

Providence, R. I., Spring 1993 


Vll 


ABBREVIATIONS OF JOURNALS AND SERIALS 


AJOS—Aligarh Journal of Oriental Studies 

Aligarh OS—Aligarh Oriental Series 

AOR—Annals of Oriental Research 

AV—Arhat Vacana 

BEI—Bulletin d’etudes indiennes 

BLJ—British Library Journal 

BNME—Bulletin of the National Museum of Ethnology 
CAG—Caukhamba Amarabhdrati Granthamdld 
Calcutta SS—Calcutta Sanskrit Series 
CHLT—The Collection of Hindu Law Texts 
CPG—Caukhambhd Prdcyavidyd Granthamdld 
GB—Ganitabhdrati 

GSG—Gokuladdsasarnskrtagranthamdld 


IHR—Indian Historical Review 

Ind Taur—Indologica Taurinensia 

JIP—Journal of Indian Philosophy 

KCBS—Kadalangudi Centenary Book Series 

KK—Kagakusi Kenkyu 

KSVS—Kendriya Sarnskrta Vidydpitha Series 

NPS—Nag Publishers Series 

SK—Sugakushi Kenkyu 

SMGM—Sarnsodhanamandalagranthamdld 

SSPS—Sarnskrta Sdhitya Parisat Series 

SVORS—Sri Venkateswara Oriental Research Series 

Vdrdnaseya SG — Vdrdnaseyasarnskrtagranthamdld 


Vlll 


BIBLIOGRAPHY 


Abdi, Wazir Hasan. [A5. 1982]. “Some Works of Indian 

Mathematici^lns Who Wrote in Persian,” GB 4, 1982, 6-9. 

-. [A5. 1983]. “Some Indian Mathematicians Who Wrote 

in Persi^ul,” Proceedings of the 11th Iranian Mathematics 
Conference (1980), Mashhad 1983, pp. 40-50. 

Abe, Gakuho. [A5. 1985]. “Magic Squares Made by Nwaya^ 
Pan<hta,” SK 104, 1985, 32-44 (in Japanese). 

Abhyankar, K. D. [A5. 1991]. “Misidentification of Some Indi 2 m 
Neik^trais,” IJHS 26, 1991, 1-10. 

Abraham, George. [A5. 1981]. “The Gnomon in Early Indiem 
Astronomy,” IJHS 16, 1981, 215-218. 

-. [A5. 1982]. “Algebraic Formulae for the Moon, Saturn emd 

Jupiter in the Pancasiddhantika," AHES 26, 1982, 287-297. 

-. [A5. 1984]. “Length of the Yeeir in Pre-epicyclic Plemetaxy 

Theory,” AHES 30, 1984, 189-195. 

-. [A5. 1986]. “The Motion of the Moon in the Romaka 

Siddhanta," AHES 35, 1986, 325-328. 

-. [A5. 1988]. “Apollonius’ Theorem for Stationary Points,” 

JAS 30, 1988, 50-54. 

-. [A5. 1991]. “Meem Sun and Moon in Ancient Greek and 

Indian Astronomy,” IJHS 26, 1991, 383-387. 

Acheirya, Bhanushanker NiUcanth. [1954]. This is a reprint of his 
thesis, which weis published at Halvad in 1951. 

-. [A5. 1980]. “Sanskrit and Mathematics,” Proceedings of 

the First International Sanskrit Conference III 1, New Delhi 

1980, pp. 230-231. 

Adhikari, R. K. [A5. 1980]. “Grahadmam calatvan na prthi- 
vyah,” Sagarika 18, 1-2, Sam. 2037, 183-188. 

Agarwala, G. C. [A5. 1979]. Age of Bhdrata War, DeUii- 

Vcircmeisi-Patna 1979. 

Agravala, Suresacandra. See A. Jaina emd S. AgravaJa [A5. 
1985]; [A5. 1988/89a]; and [A5. 1988/89b]. 

Agrawal, M. B. Lai. [A5. 1983]. “Contribution of the Jainacaryas 
to the Development of Mathematics and Astronomy,” GB 5, 
1983, 16-21. 

AgrawcJa, R. C. [A5. 1963]. “A Newly Discovered Sun Temple 
at Tusa,” Bharatiya Vidya 23, 1963, 56-58. 

AgrawfJ, V. P. [A5. 1978]. “A Note on Combinatorics,” ME 12, 
1978, 1, 1-4. 

Ahmad, Afzal. [A5. 1981]. “On the Pi of Aryabhato I,” GB 3, 

1981, 83-85. 

-. [A5. 1982]. “On Vedic Square-Circle Conversion,” GB 4, 

1982, 72-77. 

Aithad, Par^uneswara. [A5. 1980/81]. “On the Caturmasya-pr^^r 
yoga of Anantadeva,” Brahmavidya 44-45, 1980-81, 486-505. 

Alsdorf, Ludwig. [A4. 1933]. Translated into English by 

Sreeramula Rajesweira Sarma as “The Pratyayeis: Indian 
Contribution to Combinatorics,” IJHS 26, 1991, 17-61. 

Anonymous. [A5. 1982]. In the Image of Man. The Indian 
Perception of the Universe through 2000 Years of Painting 
and Sculpture, New York 1982. 

Ans^u'i, S. M. Razaiillah. See S. F. A. Jedali and S. M. R Ansari 
[A5. 1985]. 

-. [A5. 1978]. “The Establishment of Observatories amd the 

Socio-economic Conditions of Scientific Work in Nineteenth 
Century India,” IJHS 13, 1978, 62-71. 


-. [A5. 1985]. “Introduction of Modem Western Astronomy 

in India during 18-19 Centuries” in S. N. Sen emd K. S. Shukla 
[A5. 1985], pp. 363-402; repr. New Delhi, 1985. 

Apte, P. P., and S. G. Supekar. [A5. 1983]. “Vastu-pumsa- 
mand£da in the Pauskara-sarnhitd cmd Brhat-samhita. A 
Comparative Study,” BDCRI42, 1983, 5-17. 

Apte, P. P. [A5. 1972/73]. “Mandalaradhana,” JOI Baroda 22, 
1972-73, 501-524. 

Apte, S. S. [A5. 1978]. Vedic Astronomy & Mythology, Pime 
1978 (English translation of A. J. Kctrandikar [A5. ?]). 

Apte, V. M. [A5. 1942]. “Rta in the Rgveda,” ABORI 23, 1942, 
55-60. 

Arkasomayaji, D. (see D. A. Somayaji) [A5. 1974]. “The 

Experience of the ‘Imaginjiry’ through the Gleisses of Math¬ 
ematics,” Dr. V. Raghavan Shashtyabdapurti Felicitation 
Volume, Madras 1974, pp. 268-273. 

ArunachcJeun, B. [A5. 1985]. “The Haven Finding Art in 

Indian Navigational Traditions £md its Applications in Indi£m 
Navigational Cartography,” Indica 22, 1985, 103-122. 

Aryika JnanamatT. [A5. 1985]. “J^una Geography,” trems. S. S. 
Lishk, Hastinapur 1985. 

Askhedkar, L. Y. [A5. 1875]. “Verse 33 of Ch^md’s 27th Canto,” 
lA 4, 1875,152-153. 

Bag, A. K., <md K. S. Shen. [A5. 1984]. “Kuttaka and 

Qiuyishu,” IJHS 19, 1984, 397-405. 

Bag, A. K. [A5. 1979]. Mathematics in Ancient and Medieval 
India, Varemasi 1979. 

-. [A5. 1980a]. “Indicm Literature on Mathematics During 

1400-1800 A.D.,” IJHS 15, 1980, 79-93. 

-. [A5. 1980b]. “A Critical Appraisal of Sanskrit Works 

on Astronomy and Mathematics,” Proceedings of the First 
International Sanskrit Conference III 1, New Delhi 1980, pp. 
239-268. 

-. [A5. 1985a]. “Astronomy in Indus Civilization and dm-ing 

Vedic Times” in S. N. Sen and K. S. Shukla [A5. 1985], pp. 
122-130. 

-. [A5. 1985b]. Science and Civilization in India. Harappan 

Period (c. 3000 B.C.-c. 1500 B.C.), New Delhi 1985. 

-. [A5. 1990]. “Ritued Geometry in India and its Parallelism 

in Other Cultvu-al Areas,” IJHS 25, 1990, 4-19. 

Bagchi, Prabodh Ch 2 indra. [A5. 1981]. Astro Therapy, Calcutta 
1981. 

Bahulkar, S. S. [A5. 1984]. “The Naksatrakalpa and the ^anti- 
kalpa,” PAIOC 31, Poona 1984, 179-184. Reprinted in JOI 
Baroda 34, 1984-85, 134-139. 

Bcihura, Gopala Narayana. [A5. 1981]. “Jayapurei-rajagrha 

pothikhana ke pamcamga,” Jijndsd 2, 1981, 86-96. 

Bajaj, Prem N. [A5. 1980]. “Numerals: an Invention of the 

Hindus,” Bhdratibhdnam, PUIS 26, Hoshiarpur 1980, pp. 
482-484. 

Balslev, Anindita Niyogi. [A5. 1983]. A Study of Time in 

Indian Philosophy, Wiesbaden 1983. 

-. [A5. 1984]. “An Over-cdl View of the Problem of Time in 

Indian Philosophy,” Indologica Taurinensia 12, 1984, 39-48. 

Bandhopadhyay, Amedendu, ^md Ashok Kumar Bhatnagar. [A5. 
1987]. “System of Astronomical Constaints in Hindu Astron¬ 
omy,” History of Oriental Astronomy, Cambridge 1987, pp. 
85-89. 


IX 


X 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bandhopadhyay, Amalendu. [A5. 1988]. “Astronomical Works 
of S£imanta Ch£uidr£isekhar,” JAS 30, 1988, 7-12, 

Beissan, D, S. [A5. 1984]. “Ancient Indiem Mathematics,” 

Sciences and the Vedas, Bombay-Madras-New Delhi 1984, pp. 
40-54. 

Beeimes, John. [A5. 1872]. “Mode of Dating in Orissa,” lA 1, 
1872, 64, (Answered by J. S. F. Mackenzie [A5. 1872]). 

Behaxi, Bepin. [A5. 1983]. A Study in Astrological Occultism, 
Bangalore 1983. 

Behari, Keulash, emd Vijeii Govind. [A5, 1980]. “A Survey of 
Historical Astrolabes of Delhi,” IJHS 15, 1980, 94-104. 

Behari, Ram. [A5. 1977]. “Aryabhato as a Mathematiciem,” 
IJHS 12, 1977, 147-149. 

Behere, Madhava Krsna. [A5. 1976], Devdrncd phaujaddra 

arthdt srt sani, Pune 1976. 

Bekken, O. B. [A5. 1984]. Readings from the Hindu Arithmetic 
and Algebra, Agder 1984. 

Bender, Ernest. [A5. 1984]. “The Place of the Manduka in 

a Hindu Cosmological System,” Sarnskrtasarnskrtih: Cultura 
Sdnscrita, Mexico 1984, pp. 55-58. 

Bendrey, V. S. [A5. 1933]. Tdrtkh-i-Ildht, Poona 1933; reprinted 
Aligarh 1972. 

Bentley, John. [1823]. Reprinted H^lridw^lr, 1990. 

Bhandarkar, D. R. [A5. 1938]. “Purva,” NIA 1, 1938, 142-143. 

Bhamdairkar, Ramkrishna Gopal. [A5. 1872]. “The Old S^mskrit 
Numerals,” lA 1, 1872, 60-61. 

Bhanu, Jagannath Preisad. [A5. 1924]. Anka Vilas or Mysteries 
of Figures, Bilaspiu 1924. 

Bhcirgava, P. L. [A5. 1980]. “The Adityas in the Rgveda,” 

Bhdratibhdnam, PUIS 26, Hoshi£irpur 1980, pp. 15-18. 

Bhaisin, J. N. [A5. 1974], Events and Nativities, New Delhi 

1974, repr. New Delhi 1986. 

-. [A5. 1982a]. The Art of Prediction, New Delhi 1982. 

-. [A5. 1982b]. Dispositors in Astrology, New Delhi 1982. 

-. [A5. 1984]. Astrology in Vedas, New Delhi 1984. 

Bhat, M. Ramaikrishna. [A5. 1985]. “Astrological Elements in 
Pamni,” MM Professor Kuppuswami Sastri Birth Centenary 
Commemoration Volume, part II, Madrcis 1985, pp. 199-208. 

Bhatnagar, Ashok Kum£ir. See A. Bsmdhopadhyay and A. K. 
Bhatnagctr [A5. 1987]. 

Bhatt, J. A. [A5. 1984]. “Mrnmayarh grham in jRF VII 89 in 
Compeirison with the Theory of Black-holes in the Modem 
Science,” PAIOC 31, Poona 1984, 185-188. 

Bhattachaojee, Amulya Kumeir. [A5. 1981]. “Age of the Maha- 
bh^ata W6ir,” Proceedings of the First International Sanskrit 
Conference IV, New Delhi 1981, pp. 106-108. 

Bhattacharji, Sukmnari. [A5. 1982], “Fatalism—its Roots and 
Effects,” JIP 10, 1982, 134-154. 

Bhattacharya, Arupratzm. [A5. 1987]. Ancient Indian As¬ 

tronomical Terms and their Interpretations in the Light of 
Modern Astronomy, C£ilcutta 1987. 

Bhattacheu-ya, Bhabatosh. [A5. 1938]. “Raghunandana’s 

Indebtedness to Cemdesvara,” NIA 1, 1938, 534-535. 

-. [A5. 1946/47]. “Supplementeiry Portion of the Text of the 

Grhastha-ratndkara of C^mdesv^lra,” IC 13, 1946-47, 79-84. 

-. [A5. 1952/53]. “The Rdmdyana and its Influence upon 

Ball^a Sena and Raghunandema,” JOI Baroda 2, 1952-1953, 
18-22. 

-. [A5. 1955]. Raghunandana’s Indebtedness to his Predeces¬ 
sors, Calcutta 1955. 

-. [A5. 1967]. “The Semitary Regulations Prescribed 

by Candesvaira in his Grhastharatndkara," SVUOJ 10, 1967, 
37-45. 


Bhattacheuya, Bibhuti Bhushan. [A5. 1988]. “A Discussion 

about Some Discrep^mt or Obscure Formulae in the Mathe¬ 
matics: Europeem ^md Indiem,” JAS 30, 1988, 161-171. 

Bhattacheirya, Dipak. [A5. 1980]. “The Scheme of Four in Early 
Buddhism,” Bhdratibhdnam, PUIS 26, Hoshiarpur 1980, pp. 
291-298. 

Bhattacheirya, Sitesh Chemdra. [A5. 1977/78]. “Seirala capTya 
jatyatrikomgamta,” OH 25, 1977, 2, art. 8 (pp. 1-16), emd 
26, 1978, 1, art. 9 (pp. 17-32). 

Bhattacharyya, Asutosh. [A5. 1977]. The Sun and the Serpent 
Lore of Bengal, Cedcutta 1977. 

Bhattacharyya, Dinesh Chemdra. [A5. 1941]. “CiremjTva emd his 
patron Yasavanta Sirnha,” IHQ 17, 1941, 1-10. 

Bhattacharyya, Jagatbandhu. [A5. 1985]. “AryabhatTya DasagT- 
tika,” OH 33, 1985, 2, art. 11. 

Bhau DajT. [1865]. Reprinted in D. Chattopadhyaya [A5. 1982], 
vol. 2, pp. 518-536. 

Bhise, Usha R. [A5. 1977/78]. “Some Unknown Works of 

K^Inatha Upadhyaya,” JAS Bombay 52-53, 1977-78, 55-74. 

Bhola, Ishwar. [A5. 1984]. “Development of Indiem Astronomy 
at the Time of Aryabha^ I,” GB 6, 1984, 19-24. 

Billeird, Roger. [A5. 1977]. “Aryabhato and Indiem Astonomy,” 
IJHS 12, 1977, 207-224. 

-. [A5. 1986]. “Investigation du present Karanaratna," 

BEFEO 75, 1986, 21-36. 

Blempied, W. A. [A5. 1974]. “The Astronomical Program of 
Raja Sawai Jeii Singh II emd its Historical Context,” JSHS 13, 
1974,87-126. 

Bongeird-Levin, G. M. [A4. 1977/78]. Also in IJHS 12, 1977, 
187-193. 

Bosemquet,S. R. [A5. 1880]. Hindu Chronology and Antediluvian 
History, London 1880. 

Bose, Phanindra Nath. [A5. 1926]. Principles of Indian 

Silpasdstra, PSS 12, Leihore 1926. 

Braha, James T. [A5. 1986]. Ancient Hindu Astrology for the 
Modern Western Astrologer, Mieuni 1986. 

Brereton, Joel Peter. [A5. 1981]. The Rgvedic Adityas, AOS &3, 
New Haven 1981. 

Bruins, E. M. [A5. 1983]. “With Roots towards Aryabhate’s 
TT-value,” GB 5, 1983, 1-7. 

Biihler, Georg. [1894]. Reprinted in Rtambhard. Studies in 
Indology, Ghaziabad 1986, sect. II, pp. 106-115. 

Biilmemann, Gudrun. [A5. 1984]. “Some Remarks on the 

Stmcture emd Application of Hindu Sanskrit Stotreis,” WZKS 
28, 1984, 73-104. 

Burgess, Ebenezer. [i860]. The section entitled “The Astronom¬ 
ical Siddhdntas" reprinted in D. Chattopadhyaya [A5. 1982], 
vol. 2, pp. 503-509. 

CeiiUot, Collette, emd Ravi Kumeir. [A5. ?]. La cosmologie jaina, 
tremsl. into English by R. Normem eis The Jain Cosmology, 
Basel-Peiris-New Delhi 1981. 

Catm-vedi, ^ukadeva. [A5. 1973/74]. “PracTna Bharata mem 
rekhagemita,” ^riparamesvardnandasdstrismrtigrantha. New 
Delhi 1973-74, part III, pp. 97-105. 

Chaki, M. C. [A5. 1988]. “On an Attempt in India to Prove 
Euclid’s Fifth Postulate,” JAS 30, 1988, 119-127. 

Cheikraveirti, Chintaheiran. [A5. 1946]. “Muslim Patronage to 
Sanskrit Leeiming,” B. C. Law Volume, peut II, Poona 1946, 
176-182. 

Chetkraveu-ty, Aptuba Kumeir. See S. K. Chatterjee emd A. K. 
Cheikravarty [A5. 1985]. 

Chedcraveirty, A. K. [A5. 1980]. “Works of Seimuel Davis on 

Hindu Astronomy,” Bhdratibhdnam, PUIS 26, Hoshieirpur 
1980, pp. 491-495. 


BIBLIOGRAPHY 


XI 


-. [A5. 1987]. “The Asterisms,” History of Oriental 

Astronomy, Cctmbridge, 1987. 23-28. 

-. [A5. 1988]. “Astronomiced and C£Jendric£d Evidence in 

Early Indian Inscriptions,” JAS 30, 1988, 18-30. 

-. [A5. 1991]. “Some Studies on V^u■ahamihira,” IJHS 26, 

1991, 71-77. 

Chakrav£U'ty, Bani. [A5. 1968]. “The Acaracandrika, a Little- 
known Nibcuidha of ^rmatha Acarya Cudamam,” SVUOJ 11, 
1968, 21-25. 

-. [A5. 1974]. “A Compeirative Study of the Socicd 

Customs of Bengal and Mithila as Recorded in the Works 
of Raghim£mdctna and Vacaspati Misra,” SVUOJ 17, 1974, 
45-51. 

Chandel, Ncirender K., and Shaktidh^u•a Sharma. [A5. 1991]. 
“A Comparative Study on Cometary Records from the Brhat 
Samhita and Bhadrabahu Sarnhitd,” IJHS 26, 1991, 375-382. 

Cheumab£isappa, M. N. [A5. 1984]. “Mathematic£j Terminology 
Peculiar to the Bakhsh^ M£uiuscript,” GB 6, 1984, 13-18. 

Chatterjee, Asim Kvunar. [A5. 1980/82]. “Geography of the 
Rdmayana," JAIH 13, 1980-1982, 228-242. 

Chatterjee, Bhaskar. [A5. 1976]. “Iconographic Development of 
Sun-God in etirly North India,” PAIOC 27, Poona 1976, pp. 
409-413. 

Chatterjee, D. [A5. 1985]. “On Trisecting an Arbitrary Angle,” 
ME 19, 1985, 106-107. 

Chatterjee, H. (see H. C. Sastrl). [A5. 1978]. Studies in Some 
Aspects of Hindu Samskaras in Ancient India in the Light of 
Samskaratattva of Raghunandana, Calcutta 1978. 

Chatterjee, S. K., ^lnd A. K. Chakravarty [A5. 1985]. “Indian 
Ccdendar from Post-Vedic Period to A.D. 1900” in S. N. Sen 
and K. S. Shukla [A5. 1985], pp. 252-307. 

Chatterjee, S. K. [A5. 1987]. “Indicin Ccilendctrs,” History of 
Indian Astronomy, C£unbridge 1987, pp. 91-95. 

Chattopadhyaya, Debipreisad. [A5. 1977]. Science and Society 
in Ancient India, C^llcutta 1977; repr. 1979. 

-. [A5. 1982]. Studies in the History of Science in India, 

ed., 2 vols.. New Delhi 1982. 

Chaudhary, Bishwanath, eind Parmeshwar Jha. [A5. 1990]. 

“Studies of Bh^kara’s Works in Mithila,” GB 12, 1990, 
27-32. 

Chawdhri, L. R. [A5. 1979]. Complete Astro Palmistry, New 
Delhi 1979. 

-. [A5. 1983]. The Fascinating Jupiter, New Delhi 1983. 

Chawla, Jyotsna [A5. 1985]. “The Iconic Forms of Surya in the 
Rgveda," Proceedings of the Fifth World Sanskrit Conference, 
New Delhi 1985, pp. 482-487. 

Church, Cornelia Dimmitt. [A5. 1976]. “The Indian Yug«is eind 
the Magnus Annus in Ir^ln eind Greece,” Inde ancienne, Actes 
du XXIX^ Congres international des Orientalistes, Peiris 
1976, pp. 236-243. 

Chutia, Dhcirmeswar. [A5. 1988]. “A Note on ^ln Inscribed 

Sim-image Preserved in the Asscim State Museum,” JARS 30, 
1988, 50-56. 

Colebrooke, Henry Thomas. [1837]. Reprinted in 2 vols.. New 
Delhi 1977. 

Culeta, Dinanatha Sastrl. [A5. 1931]. Buddha parncdmga pra- 
vartaka kameit, Indaura kt sampurna riport, Indaura [1931]. 

Dagens, Bruno. [A5. 1977]. Les enseignements architecturaux de 
I’Ajitagama et du Rauravdgama, PIFI 57, Pondichery 1977. 

Dcde, J. B. [A5. 1895]. Indian Palmistry, London-Benares 1895. 

Dcimant, G. H. [A5. 1875]. “Notes on Hindu Chronograms,” lA 
4, 1875, 13-14. 

Das, D. R. [A5. 1975]. “The Vastubhusana-A Newly Discovered 
Text on Architecture,” JBRS 61, 1975, 79-87. 


D^ls, S. K. [A5. 1986]. Everybody’s Guide to Palmistry, New 
Delhi-Bangalore 1986. 

Dass, Ayodhya Chamdra. [A5. 1979]. “Sun-worship in the 

Principad Upeinishads,” Meerut University Sanskrit Research 
Journal 4, 1979, 2, 1-9. 

-. [A5. 1981]. “Pre-Puramc Form of Sun-worship in 

Atharvaveda-Sarhhitd,” VIJ 19, 1981, 20-29. 

-. [A5. 1984]. Sun-worship in Indo-Aryan Religion and 

Mythology, Delhi 1984. 

Datta, Bibhutibhusan, ^uld Avadhesh Narayan Singh, revised by 
Kripa Shankar Shukla. [A5. 1980]. “Hindu Geometry,” IJHS 
15,1980,121-188. V 

-. [A5. 1983]. “Hindu Trigonometry,”18, 1983, 39-108. 

-. [A5. 1984]. “Use of CeJculus in Hindu Mathematics,” 

IJHS 19, 1984, 95-104. 

Datta, B. B. [1929b]. Reprinted in D. Chattopadhyaya [A5. 
1982], vol. 2, pp. 684-716. 

Davane, G. V. [A5. 1974/76]. “The Moon in the Vedic 

Literature,” JAS Bombay 49-51, 1974-1976, 75-83. 

Deodhar, Pramila. [A5. 1990]. “Recreations in Mathematics: 
With Special Reference to Ganita Kaumudi of Narayaina (1356 
A.D.),” BDC 50, 1990, 193-196. 

Desai, Nileshvciri Y. [A5. 1979]. “Glimpses from Astrology and 
Chiromancy in the Markandeya Purana,” Purdna 21, 1979, 
100-107. 

Desai, S. G. [A5. 1967]. “The Minor Deities,” Bhdrattya Vidyd 
27, 1967, 25-40. 

Dethier, Jean. [A5. 1985]. L’astrologie de I’Inde, St.-Jean-de- 
Braye 1985. 

Devaisthali, G. V. [A5. 1945]. “Harsa, the Author of the 

Ahka-yantra-cintamam & His Relatives,” B. C. Law Volume, 
part I, CeJcutta 1945, pp. 496-503. 

Devra, G. L. See S. S. Geihlot emd G. L. Devra [A5. 1980]. 

de Young, Gregg. [A5. 1986]. “The Khulasat al-Hisab of Beiha’ 
al-Dln eJ-‘Amilr and the Dar-i-NizamI in India,” GB 8, 1986, 
1-15. 

Dhami, S. L. [A5. 1977]. “Manvantara Theory of Evolution of 
Solar System £ind Aryabhato,” IJHS 12, 1977, 161-166. 

Dhav£de, D. G. [A5. 1967]. “The Astronomiced Method £ind 

Indiam Chronology,” SVUOJ 10, 1967, 1-6. Reprinted in 
Science and Human Progress, Bombay 1974, pp. 184-189. 

-. [A5. 1981]. “The Brahmasiddhanta of Sakedya Samhita,” 

Proceedings of the First International Sanskrit Conference III 
2, New Delhi 1981, pp. 230-242. 

Dietz, Siglinde. [A5. 1989]. “Remarks on a Fragmentary List of 
Kings of Magadha in a Lokaprajnapti Fragment,” WZKS 33, 
1989, 121-127. 

d’Occhieppo, K. Ferrari. [A5. 1979]. “Datierbarkeit des Horo- 
skops im I Buch des Epos Ramayam,” WZKS 23, 1979, 
109-116. 

Dohgare, Narayana Gopala. [A5. 1979]. Vaisesikasiddhdntdndrn 
ganitiyapaddhatyd vimarsah, Varanasi 1979. 

Dube, Mahesa. [A5. 1991]. “Kavi aura geimtajha: M^dlavIracar- 
ya,” AV3, 1991, 1, 1-26. 

Dutt, Sukomal. [A5. 1988]. “Bibhuti Bhusan Datta (1888-1958) 
or Swami Vidyareinya,” GB 10, 1988, 3-15. 

Dvivedr, Krsnaccindra. [A5. 1980/81]. “Grahavarnasamuhah, 
tadutpattis ca,” Sarasvati Susamd 35, 1980-81, 237-248. 

Dvivedin, Sudhakara. [1892]. Reprinted as Hemanta Sanskrit 
Series 2, V^^asT 1986. 

Dwivedi, R. P. [A5. 1988/89]. “Kalidasa’s Meghaduta find 

V^tusastra,” JOI Baroda 38, 1988-89, 279-289. 

Dwivedi, Radhey Shieim. [A5. 1979]. “The Time of Bharata 
War” in G. C. Agarwala [A5. 1979], pp. 319-320. 

Dwivedi, Vinod Prakash. [A5. 1980]. Bdrahmdsd, Delhi 1980. 


Xll 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Eilers, Wilhelm. [A5. 1976]. Sinn und Herkunft der Planeten- 
namen, Miinchen 1976. 

Elfering, Kmt. [A5. 1977]. “The Area of a Triangle and the 
Volimie of a Pyr 2 inud as well as the Area of a Circle cind the 
Smface of the Hemisphere in the Mathematics of Aryabhate 

I, ” IJHS 12, 1977, 232-236. 

Euringer, Florian. [A5. 1989]. Indische Astrologie. Die 27 

Frauen des Mondes, Miinchen 1989. 

Fairaut, F. G. [A5. 1910]. Astronomie cambodgienne, Phnom- 
Penh 1910. 

Filliozat, Jean. [1955/56]. Reprinted in D. Chattopadhyaya [A5. 
1982], vol. 2, pp. 767-775. 

Filliozat, Pierre-Sylvain, and Guy Mazars. [A5. 1985]. “Ob¬ 
servations sur la formule du volvune de la pyramide et de la 
sphere chez Aryabhate,” BEI 3, 1985, 37-48. 

-. [A5. 1987]. “La terminologie et recrittire des fractions 

dems la litterature mathematique sanskrite,” BEI 5, 1987, 
67-96. 

FiUiozat, P.-S. [A5. 1984]. “The French Institute of Indology in 
Pondicherry,” WZKS 28, 1984, 133-147. 

-. [A5. 1988]. “C^Jcvds de demi-cordes d’£ircs p^u• Aryabha^ 

et Bhaskara I,” BEI 6, 1988, 255-274. 

Fleet, J. F. [1911a]. Reprinted in D. Chattopadhyaya [A5. 1982], 
vol. 2, pp. 739-750. 

Forbes, Eric G. [A5. 1977]. “Mesopotamian and Greek Influences 
on Ancient Indian Astronomy and on the Work of Aryabha^,” 
IJHS 12, 1977, 150-160. 

-. [A5. 1982]. “The Emopecm AstronomiccJ Tradition: its 

Transmission into India, emd its Reception by Sawai Jai Singh 

II, ” IJHS 17, 1982, 234-243. 

Fuller, C. J. [A5. 1980]. “The Ccdendrical System in T^mlilnadu 
(South India),” JRAS, 1980, 52-63. 

Gaihlot, Poomima. [A5. 1979]. Ready Reckoner for Indian Eras, 
Jodhpur 1979. 

Gahlot, Sukhvir Singh, and G. L. Devra. [A5. 1980]. Indian 
Calendars, A.D. 1444 to A.D. 1543, Jodhpur 1980. 

Geihlot, Sukhvir Singh. [A5. 1979]. Historians’ Calendar, 1544 
A.D. to 1643 A.D., Jodhpur 1979. 

Gai, G. S. [A5. 1961/62]. “Gadivore Gr 2 mt of Shashthadeva (II), 
KaU Year 4357,” El 34, 1961-62, 105-110. 

Gail, Adalbert. [A5. 1980]. “Planets and Pseudoplcmets in 

Indian Literature ^md Art with Specieil Reference to Nep^J,” 
Proceedings of the First Symposium of Nepali and German 
Sanskritists 1978, Kathm«mdu 1980, pp. 121-136. 

G£mgadh 2 Lran, N. [A5. 1978]. “The Saurapa^Ir^kamatas^tmar- 
th^ma of Nll 2 ikantha Caturdhara,” AOR 28, 1, 1978, S£mskrit 
section, 2 u-t. 6. 

-. [A5. 1981]. “Certmn Geographical Concepts in the 

Puranas,” Purina 23, 1981, 161-164. 

Gamtanand [A5. 1986]. “When There W^ls No Unity in the 
Number-land,” GB 8, 1986, 44-45. 

-. [A5. 1988]. “In the Name of Vedic Mathematics,” GB 10, 

1988, 75-78. 

-. [A5. 1990a]. “The L 2 ik^ Scede of the Valmlki Ramayam 

and Rama’s Army,” GB 12, 1990, 10-16. 

-. [A5. 1990b]. “A Few Rem 2 U'ks Concerning Certmn V^dues 

of TT in Ancient India,” GB 12, 1990, 33-38. 

Ghori, S. A. Khein [A5. 1985]. “Development of Zlj Literature in 
India” in S. N. Sen amd K. S. Shukla [A5. 1985], pp. 21-48. 

Giordimo, Ferruccio Ducrey. [A5. 1973]. Jai Singh e i suoi 

giardini astronomici, Torino 1973. 

Gode, P. K. [A5. ?]. “Some Contemporciry Manuscripts of the 
Works of Nllakantha Caturdh^lra, the Commentator of the 
Maihabharata-Between A.D. 1687 ^md 1695,” JTSML 4, 1, ?, 
1-7; repr. in P. K. Gode [1953/56], vol. 2, pp. 491-498. 


-. [A5. 1942]. “Nll£ik£mtha Caturdhara, the Commentator of 

the Mahabh^ata-His Geneedogy and Descendants,” ABORI 
23, 1942, 141-161; repr. in P. K. Gode [1953/56], vol. 2, pp. 
476-490. 

Gokani, Puskar. [A5. 1978/79]. “Shree Shankaracharyaji 

through the Signs of Zodiac,” ^aradapithapradipa 18-19, 
1978-79, pt. 1, 71-78. 

Gold, David, emd David Pingree. [A5. 1991]. “A Hitherto 

Unknown S^mskrit Work concerning Madhava’s Derivation of 
the Power Series for Sine £md Cosine,” Historia Scientiarum 
42, 1991,49-65. 

Gonda, J. [A5. 1984]. Prajapati and the Year, Amsterdam- 

Oxford-New York 1984. 

Gopal, Lall^mji. [A5. 1973]. “The Date of the Krsi-Pareisara,” 
JIH, 1973, 151-168. 

-. [A5. 1980/82]. “Krtyakalpat 2 um Quotation from Br^dlma- 

puraM on Aristas,” JAIH 13, 1980-1982, 57-64. 

-. [A5. 1982]. “Visnudhaxmottara Purana on Aristais,” 

Purina 24, 1982, 63-78. 

Gop£mi, A. S. [l942/43a]. Reprinted in his Some Aspects of 
Indian Culture, LDS 78, Ahmedabad 1981, pp. 170-199. 

-. [A5. 1947]. “Some of the Missing Links in the History of 

Astrology,” Bhiratiya Vidyi 8, 1947, 135-139 and 197-199. 

Gori, S. A. Khan. [A5. 1980]. “Impact of Modem Europe£m 
Astronomy on Raja J£d Singh,” IJHS 15, 1980, 50-57. 

Goswami, Alpana. [A5. 1976]. “Udvahatattv^lm,” Anviksi 7, 
1976, S^mskrit peu-t, 37-47. 

Govind, Vijcd. See K. Behari and V. Govind [A5. 1980]. 

-. [A5. 1979]. “A Sm-vey of Medieval Indian Astrolabes,” 

Bhiratiya Vidyi 39, 1979, 1-30. 

Goyal, S. C. [A5. 1976]. “Science in Vedas,” SVUOJ 19, 1976, 
101-107. 

Growse, F. R. [A5. 1874]. “Notes on Prof. Hoemle’s Tr^mslation 
of the 27th Canto of Chand,” I A 3, 1874, 339-341. 

Gupta, M. L. [A5. 1974/79]. “Truths about the Solar System as 
Revealed in the Rigveda” (= “Scientific Tmths as Reveeded in 
the Rigveda”), Bhiratisodhasirasahgraha 2, 4, 1974-75, 1-2, 
9-13; 2, 5, 1975-76, 1-2, 25-33; and 2, 7, 1978-79, 3-4, 1-22. 

Gupta, P. L. [A5. 1979]. Ancient Indian Numerals, 2 ch^u•ts, 
Delhi [1979]. 

Gupta, Radha Ch^lran. [A5. 1976]. “Madhava’s Power Series 
Computation of the Sine,” Ganita 27, 1976, 19-24. 

-. [A5. 1977]. “On Some Mathematic^d Rules from the 

Aryabhatlya,” IJHS 12, 1977, 200-206. 

-. [A5. 1978]. “Indian Values of the Sinus Totus,” IJHS 13, 

1978, 125-143. 

-. [A5. 1979a]. “Mimlsv 2 ira’s Modification of Brahmagupta’s 

Rule for Second Order Interpolation,” IJHS 14, 1979, 66-72. 

-. [A5. 1979b]. “Time-edtitude and Altitude-azimuth 

Equations in Hindu Astronomy,” VIJ 17, 1979, 256-263. 

-. [A5. 1980a]. “Citrabhanu: a Little Known Mathematiciam 

of Medieval India,” Bhiratihhinam, PUIS 26, Hoshi^up^u• 
1980, pp. 485-490. 

-. [A5. 1980b]. “Indian Mathematics and Astronomy in 

Eleventh-Centvu-y Spain,” GB 2, 1980, 53-57. 

-. [A5. 1980c]. “Bibhutibhusan Datta (1888-1958), Histori£m 

of Indi£m Mathematics,” HM 7, 1980, 126-133. 

-. [A5. 1980d]. “The Marici Commentary on the Jyotpatti," 

IJHS 15, 1980, 44-49. 

-. [A5. 1980e]. “Some Import£mt Mathematical Methods 

as Conceived in Ancient India,” Proceedings of the First 
International Sanskrit Conference III 1, New Delhi 1980, pp. 
218-229. 

-. [A5. 1981a]. “The Process of Averaging in Ancient and 

Medievad Mathematics,” GB 3, 1981, 32-42. 


BIBLIOGRAPHY 


Xlll 


-. [A5. 1981b]. “A Bibliography of Selected S 2 uiskrit 

and Allied Works on Indietn Mathematics emd Mathematical 
Astronomy” GB 3, 1981,86-102. 

-. [A5. 1981c]. “Centenary of B^tksha]I Manuscript’s 

Discovery,” GB 3, 1981, 103-105. 

-. [A5. 1981d]. “Indian Astronomy in China during Ancient 

Times,” VIJ 19, 1981, 266-276. 

-. [A5. 1982a]. “Indian Mathematics Abroad up to the Tenth 

Centm-y A.D.,” GB 4, 1982, 10-16. 

-. [A5. 1982b]. “Indi^ul Astronomy in West Asia,” VIJ 20, 

1982, 219-236. 

-. [A5. 1983a]. “Decimal Denomination^d Terms in Ancient 

amd MedieveJ India,” GB 5, 1983, 8-15. 

-. [A5. 1983b]. “Spread £md Triiunph of Indiem Numereds,” 

IJHS 18, 1983, 23-38. 

-. [A5. 1984]. “Mathematics of the Mediavedi,” VIJ 22, 1984, 

1-9. 

-. [A5. 1985a]. “On Some Ancient emd Medieved Methods of 

Approximating Quadratic Surds,” GB 7, 1985, 13-22. 

-. [A5. 1985b]. “Jinabhadra Gemi emd Segment of a Circle 

between Two Peiredlel Chords,” GB 7, 1985, 25-26. 

-. [A5. 1986a]. “MediavTrac^ya’s Rule for the Voliune of 

Frustiun-like Solids,” A JOS 3, 1986, 31-38. 

-. [A5. 1986b]. “On Derivation of Bhaskara I’s Formula for 

the Sine,” GB 8, 1986, 39-41. 

-. [A5. 1986c]. “Some Equalization Problems from the 

Beddishalr Memuscript,” IJHS 21, 1986, 51-61. 

-. [A5. 1986d]. “Madhavacemdra’s emd Other Octagonal 

Derivations of the Jedna Vedue TT = VTO,” IJHS 21, 1986, 
131-139. 

-. [A5. 1986e]. “Highlights of Mathematical Developments 

in India before Newton,” ME 20, 1986, 131-138. 

-. [A5. 1987a]. “South Indiem Achievements in Medieval 

Mathematics,” GB 9, 1987, 15-40. 

-. [A5. 1987b]. “Madhava’s Rule for Finding Angle between 

the Ecliptic emd the Horizon emd Aryabhato’s Knowledge of 
it,” History of Oriental Astronomy, Cambridge 1987, pp. 
197-202. 

-. [A5. 1988a]. “New Indiem Vedues of TT from the Mdnava 

sulba sutra," Centaurus 31, 1988, 114-125. 

-. [A5. 1988b]. “Volume of a Sphere in Ancient Indiem 

Mathematics,” JAS 30, 1988, 128-140. 

-. [A5. 1989a]. “On Some Rules from Jedna Mathematics,” 

GR 11, 1989, 18-26. 

-. [A5. 1989b]. “Sino-Indian Interaction emd the Great 

Chinese Buddhist Astronomer-Mathematiciem I-Hsing (A.D. 
683-727),” GB 11, 1989, 38-49. 

-. [A5. 1990a]. “The Chronic Problem of Ancient Indiem 

Chronology,” GB 12, 1990, 17-26. 

-. [A5. 1990b]. “The Vedue of TT in the Mediabh^ata,” GB 

12, 1990, 45-47. 

Habib, Irfem. [A5. 1977]. “Cartography in Mughal India,” 

Medieval India 4, 1977, 122-134. 

-. [A5. 1985]. Medieval Technology Exchanges between India 

and the Islamic World, Aligarh OS 6, Aligeirh 1985. 

Haddad, Fuad I., David Pingree, and E. S. Kennedy. [A5. 1984]. 
“Al-BTrunI’s Treatise on Astrological Lots,” Zeitschrift fur 
Geschichte der Arabisch-Islamischen Wissenschaften 1, 1984, 
9-54. 

Heu-iheu-an, S. [A5. 1988a]. “A Note on Keiremaratna of Devacar- 
ya,” GB 10, 1988, 64-68. 

-. [A5. 1988b]. “Declination in Indian Astronomy emd the 

Approach of Kerala Astronomers,” JAS 30, 1988, 39-49. 


Hayeishi, T., T. Kusuba, and M. Yemo. [A5. 1990]. “The 

Correction of the Madhava Series for the Circumference of a 
Circle,” Centaurus 33, 1990, 149-174. 

Hayashi, Tedcao [A5. 1979]. “Permutations, Combinations emd 
Enumerations in Ancient India,” KK 2, 18, 1979, 158-171. 

-. [A5. 1986a]. “Hojinzem: A Japemese Tremslation of 

Chapter 14 of Narayema’s Ganitakaumudi," Episteme II 3, 
1986, i-xxxiv. 

-. [A5. 1986b]. “The Cheirming RemjinI—A Geune of 

Medieved India,” SK 108, 1986, 28-34 (in Japemese). 

-. [A5. 1987a]. “Ritual Application of Mensuration Rules 

in India: An Edition of Gemesa’s Kundasiddyudahrti with 
Mathematiced Commenteuy,” BNME 12, 1987, 199-224. 

-. [A5. 1987b]. “Bhaskeu'a IPs Bijaganita," Chusei no 

Sugaku, Tokyo 1987, pp. 429-465 (in Japemese). 

-. [A5. 1987c]. “Veiraheunihira’s Pemdiagonal Magic Square 

of the Order Four,” HM 14, 1987, 159-166. 

-. [A5. 1987d]. “The Unknown ya in the Beddishedi Memu¬ 
script,” Journal of Indian and Buddhist Studies 36, 1987, 
4^1-445 (in Japemese). 

-. [A5. 1988a]. “A Prelimineuy Study in the History of 

Magic Squares before the Seventeenth Century,” BNME 13, 
1988, 615-719 (in Japanese). 

-. [A5. 1988b]. “Magic Squeires in Indiem Medieval Works,” 

The Science and Engineering Review of Doshisha University 
■28, 1988, 231-243 (in Japanese). 

-. [A5. 1988c]. “Mind Reading—a Mathematiced Geune of 

Medieved India,” SK 116, 1988, 9-23 (in Japemese). 

-. [A5. 1990a]. “Narayema’s Rule for a Segment of a Circle,” 

GB 12, 1990, 1-9. 

-. [A5. 1990b]. “A New Indiem Rule for the Squeu-ing of a 

Circle: M^aveisulbeisutra 3.2.9-10,” GB 12, 1990, 75-82. 

-. [A5. 1990c]. “The Words of a Courtesem: A True-False 

Problem in Indiem Mathematics,” KK II 29, 1990, 93-100 (in 
Japanese). 

-. [A5. 1991a]. “A Note on Bhaskeu-a I’s Rational 

Approximation to Sine,” Historia Scientiarum 42, 1991, 45- 
48. 

-. [A5. 1991b]. “The PamcavimiahTa in its Two Recensions,” 

IJHS 26, 1991, 395-448. 

Hazra, Rajendra Chemdra [A5. 1933]. “Influence of Temtra on 
the Tattveis of Raghunemdema,” IHQ 9, 1933, 678-704. 

-. [A5. 1950]. “A Note on Sm^ta Raghunemdema’s Works 

emd Time,” Bharatiya Vidyd 11, 1950, 178-182. 

Hermelink, H. [A5. 1978]. “Arabic Recreational Mathematics eis 
a Mirror of Age-old Cultured Relations between Eeistem emd 
Western Civilizations,” Proceedings of the First International 
Symposium for the History of Arabic Science, vol. 2, Aleppo 
1978, pp. 44-54. 

HiUebremdt, Alfred. [A5. 1889]. “Die Sonnwendfeste in Alt- 

Indien,” Romanische Forschungen 5, 1889, 299-340; repr. in 
A. HiUebremdt [A5. 1987], pp. 74-115. 

-. [A5. 1924/25]. “Der Nachtweg der Sonne,” Zeitschrift 

fur Buddhismus und verwandte Gebiete 6, 1924/25, 114-117; 
repr. in A. HiUebremdt [A5. 1987], pp. 250-253. 

-. [A5. 1987]. Kleine Schriften, Glasenapp-Stiftung 28, 

Stuttgart 1987. 

Hoemle, A. F. R. [1888b]. Reprinted in D. Chattopadhyaya [A5. 
1982], vol. 2, pp. 655-683. 

Hooda, D. S. [A5. 1979]. “Aryabhata,” GB 1, 1979, 12. 

Huberty, Lila. See V. N. Sheirmaemd L. Huberty. [A5. 1984]. 

Hultzsch, Eugen. [A5. 1879]. Prolegomena zu des Vasantardja 
Sdkuna nebst Textproben, Leipzig 1879. 

IngUs, Grace. [A5. 1973]. Hindu Dasa System, New Delhi 1973. 


XIV 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Iyengar, G. S. S£impath, and G. S. Sheshagiri [A5. 1979]. “Date 
of the Meihabharata War: Simunary” in G. C. Ag^lrw^Ja. [A5. 
1979], pp. 240-247. 

-. [A5. 1980]. Ancient Hindu Astronomy, Madr£is 1980. 

Iyengar, G. S. Sampath. [A5. 1987/88]. “Astronomy in Rgveda,” 
JOI Baroda 37, 1987-88, 191-194. 

Jacobi, Hermeinn [A3. 1894]. Reprinted in Rtambhard. Studies 
in Indology, Ghaziabad 1986, sect. II, pp. 91-97 (with an 
appendix). 

Jaggi, O. P. [A5. 1986]. History of Science, Technology 

and Medicine in India, vol. 6: Indian Astronomy and 
Mathematics, DeUii-Lucknow 1986. 

Jciina, Abhaya Prakasa. [A5. 1991]. “Khagola sastra eveun Jmna 
jyotisa kl pracTnata,” AV 3, 1991, 3, 43-47. 

Jaina, Anupama. See. L. C. Jaina 2 tnd A. Jaina. [A5. 1988/89]. 

Jmna, Anupeima, and Jayacandra Jctina. [A5. 1988/89]. “Kya 
srTdheira Jmna the?,” API, 1988-89, 2, 49-54. 

Jmna, Anupeuni^, and Suresacandra Agrav^a. [A5. 1985]. 

Mahdvirdcarya. Eka samiksatmaka adhyayana, Meerut 1985. 

-. [A5. 1988/89a]. “Jeiina ganitlya sahitya,” AV 1, 1988-89, 

1, 19-40. 

-. [A5. 1988/89b]. “Jctina gatnitajha—Mahavlracarya,” AV 

1, 1988-89, 1, 41-46. 

Jctin, Anupam. [A5. 1981]. “Contribution of Jctinacaryas to the 
Development of Mathematics,” GB 3, 1981, 43-44 (in Hindi). 

-. [A5. 1982]. “ Some Unknown Jaina Mathematical Works,” 

GB 4, 1982, 61-71 (in Hindi). 

-. [A5. 1984]. “Mahavlracarya, the Man 2 tnd the Mathemati¬ 
cian,” Acta Sciencia Indica 10, 4, 1984, 275-280. 

-. [A5. 1988/89a]. “Acarya Kimdakunda ke sahitya me 

vidyeimana ganitlya tattva,” AV 1, 1988-89, 1, 47-52. 

-. [A5. 1988/89b]. “Madhavacandra evam unetkl sattrimsi- 

ka,” API, 1988-89, 1, 65-74. 

-. [A5. 1988/89c]. “Darseinika ganitajha—Acarya Yativrea- 

bha,” API, 1988-89, 2, 17-24. 

-. [A5. 1988/89d]. “Darsetnika g^trutajha—Acarya Viretsena,” 

API, 1988-89, 2, 25-37. 

-. [A5. 1988/89e]. “Jaina ganita petra eka aura cmtcirrastrlya 

scimgosthl kl upadayeta,” API, 1988-89, 2, 65-67. 

-. [A5. 1989/90]. “Vacana kosa ke ganitlya amsa,” AP 2, 

1989-90, 2, 71-74. 

Jaina, Cakresa Kiunara. See L. C. Jaina and C. K. Jaina. [A5. 
1989/90]. 

-. [A5. 1988/89]. “The Jctina Geography, the Digambara 

Jaina J^tmbudvipa, etnd the Modem Context,” API, 1988-89, 
4, 19-20. 

Jaina, JagadTsacandra. [A5. 1977]. “^ctkima sastra—peisupaka- 
yom ka sastra,” Tulasx Prajhd, J^tn.-M^trch 1977, 24-30. 

Jaina, Jayacandra. See A. Jaina and J. Jaina [A5. 1988/89]. 

Jain, Jyoti Pretsad [A5. 1948/49]. “The Birthplace of Dhavala &: 
Jayadhavatla,” Jaina Ant. 14, 1948-49, 46-57. 

Jetina, Kamata Pr 2 tsada. [A5. 1938/39]. “^rlpadmanandi 

viracita ‘J^tmbudvIpa-prajnapti-samgr^tha’,” Jainasiddhdnta- 
hhdskara 5, 1938-1939, 172-175. 

Jatina, Letksmicandra, and Vedapr 2 tkasa. [A5. 1976]. “Adhimika 
gctnitlya sodha ke sandarbha mern jaina gatnita ka purveksa- 
na,” Tulasx Prajhd, April-Jime 1976, 67-78. 

Jaina, LatksmI C^tndra, atnd Anup^tma Jmna [A5. 1988/89]. “Kya 
ac^ya K\md£tkunda d£tsarha paddhati ke aviskaraka the?,” 
A P 1, 1988-89, 3, 7-15. 

Jctina, LctksmI Candra, and Catkresa Ktunara Jmna. [A5. 1989/- 
90]. “Jctmbudvipa paripreksya,” AP 2, 1989-90, 2, 55-62. 

Jaina, Laksmicandra. [A5. 1973]. “Bharatiya gamtats^tra aura 
jetina lokottara ganita,” Anusandhdna Patrikd 2, April-Jime 
1973, I 20-37. 


-. [A5. 1973/75]. “Mathematic 2 j Foundations of Ketrma 

Quetntum System Theory,” Anusandhdna Patrikd 4, Oct.- 
Dec. 1973, II 1-19, etnd Tulasx Prajhd, July-Sept. 1975, 
77-79. 

-. [A5. 1975a]. “Jaina School of Mathematics,” Contribution 

of Jainism to Indian Culture, Delhi-Varemasi-Patna 1975, pp. 
206-220. 

-. [A5. 1975b]. “Kinematics of the Sim emd the Moon in 

Tiloyapetnnatti,” Tulasx Prajhd, Jan.-March 1975, 60-67. 

-. [A5. 1976]. “The Principle of Relativity in Jain School of 

Mathematics,” Tulasx Prajhd, Jetn.-Metrch 1976, 20-28. 

-. [A5. 1977a]. “Aryabhate I etnd Yativrsabha—A Study in 

Kalya and Merit,” IJHS 12, 1977, 137-146. 

-. [A5. 1977b]. “On the Contributions, Trctnsmissions 

& Influences of the Jctina School of Mathematical Sciences,” 
Tulasx Prajhd, Oct.-Dec. 1977, 121-134. 

-. [A5. 1978]. “On the Spiro-elliptic Motion of the Sim 

Implicit in the Tiloyayannattx," IJHS 13, 1978, 42-49. 

-. [A5. 1979]. “System Theory in Jaina School of Mathemat¬ 
ics,” IJHS 14, 1979, 31-65. 

-. [A5. 1982/83]. Exact Sciences from Jaina Sources, 

vol. 1: Basic Mathematics, Jctipur-New Delhi 1982; vol. 2: 
Astronomy and Cosmology, Jaipur-New Delhi 1983. 

-. [A5. 1988/89]. “Acarya Nemicetndra siddhanta Cctkravetrtl 

kl khagola vidya evam ganita sctmbandhi manyataem—adhu- 
nika sand£trbha mem,” API, 1988-89, 1, 75-90. 

-. [A5. 1989/90a]. “Brahml lipika aviskara evetm acarya 

Bhadrab^u muni sahgha,” AP 2, 1989-90, 2, 17-26, and 3, 
1-12. 

-. [A5. 1989/90b]. “Digctmbara Jctina gremthoin mein bindu, 

vrtta, rekha aura tribhuja,” AP 2, 1989-90, 4, 9-12. 

-. [A5. 1989/90c]. “Origination «tnd Ch^tracteristic of Jctina 

Mathematics,” AP 2, 1989-90, 4, 73-75. 

-. [A5. 1991a]. “Subject Matter of the Labdhisara,” AP 3, 

1991, 1, 27-37. 

-. [A5. 1991b]. “Mula Namdi S£tmgha Acarya ^rl Kun- 

dakunda ka S£tmaya Nirdharana,” AP 3, 1991, 3, 33-41. 

Jain, Manik Chand. [A5. 1977]. Zodiacal Constellations, Delhi 
1977. 

-. [A5. 1980]. Karmic Control Planets, Delhi 1980. 

-. [A5. 1985]. Astrology in Marriage Counselling, 3rd ed.. 

New Delhi 1985. 

Jmna, Nemicctndra. [A5. 1939/40a]. “Acarya Nemic^tndra aura 
jyotisa-sastra,” Jainasiddhdntabhdskara 6, 1939-40, 93-101. 

-. [A5. 1939/40b]. “Gommate-murti kl pratisthakallna kun- 

dctll ka phala,” Jainasiddhdntabhdskara 6, 1939-40, 261-266. 

-. [A5. 1941]. “Jaina pancamga,” Jainasiddhdntabhdskara 8, 

1941, 74-80. 

-. [A5. 1942]. “Kevalajnanaprasnacudamani,” Jainasid¬ 
dhdntabhdskara 9, 1942, 81-83. 

-. [A5. 1945/46a]. “Svapna aura usetka pheJa,” Jainasid¬ 
dhdntabhdskara 12, 1945-46, 1, 25-33. 

-. [A5. 1945/46b]. “Jmnacarya Rsiputra ka samaya aura 

unaka jyotisa-jnana,” Jainasiddhdntabhdskara 12, 1945-46, 2, 
24-29. 

-. [A5. 1946/47]. “Rista setmuccaya,” Jainasiddhdntabhds¬ 
kara 13, 1946-47, 106-111. 

-. [A5. 1947/48]. “^rldharacarya,” Jainasiddhdntabhdskara 

14, 1947-48, 31-42. 

Jetin, Nem Kumetr. [A5. 1982]. Science and Scientists in India 
(Vedic to Modern), Delhi 1982. 

Jetin, N. L. [A5. 1985/86]. “Units of Length in Jaina C^tnnons,” 
Jaina Journal 20, 1985-86, 94-111. 


BIBLIOGRAPHY 


XV 


Jaina, Paramananda [A5. 1939/40]. “^ravaM krena pratipadald 
smareiruya tithi aura VTrMas£Uia-jay£mtr,” Jainasiddhania- 
bhdskara 6, 1939-40, 55-58. 

Jain, S. C. [A5. 1989/90]. “Jambudvipa and its Two Sims,” AV 
2, 1989-90, 1, 21-27. 

Jakatad^a, Krena An£inta [A5. 1970]. Sarnkhydsdstra, Pune 

1970. 

Jalali, S. Farrukh AU, and S. M. R. Ansari. [A5. 1985]. “Per- 
si^ln Translation of Varah^unihira’s Brhats 2 unhita,” Studies in 
History of Medicine and Science 9, 1985, 161-169. 

Jani, H. M., B. H. Yagnic, and B. G. Shukla. [A5. 1984]. 

“Origin and Development of the Muhurta Branch £md the 
Book Ath^u-va Vedanga Jyotis,” Sciences and the Vedas, 
Bombay-Madrais-New Delhi 1984, pp. 62-69. 

Jervis, T. B. [A5. 1835]. Records of Ancient Science, Calcutta 
1835. 

Jha, Amoda. [A5. 1983/84]. “Jyotise mcuthileJuta gr^mthah,” 
Sarvamanisd 7, 1983-84, 3, 57-67. 

Jha, Damodara. [A5. 1982]. “Ganitanteiriksavijnanayoh seunskr- 
t^lsya yogad^am,” Proceedings of the First International 
Sanskrit Conference V, New Delhi 1982, pp. 173-176. 

Jha, G^mganand. [A5. 1978]. “AnalyticeJ Geometry in Ancient 
Hindu Mathematics,” ME 12, 1978, 1, 25-27. 

Jha, P^lrmeshwar. See B. Chaudhjiry emd P. Jha. [A5. 1990]. 

-. [A5. 1982a]. “Historical Background of Mathematics and 

Astronomy in Mithila,” GB 4, 1982, 26-40. 

-. [A5. 1982b]. “Aryabhate I jmd the Science of Algebra,” 

VIJ 20, 1982, 237-242. 

-. [A5. 1985]. “Astronomical Principles in Narada-Purdna," 

VIJ 23, 1985, 156-162. 

-. [A5. 1987]. “Mm. Hemahgada Thakura and his Work 

‘Rahupciragapanji’,” ME 21, 1987, 2, 38-43. 

-. [A5. 1988a]. Aryabhata I and his Contributions to 

Mathematics, Patna 1988. 

-. [A5. 1988b]. “Study of History of Mathematics in Bihar,” 

GB 10, 1988, 59-63. 

-. [A5. 1988c]. “Algebra 2 md Algebraic Equations in Ancient 

India,” JAS 30, 1988, 112-118. 

-. [A5. 1988/89]. “Contributions of Jainac^lry^ls to Mathe¬ 
matics & Astronomy,” AV 1, 1988-89, 1, 103-112. 

-. [A5. 1989/90]. “Jaina Astronomiccd Texts Belonging to 

the Pre-siddhantic Period of Ancient India,” AV 2, 1989-90, 
2, 5-10. 

Jha, Ramadeva [A5. 1973]. “Jyotisa puranayo dretya suryavica- 
ra,” Adhyayanamdld 1, 1973, 123-132. 

-. [A5. 1973/74]. “Jyautisapuranayor dretya candravicara,” 

Sri-paramesvardnandasdstrismrtigrantha, New Delhi 1973—74, 
part III, pp. 154-162. 

Jha, Sachchidanand. [A5. 1978]. “A Critical Study on 

Braihmagupta £md Mahavlracarya and their Contributions in 
the Field of Mathematics,” ME 12, 1978, 4, 66-69. 

Jha, S^lrvan^ay^ma. [A5. 1983/84a]. “Saurapariv^^tsyotpat- 
tih,” Sarvamanisd 7, 1983-84, 2, 57-61. 

-. [A5. 1983/84b]. “Pcihc^gesv ekarupata kathfim syat,” 

Visvamanisd 7, 1983-84, 4, 38-41. 

Jha, Visvanatha. [A5. 1982]. “Jyotise rajainitih,” Proceedings 
of the First International Sanskrit Conference V, New Delhi 
1982, pp. 101-117. 

Jha, Y^ls^lspati. [A5. 1983-84]. “Jyauti^ prsthlyagrahajnanad 
g^lrbh^yagrahajhanam,” Sarvamanisd 7, 1983-84, 1, 68-72. 

Joshi, Mahadev N. [A5. 1984]. “Raja-niti in Someshvara’s 

Manasoll 2 isa,” Karnatak Historical Review 18, 1984, 28-36. 

Joshi, S. K. [A5. 1985]. “Defense Architecture in Sanskrit 

Literatme,” Karnatak Historical Review 18, 1984, 7-12. 


Jo«, Kedaradatta. [A5. ?]. Vedorn mem jyautisa kd saman- 
vaydtmaka adhyayana, Varanasi [N. D.]. 

Jyotishmati, Usha. See S. Prakash and U. Jyotishmati [A5. 
1979]. 

Kak, Subash C. [A5. 1986]. “Computational Aspects of the 

Aryabhata Algorithm,” IJHS 21, 1986, 62-71. 

-. [A5. 1989]. “The Brahmagupta Algorithm for Square 

Rooting,” GB 11, 1989, 27-29. 

Kamada, K. [A5. 1979]. “Vidyeirzmya K^Jajn^mam. The 

Introduction of a M 2 muscript,” Proceedings of the Andhra 
Pradesh Oriental Conference. First Session, Hyderabad 
1979, pp. 131-133. 

Kanakumaif. [A5. 1973]. “Jeiina darsana mem seikuna vicara,” 
Anusandhdna Patrikd 4, Oct.-Dec. 1973, I, 10-17. 

Kcme, P. V. [A5. 1947]. “UtptJa and the Arthiisastra of 

Kautilya,” ABORI 28, 1947, 136-137. 

Kemsera, Netrayem. [A5. 1986/87]. “Vedic Mathematics: A Novel 
Ancient Tool for Modem Science,” JOI Baroda 36, 1986-87, 
1-16. 

Kapoor, Gauri Shankar. [A5. 1976]. Learn Astrology the Easy 
Way, Delhi 1976. 

Kapur, J. N. [A5. 1988]. “A Brief History of Mathematics 

Education in India,” GB 10, 1988, 31-39. 

Keu' 2 mdik£ir, A. J. [A5. ?]. Vaidika drydcern jyotirvijhdna dni 
vaidika devatdmcern punardarsana. Enghsh tr^mslation in S. 
S. Apte [A5. 1978]. 

Kcishikar, C. G. [A5. 1980]. “Baudhayjma ^yenaciti: a Study in 
the Pihng up of Bricks,” PAIOC 29 (1978), Poona 1980, pp. 
191-199. 

-. [A5. 1985]. “The Area of ^yenaciti in the Apeistamba Tra¬ 
dition,” MM. Professor Kuppuswami Sastri Birth Centenary 
Commemoration Volume, pau-t II, Madrets 1985, pp. 21-26. 

Katakkar, M. [A5. 1984]. Palmistry in Pictures, Bombay 1984. 

Katre, Sadashiva L. [A5. 1946]. “Exact Date of Raghunatha- 
bhatta’s Commenteiry on the Trimsacchlokr-1588 A.D.,” PO 
11, 1946, 1-2, 43-44. 

Katre, S. M. [A5. 1960/61]. “Marathi and Gujeirati Words for 
‘Week’,” Bhdratiya Ftrfya 20-21, 1960-61, 395. 

Kaur, Amarjit. See S. S. Lishk and A. Kaur [A5. 1987/88]. 

Kaushal, Inderjit, and Gicm Singh M^mn [A5. ?]. Mars & 

Manglik in Astrology, New Delhi [N. D.]. 

Kaye, George Rusby [1924]. Reprinted New Delhi, 1981. 

Kennedy, E. S. See F. I. Haddad, D. Pingree, emd E. S. Kennedy 
[A5. 1984]. 

Kennedy, E. S., £md David A. King. [A5. 1982]. “Indicm 

Astronomy in Fourteenth Century Fez: The Versified Zlj of 
al-Qusuntlnl,” JHAS 6, 1982, 3-45. 

Kennet, C. E. [A5. 1874]. “Explanation of the Teimil Method of 
Naming the Days of the Week,” lA 3, 1874, 90. 

Kem, H. [A5. 1877]. “On Ancient Nagetrl Numer^ds,” lA 6, 

1877, 143. 

Khan, M. S. [A5. 1977]. “Aryabhate I and «J-BlrunI,” IJHS 12, 
1977, 237-244. 

-. [A5. 1987]. “An Examination of al-Blrum’s Knowl¬ 
edge of Indian Astronomy,” History of Oriental Astronomy, 
Ccimbridge 1987, pp. 139-145. 

-. [A5. 1988]. “Teaching of Mathematics and Astronomy 

in Educational Institutions of Mediev^d India,” JAS 30, 1988, 
144-155. 

Khan Ghori, S. A. See S. A. K. Ghori [A5. 1980]. 

Khare, G. H. [A5. 1938]. “Abhilasitarthacintamam jmd ^ilpa- 
ratna,” NIA 1, 1938, 529-533. 

King, David A. See E. S. Kennedy and D. A. King. [A5. 1982]. 

Kirfel, WiUibaJd. [A5. 1939]. “1st die Funfzahl der symboUsche 
Ausdruck einer bestimmten Kultm-?,” Die Geistige Arbeit 6, 


XVI 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


1939, no. 4, pp. 3-8; repr. in W. Kirfel [A5. 1976] pp. 
173-178. 

-. [1959b]. Repr. in W. Kirfel [A5. 1976] pp. 111-119. 

-. [A5. 1961]. “Zahlen- imd Farbensymbole,” Saeculum 12, 

1961, 237-247; repr. in W. Kirfel [A5. 1976] pp. 248-258. 

-. [A5. 1976]. Kleine Schriften, Wiesbaden 1976. 

Klaus, Konrad. [A5. 1986]. Die altindische Kosmologie. Nach 
den Brahmanas dargesielH, Indica et Tibeiica 9, Bonn 1986. 

Kloetzli, R£indy. [A5. 1983]. Buddhist Cosmology, Delhi-Varanar 
si-Patna 1983. 

Kohl, J. F. [A5. 1955]. “Einige Bemerkungen zur Zahlen- 

symbolik und zimi Animismus im botanischen System der 
Jmna-Kanon,” Studia Indologica, BOS, NS 3, Bonn 1955, pp. 
125-135. 

Kothandarauneui, P. [A5. 1982]. “Tamil and Telugu Numer^Js. 
A Constructive Analysis,” AOR Madras 31, 1982, art. 2. 

Kothari, P. C. [A5. 1985]. “Hidden Laws of Numbers of 

Harappa,” GB 7, 1985, 23-24. 

Krish£m, Y. [A5. 1983/84]. “The Doctrine of Karma 2 md Ph^llita 
Jyotisa,” VIJ 21, 1983-84, 53-67. 

Kuiper, F. B. J. [A5. 1983]. Ancient Indian Cosmogony, New 
Delhi 1983. 

KuleJcarnT, Bha. Ram. [A5. 1946/47]. “Bharatiya jyotisa 

kr prak GrTsa k^na ‘lagna’ pr^tn^,” Jainasiddhantabhaskara 
13,1946-47, 98-99. 

Kul^lkarm, Raghimatha Pvun^ttcima. [A5. 1978a]. Cara 

sulbasutre, Mumbai 1978. 

-. [A5. 1978b]. “The V£ilue of TT Known to Sulbasutrakdras," 

IJHS 13, 1978, 32-41. 

-. [A5. 1978c]. “Geometry £is Known to the People of Indus 

Civilization,” IJHS 13, 1978, 117-124. 

-. [A5. 1983]. Geometry According to Sulba Sutra, Pime 

1983. 

-. [A5. 1987]. Layout and Construction of Citis according to 

Baudhayana-, Mdnava-, and Apastamba-Sulbasutras, BORI, 
RUS 10, Poona 1987. 

-. [A5. 1988]. “A Water Instnmient to Meeisure the Time of 

One Nalika,” ABORI69, 1988, 279-281. 

Kuliachev, Alexey Pavlovich. [A5. 1984]. ^^Srfyantra and its 
Mathematiced Properties,” IJHS 19, 1984, 279-292. 

Kumar, Lcdit. [A5. 1981]. “Jm Singh’s Observatory at Banaras- 
aui Observation,” Cultural Contours of India, ed. Vijai 
Shankar Sriveistava, Atlantic Highlands, N. J., 1981, peirt II, 
pp. 170-171. 

Kumar, Ravi. See C. Ceullat amd R. Kiuneir [A5. ?]. 

Krunar, Vijayendra. [A5. 1984]. “Laws of Modem Mathematics 
in Yajurveda,” Sciences and the Vedas, Bombay-Madras-New 
Delhi 1984, pp. 55-61. 

Kupp^lnna S^lstry, T. S. See K. V. Sarma and T. S. Kupp^mna 
Sastry [A5. 1984]. 

-. [A5. 1978]. “The Epoch of the Romaka Siddhanta in the 

Panca Siddhantika and the Epoch Longitudes of the Svm and 
Moon in the Vasistha^Pauhsa,” IJHS 13, 1978, 151-158. 

-. [A5. 1979]. “The V^istha-Paulisa Venus in the P^mc^lsid- 

dhantika of Varahamihira,” IJHS 14, 1979, 150-154. 

Kuppuswami, A. [A5. 1982]. Easy Lessons in Elementary 

Astrology, Tiruchirapadli 1982. 

Kurtik, G. E. [A5. 1987]. “Theory of Precession in the Mediev^J 
Indian and Eeirly Islamic Astronomy” (in Russiem), Moskva 
1987. 

Kusuba, T. See T. Hayetshi, T. Kusuba, and M. Yamo [A5. 1990]. 

Kusuba, Tadcanori. [A5. 1981]. “Brahmagupta’s Sutras on Tri- 
and Quadrilaterals,” Historia Scientiarum 21, 1981, 43-55. 

-. [A5. 1987a]. “Bredunagupta’s Patigamta,” Chusei no 

Sugaku, Tokyo 1987, pp. 381-407 (in Jap 2 mese). 


-. [A5. 1987b]. “Brahmagupta’s Bijaganita,” Chusei no 

Sugaku, Tokyo 1987, pp. 408-428 (in Japanese). 

L 2 diiri, N. C. [A5. 1980]. “Limar amd Solar Equations of Hindu 
Astronomy,” Proceedings of the First International Sanskrit 
Conference III 1, New Delhi 1980, pp. 192-195. 

Lakshminarasimhi^dl, B. K. [A5. 1967]. A Guide to Astrology or 
Jyothisha Rahasyam, Bangalore 1967. 

Led, Rattan. [A5. 1983]. Nadi System of Prediction, New Delhi 
1983. 

Led, R. S., and R. Preisad. [A5. 1985]. “Simultemeous 

Indeterminate Equations of the First Degree in Ancient emd 
Medieval Hindu Mathematics,” ME 19, 1985, 87-96. 

Led, R. S. [A5. 1984]. “Extraction of Squeire-root in Ancient 
Hindu Mathematics,” ME 18, 1984, 130-135. 

-. [A5. 1988]. “Jagadguru ^etnkeirac^ya SwamI ^ree Bh^ati 

Km^ Teerthajee Medina] emd his Novel Methods of Solving 
Simple Equations,” JAS 30, 1988, 172-181. 

Lalye, P. G. [A5. 1981]. “The Concept of Yugas in An¬ 

cient India,” Proceedings of the First International Sanskrit 
Conference IV, New Delhi 1981, pp. 146-150. 

Lemer, Paiile [A5. 1988]. Astrological Key in Mahabhdrata. The 
New Era, transl. David White, Delhi 1988. 

Levi, Sylvain. [A5. 1930]. “Le pesee de I’elephant,” Dr. Modi 
Memorial Volume, Bombay 1930, pp. 442-444. 

Lishk, Sajjem Singh. See S. D. Sharma emd S. S. Lishk [A5. 
1976] and [A5. 1978]. 

-. See J. Sisodiya, ^eirma, and S. S. Liska [A5. 1977]. 

Lishk, Sajjem Singh, and A. Kavu. [A5. 1987/88]. “Psycho-social 
Aspects of Jedna Mathematics,” Jain Journal 22, 1987-88, 
20-22. 

Lishk, Sajjan Singh, emd S. D. Sharma. [A5. 1975]. “Oc- 

cultations of the Moon in Jedna Astronomy,” Tulasi Prajhd, 
July-Sept. 1975, 64-69. 

-. [A5. 1977]. “Role of pre-Aryabhate Jedna School of 

Astronomy in the Development of Siddhantic Astronomy,” 
IJHS 12, 1977, 106-113. 

-. [A5. 1979]. “Zodiacal Circumference eis Graduated in 

Jedna Astronomy,” IJHS 14, 1979, 1-15. 

-. [A5. 1980a]. “Stemdardization of Time-unit Muhurta 

through the Science of Sciatherics in Atharva Vedahga Jyoti¬ 
sa," IJHS 15, 1980, 193-203. 

-. [A5. 1980b]. “Cycle of Days in Jambudvipa prajhapti," 

PAIOC 29 (1978), Poona 1980, pp. 375-379. 

Lishk, Sajjan Singh. [A5. 1979/80]. “Certedn Peculiarities of 
Jedna School of Astronomy,” JJ 14, 1979-80, 81-88. 

-. [A5. 1983a]. “Kinematics of Venus in Bhadrabahu 

Sanhita,” JJ 18, 1983, 1-19. 

-. [A5. 1983b]. “Notion of Declination Implied in the Concept 

of Memdeda (Diurnal Circle) in Jaina School of Astronomy,” 
JJ 18, 1983, 83-102. 

-. [A5. 1986/87a]. “On Five Circular Paths of Jeunbudvipa,” 

JJ 21, 1986-87, 20-24. 

-. [A5. 1986/87b]. “Medn Cheiracteristics emd Achievements 

of Jedna School of Ancient Indiem Astronomy,” JJ 21, 1986-87, 
96-101. 

-. [A5. 1987]. Jaina Astronomy, Delhi 1987. 

-. [A5. 1988/89a]. “‘Seunaya’ eis em Unit of Time in Jedna 

Astronomy,” AVI, 1988-89, 2, 39-42. 

-. [A5. 1988/89b]. “On Geometry of Jambudvipa,” AV 1, 

1988-89, 3, 39-42. 

-. [A5. 1988/89c]. “Gnomon Experiments in Ancient Indiem 

Astronomy,” AVI, 1988-89, 3, 43-47. 

-. [A5. 1988/89d]. “Mathematical Anedysis of Post-Vedemga 

Data in Jedna Astronomy,” AVI, 1988-89, 3, 76-78. 


BIBLIOGRAPHY 


xvii 


-. [A5. 1989/90]. “On Five Circular P£u-ts of Jambudvipa,” 

AV 2, 1989-90, 4, 45-49. 

-. [A5. 1991]. “On Nature of the Sun ^lnd the Moon as Men¬ 
tioned in Twentieth P£ihuda of Surya P 2 innatti (Prajnapti),” 
AV 3, 1991, 1, 39-40. 

Mackenzie, J. S. F. [A5. 1872]. “Note on Query 2, p. 64,” lA 1, 
1872, 95 (£m answer to J. Beames [A5. 1872]). 

Majxnudcir, M. R. [A5. 1942]. “Iconography of Candra eind 

CaindrctsekhcU'a Images,” ABORI 23, 1942, 262-270. 

Mcihdihaiss£ui, S. [A5. 1990]. “Three Phases of Magic Square of 
Three,” IJHS 25, 1990, 1-3. 

Majumdctr, Pradip Kumeir [A5. 1978a]. Ganitakaumudi and 
the Continued Fraction,” IJHS 13, 1978, 1-5. 

-. [A5. 1978b]. “The Extant Siddhantasarvabhauma —An 

Error in the Sine of One-third Pcirt of cin Angle,” IJHS 13, 
1978, 6-10. 

-. [A5. 1978c]. “A Rationede of Bhaskara I’s Method for 

Solving aa: i c = by," IJHS 13, 1978, 11-17. 

-. [A5. 1981a]. “A Rationale of Brahmagupta’s Method of 

Solving ax + c = by," IJHS 16, 1981, 111-117. 

-. [A5. 1981b]. “BijagaJlit^lm of Bhaskara II ^md the 

Continued Fraction,” JAS 23, 1981, 1-2, 124-136. 

-. [A5. 1981c]. “Use of Successive Convergents of the Con¬ 
tinued Fraction in the Works of Br^lhmagupta emd Bhaskara 
II,” JAS 23, 1981, 3-4, 99-109. 

-. [A5. 1983]. “A Rationale of Bhatta Govinda’s Method for 

Solving the Equation ax — c = by and a Comparative Study 
of the Determination of “Mati” as Given by Bhaskara I and 
Bhatta Govinda,” IJHS 18, 1983, 200-205. 

-. [A5. 1988]. “Bhaskaracarya II ^md the Transformation of 

Sum and Difference into Product,” JAS 30, 1988, 141-143. 

Majumder, Heirihar. [A5. 1981]. Hindu Science of the Future, 
Calcutta 1981. 

Mankad, D. R. [A5. 1942]. “Manvantaracaturyuga Method,” 

ABORI 23, 1942, 271-290. 

-. [A5. 1945a]. “Two Notes on the Manvantara-Caturyuga 

Method,” Bharatiya Vidyd 6, 1945, 6-10. 

-. [A5. 1945b]. “Caturyuga = Generation,” Bharatiya Vidyd 

6, 1945, 198. 

Mctnkad, P. A. [A5. 1935/36]. “Sam£irahganasutradh^a and 

Yuktikcdpatciru: Whether these Works tire Productions of One 
emd the Seime King Bhoja of Dh^a NagcirT,” ABORI 17, 
1935-36, 358-370. 

Mann, Gi^m Singh. See. I. Kaushel and G. S. Mann [A5. ?]. 

Manu, R. E. [A5. 1977]. Horary Tables of Houses, Secunderabad 
1977. 

Maula, Erkka. [A5. 1984]. “The Calendar Stones from Moenjo- 
daro,” Interim Reports. Reports on Field Work Carried out 
at Mohenjo-Daro Pakistan 1982-83, vol. 1, Aachen [1984], 
pp. 159-170. 

Mazars, Guy. See P.-S. FiUiozat emd G. Mazars [A5. 1985] and 
[A5. 1987]. 

Mehra, Anjani Kmnar. [A5. 1982]. “SoW Eclipse Theory 

and Observations in the 18th Century India,” IJHS 17, 1982, 
252-259. 

Mehta, D. D. [A5. 1974]. Positive Sciences in the Vedas, New 
Delhi 1974. 

Mehta, S. K. [A5. 1986]. New Dimensions in Hindu Astrology, 
New Delhi 1986. 

Mercier, Raymond. [A5. 1977]. “Newly Discovered Mathemat- 
iccil Relations Between Greek emd Indiem Astronomy,” IJHS 
12,1977, 120-126. 

-. [A5. 1984]. “The Astronomical Tables of Rajah Jeii Singh 

Sawai,” IJHS 19, 1984, 143-171. 


-. [A5. 1987]. “The Meridiems of Reference in Indiem Astro¬ 
nomical Canons,” History of Oriental Astronomy, Ceunbridge 
1987, pp. 97-107. 

Meshreun, Pradip Shedigreun. [A5. 1989]. “A Unique Surya 

Figure from Hatodi,” ABORI 70, 1989, 273-275. 

Michiwedd, Yoshimeisa. [A5. 1989/90]. “On the Resemblance of 
Indiem, Chinese and Japanese Mathematics,” AV 2, 1989-90, 
2, 11-15. 

-. [A5. 1991]. “On the Resemblance etmong Indian, Chinese, 

and Japanese Old Mathematics,” AV 3, 1991, 3, 23-26. 

Mireishi, Veisudeva Vishnu. [A3. 1968/69]. Reprinted in his 

Literary and Historical Studies in Indology, Delhi-Varemeisi- 
Patna 1975, pp. 103-108. 

-. [A4. 1975/76]. Reprinted in his Indological Research 

Papers, vol. 1, Nagpin 1982, pp. 1-16. 

-. [A5. 1983/84]. “D. R. Bhemdarkar’s Views on the Krta 

Era,” VIJ 21, 1983-84, 110-116. 

Misra, RajesvarTdatta. [A5. 1948/49]. “Vrttaksetra ka geuuta— 
Jaina tatha Jaineteiraacaryom ke siddhanta,” Jainasiddhdnta- 
bhdskara 15, 1948-49, 105-111. 

-. [A5. 1950]. “Jeiina-granthom mem ksetramiti,” Jainasid- 

dhdntabhdskara 17, 1950, 17-23. 

-. [A5. 1952]. “Jeiina-gamta kT kucha maulika udbhavema- 

em,” Jainasiddhdntabhdskara 19, 1952, 1, 36-41. 

Misra, Ramajanma. [A5. 1979]. Acdryabhdskara, CPG 13, 

VaraneisT 1979. 

Misra, Sacid^emda. [A5. 1983/84]. “Athayanamseisemilksa- 

nam,” Visvamanisd 7, 1983-84, 4, 27-33. 

Misra, Satya Deva. [A5. 1984/86]. “Technical Terms Related 
to Machines ( Yantra-s) in Samardhgana-sutradhdra: Modem 
Exposition emd Eqmv£dents,” Rtam 16-18, 1984-86, pt. 2, 
205-215. 

Mitchiner, John E. [A5. 1982]. Traditions of the Seven Rsis, 
Delhi-Varemasi-Patna 1982. 

Mitra, Seirat Chandra. [A5. 1986]. The Cult of the Sun God in 
Medieval Eastern Bengal, New Delhi-AUahabad 1986. 

Modak, B. R. [A5. 1971]. “The Social and Political Conditions £is 
Reflected in the Ath£irvaveda-Parisishtas,” Studies in Indian 
History and Culture, Dhetrwar 1971, pp. 280-287. 

Modi, GopaUcrishna. [A5. 1985/87]. “The Hindu Calendar,” 
Bhdratiya Vidyd 45-47, 1985-87. 290-293. 

Modi, J. J. [1914]. Reprinted in J. J. Modi, Asiatic Papers. Part 
III, Bombay 1927, pp. 247-277. 

Moghe, S. G. [A5. 1969]. “Vijnanesvara and Nllakantha as 

the Interpreters of the YajnavaUcya-smrti,” SVUOJ 12, 1969, 
19-29. 

-. [A5. 1970a]. “The Constellation RohinI in the Ramaya^ 

and the Later Poets,” Bhdratiya Vidyd 30, 1970, 55-59. 

-. [A5. 1970b]. “A Few Observations on Mitraunisra— 

the Commentator of the YajnaveJkya Smrti,” Pratibhdnam, 
Triv£mdram 1970, pp. 45-56. 

-. [A5. 1974]. “On Sulapam—The Interpreter of the 

Yajnavalkya Smiti,” SVUOJ 17, 1974, 113-121. 

-. [A5. 1977/78]. “Nlleikantha’s Vyavahara-Mayukha cmd 

Svcisru-snusa-dhana-samvada,” JAS Bombay 52-53, 1977-78, 
200-207. 

-. [A5. 1979a]. “A Fresh Interpretation of naksatrair yas ca 

jivati," Bhdratiya Vidyd 39, 1979, 59-63. 

-. [A5. 1979b]. “Purva-numamsa emd Astrological Inter¬ 
pretations,” JKUORIML 22, 1979, pt. 2, art. B3. Pp. 
1 - 21 . 

-. [A5. 1984]. “Citations from the Kautillya Arthasastra 

in Aleuiikareisastra emd Astrology,” Bhdratiya Vidyd 44, 1984, 
66-69. 

Morrissey, Patrick. See D. Pingree emd P. Morrissey [A5. 1989]. 


XVlll 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mostaert, Antoine, [A5. 1969], Manual of Mongolian Astrology 
and Divination, Ceunbridge, Maiss. 1969. 

Mnkherjee, B. N. [A5. 1973], Central and South Asian 

Documents on the Old Saka Era, Var£maisi 1973. 

-. [A5. 1982]. “The Yavanajdtaka of Sphujidhvaja, The 

Sakak^a and the Kaniska Era,” JAOS 102, 1982, 361-363. 

Mnkherjee, R. N. [A5. 1977]. “Background to the Discovery of 
the Symbol for Zero,” IJHS 12, 1977, 225-231. 

Mukhopadhyaya, Kahnatha. [A5. 1901]. Bhagolacitram, 

Kalikata ^cika 1822 = A.D. 1900/01 (= Kalinath Mukherji, 
An Atlas of Hindu Astronomy, Calcutta 1901). 

Munshi, R. L. [A5. 1975]. “Geologist Clock eind Time Concept 
in Jciin Mythology,” Tulasi Prajhd, April-Jime 1975, 59—62. 

Mm-thy, S. R. N. [A5. 1978a]. “Geological Evidences in Support 
of the Antiquity of some Ancient Indi^ln Events,” IJHS 13, 
1978, 18-22. 

-. [A5. 1979]. “On Some Geological Aspects of the 

Suryasiddhanta,'' IJHS 14, 1979, 144-149. 

-. [A5. 1978b]. “V^u•ah^lmihira’s Contribution to the Vedic 

Theory of the Earth,” Ind. Taur. 6, 1978, 193-218. 

Myhus, Klaus. [A5. 1984]. “Taittirlya-Brahmam I 1, 1-7,” 

Altorientalische Forschungen 11, 1984, 282-298. 

Nahata, Ageiracanda. [A5. 1943]. “Upadhyaya Meghavijaya ke 
do navTna gr^mtha,” Jainasiddhantabhaskara 10, 1943, 70-72. 

-. [A5. 1948/49]. “Jaina jyotisa ka eka mahatvapurm 

gremtha,” Jainasiddhantabhaskara 15, 1948-49, 112-116. 

-. [A5. 1951]. “Ustaredava y^untra sambctndhi eka mahattvar 

pur^ jaina-grantha,” Jainasiddhantabhaskara 18, 1951, 119— 
128. 

-. [A5. 1953]. “Kavi HTrakcdeisa racita Joi’sahlra,” Jainasid- 

dhdntabhdskara 20, 1953, 2, 43-45. 

-. [A5. 1954]. “Jyotisa sambemdhl katipaya ajhata jaina 

grantha,” Jainasiddhdntabhdskara 21, 1954, 2, 6-14. 

Naini, Alireza Djafari. [A5. 1982]. Geschichte der Zahlen- 

theorie im Orient im Mittelalter und zu Beginn der Neuzeit 
unter besondere Berucksichtigung persischer Mathematiker, 
Braimschweig 1982. 

Neiir, V. G. [A5. 1983]. “Acarya Aryabhata,” Jain Journal 18, 
1983, 106-111. 

Neimbiyar, Raghavan. [A5. 1947]. “Peiramesvarac^ya of 

Vatasseri,” Bhdratiya Vidyd 8, 1947, 207-208. 

Nareiheiri, H. G. [A5. 1942]. “The Vedic Doctrine of the Worlds 
Above,” ABORI 23, 1942, 302-313. 

Nath, R. [A5. 1986]. “Scinskrit Text on Jail (Jalaka),” Brah- 
mavidyd 50, 1986, 388-401. 

Navathe, P. D. [A5. 1971]. “Pusti-mavat,” Bhdratiya Vidyd 31, 
1971,20-21. 

Nayak, P. K. [A5. 1990]. “Ahka Year: a Study on Chronogram 
phy,” JAIH 17, 1987-88 [1990], 103-118. 

Nilakantham, Ratn£im. [A5. 1981]. “Cosmology in the Atheir- 
vaveda,” Historical and Critical Studies in the Atharvaveda, 
NFS 53, Delhi 1981, pp. 141-148. 

Ohami, Iseio. [A5. 1979]. “On the Measurement of Time in 

Ancient and Medieval India,” KK 18, 1979, 95-104. 

-. [A5. 1982]. “On Voliune Measures in Ancient India” (in 

Japanese), KK 21, 1982, 16-26. 

Ohaishi, Yukio. [A5. 1987]. “A Note on Some Sanskrit Manu¬ 
scripts on Astronomical Instruments,” History of Oriental 
Astronomy, Cambridge 1987, pp. 191-195. 

-. [A5. 1988]. “V^lrah^unihira’s Orthographic Projection. An 

Interpretation of the Pancasiddhdntikd XIV, 5-11,” JAS 30, 
1988, 66-76. 

-. [A5. 1991]. “Sanskrit Texts on Astronomic^ll Instruments 

during the Delhi Sultanate and Mughal Periods,” Studies 


in History of Medicine and Science 10-11, 1986-87 [1991], 
165-181. 

Ojha, Ashutosh. [A5. 1972]. Palmistry for All, Delhi 1972. 

-. [A5. 1973]. Numerology for All, Delhi 1973. 

Ojha, Gopesakumara. [A5. 1972]. Bhdratiya lagnasdrini, 

Dilll-Varanasi-Patana 1972, repr. 1981. 

-. [A5. 1978]. How to Interpret your Horoscope, New Delhi 

1978. 

Pandey, C. D. [A5. 1984]. “The Magian Priests ^md their Impact 
on Sun-worship,” Purdna 26, 1984, 203-205. 

Pandeya, Nagendra. [A5. 1979/80]. “Jyotisasastre Santanavi- 
marsa,” Sarasvati Susamd 34, 1979-80, 250-262. 

Pandeya, Ramajl. [A5. 1980]. Prdcina Bhdratiya kdlaganand 
evarn pdrarnparika samvatsara, Varanasi 1980. 

Pandeya, ^rlcandra. [A5. 1982]. Grahagati kd kramika vikdsa, 
Krsnaddsa SS 14, VaranzisI 1982. 

Pandita, M. D. [A5. 1970]. “PamnI va gamtasastra,” Samskrti- 
sugandha, Poona 1970, pp. 51-67. 

Pant, Raj^mik^mt. [A5. 1981]. “History of Rahu and Ketu,” VIJ 
19, 1981, 277-283. 

Peu-adkiir, M. D. [A5. ?]. “M^lh^unahop^wihyaya P. V. Kane on 
Muhurtasastra and Astrology,” MO 14, N. D., 83-87. 

-. [A5. 1979/80]. “Sun Worship in Indian and Other 

Cultures,” JAS Bombay, NS 54/55, 1979-80, 103-117. 

Paramahans, S. A. [A5. 1984]. “Units of Measm-ement in 

Medieval India and their Modem EquiveJents,” IJHS 19, 
1984,27-36. 

-. [A5. 1991]. “Astronomy in Ancient India—its Importamce, 

Insight and Prevalence,” IJHS 26, 1991, 63-70. 

P^lramesw^lran, S. [A5. 1981]. “Aryabhate,” Journal of Kerala 
Studies 3, 1981, 69-92. 

-. [A5. 1983]. “Madhav£in of Semgamagraman,” Journal of 

Kerala Studies 10, 1983, 185-217. 

-. [A5. 1987]. “Demonstration of the Formiila sin (x i y) = 

sin X • cos y di cos x • sin y in MedievaJ India,” Mathematics 
Teacher 23, 1987, 1-12. 

Parpola, Asko. [A5. 1975/76]. “Sanskrit Kdla “Time”, 

Dravidieui Kdl “Leg”, ^md the Mythical Cow of the Four 
Yugas,” Ind. Taur. 3-4, 1975-76, 361-378. 

-. [A5. 1976]. “Harappan Roots of Ancient Indiem 

Astronomy and Cosmic Speciilation,” Inde ancienne, Actes 
du XXIX.^ Congres international des Orientalistes, Paris 
1976, pp. 244-252. 

-. [A5. 1985]. The Sky-Garment, Helsinki 1985. 

Pathak, Indu Mati. [A5. 1978]. “A Unique Image of the 

Sim-God in Tanjinatha, Rnnchi,” The Heritage of India, ed. 
U. Th^lkur 2 ind Y. K. Mishra, Bodh Gaya 1978, pp. 238-240. 

Pathaka, Ramacandra. [A5. 1986]. Paurdnikakdlaparijndnam, 
VaraneisI 1986. 

Patil, Vasant S. [A5. 1976/77]. “Us^ls: the Muse of the Rgvedic 
Poetry,” JOI Baroda 26, 1976-77, 6-10. 

Perinb^mayag^ml, R. S. [A5. 1982]. The Karmic Theater: Self, 
Society, and Astrology in Jaffna, Amherst, Mass., 1982. 

Perrett, V. amd R. W. [A5. 1986]. “Cosmogony in the M^kan- 
deya Purana,” Purdna 28, 1986, 128-144. 

Petri, Winfried. [A5. 1966]. Indo-tibetische Astronomie. 

(Habilitationsschrift, Miinchen 1966; not published). 

-. [A5. 1977]. “Moving Reference Systems in the Aryabhatl- 

ya,” IJHS 12, 1977, 114-119. 

Phadke, N. H. [A5. 1983]. Lildvati—A Relook, translated 

from the MeirathI by K. S. Patwardham and S. A. N^ump^dly, 
Thimder Bay, Canada, 1983. 

Ph£dtane, L. A. [A5. 1952]. “The Tatwartha Sutra and 

Geography,” Jaina Ant. 18, 1952, 2, 36-38. 


BIBLIOGRAPHY 


XIX 


Pilania, G. P. [A5. 1981]. “Sawai Jciisingh as High Priest of 
Reformation,” Cultural Contours of India, ed. Vijai Shankar 
Sriv^lstava, Atlantic Highl^ulds, N. J., 1981, part II, pp. 
392-395. 

Pingree, D. See F. I. Haddad, D. Pingree, and E. S. Kennedy 
[A5. 1984]. 

-. See D. Gold and D. Pingree [A5. 1991]. 

Pingree, D., eind P. Morrissey. [A5. 1989]. “On the Identification 
of the Yogatards of the Indiem Naksatras," JHA 20, 1989, 99- 
119. 

Pingree, D. [A5. 1976]. “Brahmagupta, Balabhadra, P^thud^lka 
and Al-Blrunl,” Proceedings of the First International San¬ 
skrit Conference II 2, New Delhi 1976, pp. 166-180. 

-. [A5. 1978]. “Isleimic Astronomy in Sanskrit,” JHAS 2, 

1978, 315-330. 

-. [A5. 1979]. “The G^^utapancavim« of SrTdhara,” Ludwik 

Sternbach Felicitation Volume, 2 pts., Lucknow 1979 [1981], 
pp. 887-909. 

-. [A5. 1980a]. Reply to B. L. van der Waerden [A5. 1980] 

in JHA 11, 1980, 58-62. 

-. [A5. 1980b]. “The Khetamuktavail of Nrsimha,” Sanskrit 

and Indian Studies, Dordrecht-Boston 1980, pp. 143-157. 

-. [A5. 1981]. JyotiAsastra, Wiesbaden 1981. 

-. [A5. 1982a]. “A Note on the CeJendeirs Used in Early 

Indiam Inscriptions,” JAOS 102, 1982, 355-359. 

-. [A5. 1982b]. “Mesopotamian Astronomy and Astral 

Omens in Other CiviUzations,” in Mesopotamien und seine 
Nachharn, ed. H.-J. Nissen and J. Renger, Berlin 1982, pp. 
613-631. 

-. [A5. 1983]. “Brahmagupta, Balabhadra, PrthudaJca and 

al-BTruiu,” JAOS 103, 1983, 353-360. 

-. [A5. 1985]. “Some Little Known Commentators on 

Bhaskara’s Karanakutuhala," AJOS 2, 1985, 157-168. 

-. [A5. 1987a]. “The Rajeim^ahka of Bhojeu-aja,” AJOS 4, 

1987, 1-68; reprinted as Aligarh OS 7, Aligeirh 1987. 

-. [A5. 1987b]. “Indian and Islamic Astronomy at Jayeisimr 

ha’s Court,” Annals of the New York Academy of Sciences 
500, 1987, 313-328. 

-. [A5. 1987c]. “Siunatiharsa Gam and Some Other Jaina 

Jyotias,” Astha aura cintana, DiUl 1987, pp. 99-104. 

-. [A5. 1987d]. “Venus Omens in India and Babylon,” 

Language, Literature, and History, AOS 67, New Haven 1987, 
pp. 293-315. 

-. [A5. 1987e]. “Babyloniem Pieinetary Theory in Sanskrit 

Omen Texts,” From Ancient Omens to Statistical Mechanics, 
ed. J. L. Berggren and B. R. Goldstein, AHSNM, Copenhagen 
1987, pp. 91-99. 

-. [A5. 1988]. “The Astronomical Works of Deisabala,” 

AJOS 5, 1988, 1-56; reprinted as Aligarh OS 9, Aligarh 1988. 

-. [A5. 1989a]. “MUL.APIN and Vedic Astronomy,” 

DUBU-E 2 -DUB-BA-A. Studies in Honor of Ake W. Sjoberg, 
Philadelphia 1989, pp. 439-445. 

-. [A5. 1989b]. “The Sighrasiddhi of L^lksmIdhara,” JOI 

Baroda 37, 1987 (1989), 65-81. 

-. [A5. 1989c]. “Indizm Planetary Images emd the Tradition 

of Astr^d Magic,” JWCI52, 1989, 1-13. 

-. [A5. 1990]. “The Pm-^as and Jyoti^astra: Astronomy,” 

JAOS 110, 1990, 274-280. 

Pish^lroty, P. R. [A5. 1984]. “Meteorology in the Rgveda,” 

Sciences and the Vedas, Bombay-Madras-New Delhi 1984, pp. 
70-77. 

PraJcash, Satya, and Usha Jyotishmati. [A5. 1979]. The Sulba 
Sutras, AUeihabad 1979. 

PredcEish Seirasvati, Satya. [A5. 1987]. Geometry in Ancient 

India, Delhi 1987. 


Prasad, E. A. V. [A5. 1976]. “Hydrological Science in Veiraha- 
mihira’s Brhatsamhita,” SVUOJ 19, 1976, 109-117. 

Prasad, R. See R. S. Lai and R. Prasad [A5. 1985]. 

Przyluski, J. [A5. 1936]. “Uposatha,” IHQ 12, 1936, 383-390. 

Purohit, Ramesh Chemdra. [A5. 1979]. “Age of Bh^ata War” 
in G. C. AgarwcJa. [A5. 1979], pp. 248-264. 

Raghavan, V. [A5. 1963]. “The Puranarthasahgreiha of Vefika- 
t£iraya,” Purdna 5, 1963, 1, 47-60, repr. Purdna 32, 1990, 1, 
218-229. 

-. [A5. 1965]. “Rajaniti Section of the Pm-anarthasangraha 

of Vehkataraya,” Purdna 7, 1965, 2, 370—389, repr. Veiranasi 
1965 and Purdna 32, 1990, 1, 230-249. 

-. [A3. 1970]. Repr. Purdna 32, 1990, 1, 193-217. 

Rai, R. N. [A5. 1976/80]. “Br^lhmagupta’s Works ^md their 
Influence in and outside India,” Proceedings of the First 
International Sanskrit Conference II 2, New Delhi 1976, pp. 
181-188, and III 1, New Delhi 1980, pp. 232-238. 

-. [A5. 1985]. “Astronomical Instruments” in S. N. Sen and 

K. S. Shukla [A5. 1985], pp. 308-336. 

Rajagop^d, C. T., emd M. S. Rangachairi. [A5. 1986]. “On 

Medieval Kerala Mathematics,” AHES 35, 1986, 91-99. 

Rajagopcd, P. [A5. 1991]. “The Sthananga Sutra Programme in 
Indian Mathematics,” AV 3, 1991, 2, 1-8. 

Rajagopalan, K. R. [A5. 1982]. “State of Indian Mathematics 
in the Southern Region up to Tenth Centmy,” GB 4, 1982, 
78-82. 

Raman, BemgeJore Venkata, ^md G. D. Vasudev. [A5. 1980/81]. 
How to Judge a Horoscope, 2 vols.. Bangalore 1980-1981 (vol. 
1, by B. V. Rameui alone, originally published at Bangalore in 
1941; the 8th ed. publ. at Bangalore in 1981). 

Ram£m, Bcuigeilore Venkata. [A2. 1938a]. 13th ed., B^lngalore 
1979. 

-. [A2. 1954]. Sixth ed.. Bangalore 1979. 

-. [A5. 1983]. A Catechism of Astrology, vol. 1, Bangadore 

1983. 

Rcimanna, Raja. [A5. 1984]. “Sanskrit and Science,” Sciences 
and the Vedas, Bombay-Madras-New Delhi 1984, pp. 1-16; 
expanded version, Sanskrit and Science, Bombay 1984. 

Ranade, H. G. [A5. 1976/77]. “Sun-god emd his Associates in 
the Rgveda,” JOI Baroda 26, 1976-77, 1-5. 

R«mgachari, M. S. See C. T. Rajagopal «md M. S. Rangachciri 
[A5. 1986]. 

Rao, R. G. [A5. 1972]. Natal Chart from the Palm, B 2 ingalore 
1972; 2nd ed.. New Delhi [N. D.]. 

-. [A5. 198?]. Your Face Mirrors your Fortune, 2nd ed.. 

New Delhi [N. D.]. 

-. [A5. 1983]. Your Destiny in Thumb. Ancient Indian 

Science of Thumb Reading, 2nd ed.. New Delhi 1983. 

-. [A5. 1986]. Bhrigu Nandi Nadi, rev. ed.. New Delhi 1986. 

flashed, Roshdi. [A5. 1991]. “Al-Saimaw’al, iJ-BTrunI et 

Brahmagupta: les methodes d’interpolation,” Arabic Science 
and Philosophy 1, 1991, 101-160. 

Rath, Pvunachamdra. [A5. 1982]. Srichakralekha, Rourkela 

[1982]. 

Ray, Bidyut Lata. [A5. 1985]. “A Critic^J Study on the Pmamc 
Geographical Accoimt with Special Reference to the Ntlddri 
Mahodayam," ABORI66, 1985, 239-247. 

Reddy, Y. Gopala. [A5. 1971/72]. “Some Measures and Weights 
in Medieval Andhra,” JAHRS 32, 1971-72, 102-114. 

Rele, Veiscint G^ulg^lr^tm. [A5. 1961]. Practical Astro-numerolo¬ 
gy, Bombay 1961; 7th ed., Bombay 1969. 

Ritschl, Eva. [A5. 1976]. “Die Yogayatra des Varahamihira und 
ihr Verhaltnis ziu- Arthasastra-Tradition,” Wissenschaftliche 
Zeitschrift der Humboldt-Universitat zu Berlin, Ges-Sprechw. 
R. 25, 1976, 361-362. 


XX 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Rizvi, Smyid Samad Husmn. [A5. 1979]. “A Newly Dis¬ 

covered Book of al-Blruiu, ‘Ghurrat-uz-zTjat,’ ^lnd al-BTrunTs 
Me^lsu^ements of Eairth’s Dimensions,” Al-Birunt Commemo¬ 
rative Volume, K^t^achi 1979, pp. 605—680. 

Roebuck, V^Je^ie J. [A5. 1992]. The Circle of Stars, Shaltesbuxy- 
Rockport 1992. 

Ro§u, Arion. [A5. 1987]. “Etudes ayurvediques III. Les c^uTes 
magiques dans le medecine indienne,” Studies on Indian 
Medical History, ed. G. J. Meulenbeld ^uld D. Wujastyk, 
Groningen 1987, pp. 103-112. 

-. [A5. 1989]. “Les c^uTes magiques indiens et I’histoire des 

idees en Asie,” ZDMG 139, 1989, 120-158. 

Rowland, Benj^unin, Jr. [A5. 1938]. “Buddha ^md the Sim 

God,” Zalmoxis 1, 1938, 69-84. 

Roy, Ashim Kumar. [A5. 1974]. “A Note on Jaina Mathematics 
^md its Study in Jmpur,” Jijndsa 1, 1974, 24-28. 

Roy, Mira. [A5. 1984]. “The Concept of Yantra in the 

Samaranganasutradhara of Bhoja,” IJHS 19, 1984, 118-124. 

-. [A5. 1988]. “Astronomy eind Alchemy in India. A 

Correlated Study,” JAS 30, 1988, 156-160. 

Roy, Ranjam. [A5. 1990]. “The Discovery of the Series Formula 
for TT by Leibniz, Gregory, emd Nilakantha,” Mathematics 
Magazine 63, 1990, 5, 291-306. 

Roy, Shashanka Bhushem. [A5. 1973/74]. “Vedic Chronology 
(2,030-1,930 B.C.),” JAHRS 33, 2-4, 1973-74, 75-81. 

-. [A5. 1978]. “Tileik-Jacobi Chronology—A Critical 

Appreciation,” Journal of Itihasa 6, 1978, 1, 19-33. 

-. [A5. 1979]. “Date of M^Lhabharata Battle: Astronomical 

Determination” in G. C. Ag^u'w^Ja [A5. 1979] pp. 230-232. 

-. [A5. 1986]. “The Beginnings of Indiein Astronomy: 3,102 

B.C. A Fresh Examination,” Rtambhard. Studies in Indology, 
Ghaziabad 1986, sect. V, pp. 158-170. 

Roychowdhury, Jyotsna. [A5. 1980/82]. “The Solair Bcise of the 
Composite God Harihara,” JAIH 13, 1980-1982, 265-273. 

Rustagi, Urmila. [A5. 1981]. Darsapurnamdsa, Delhi-Varanasi 
1981. 

Saha, Ajit Kumair. [A5. 1988]. “Semin£ir on Astronomy ^md 
Mathematics in Ancient ^md Medieval India—A Di^Jogue be¬ 
tween Traditional Scholars and University Trained Scientists: 
Opening Remarks,” JAS 30, 1988, 1-6. 

Sankaranau-ayan, S. [A5. 1986]. “The Puranic Text on the Date 
of the Mahabharata Wax —A Historic 2 d ^md Archaeological 
Approach,” Purina 28, 1986, 145-173. 

Sapre, R. G. [A5. 1963]. The Torch Bearers of Eternal Truth, 
Astrological Series 10, Ahmednagar 1963. 

-. [A5. 1968]. Astrology. Different Systems Explained, 

Poona 1968. 

Saran, Parmatma. [A5. 1986]. “Qutb Minar ^ls Vijaya Staunbh: 
Super-howlers of the Archaeological Survey of India,” Rtam- 
bhara. Studies in Indology, Ghaziabad 1986, sect. V, pp. 
154-157. 

Saraisvati, T. A. [A5. 1976]. “Bhaslairacarya,” Cultural Leaders 
of India. Scientists, New Delhi 1976, pp. 100-108. 

-. [A5. 1979]. Geometry in Ancient and Medieval India, 

Delhi-V«irauiasi-Patna 1979. 

-. [A5. 1980]. “Sanskrit emd Mathematics,” Proceedings of 

the First International Sanskrit Conference III 1, New Delhi 
1980, pp. 196-209. 

SarbhaJ, S. C. [A5. 1983]. “Contribution of Aryabhate I to 

Algebra,” J. Inst. Engineers 64, sect. H2, 1983, 96-101 (in 
Hindi). 

-. [A5. 1985]. “TT and Indi^ln Sine in the Aryabhatlya,” J. 

Inst. Engineers 65, sect. H3, 1985, 187-194 (in Hindi). 


S^u•kar, Jasodan^mdan (= Yasodanamda S^lrkar). [A5. 1884]. 

The Hindu Geometry Reduced to the Principles of Euclid, 
2nd ed., CeJcutta 1884. 

Sarkar, Ramatosh. [A5. 1982]. “The BakhshaU Memuscript,” 
GB 4, 1982, 50-55. 

-. [A5. 1987]. “Vedic Literature vis-a-vis Mathematical 

Astronomy,” History of Oriental Astronomy, C^unbridge 1987, 
pp. 29-32. 

-. [A5. 1988]. “Astronomical Shortcomings in Ancient Indiein 

Treatises,” JAS 30, 1988, 13-17. 

^etrma, Dlpac£uidra. [A5. 1966]. Sarnskrta kavya mern sakuna, 
Meratha 1966. 

S 2 UTna, K. Madhava Krishna. [A5. 1976]. “Varahamihira,” 

Cultural Leaders of India. Scientists, New Delhi 1976, pp. 
73-82. 

S^lrma, K. V. See B. V. Subb 2 irayappa and K. V. Sarma [A5. 
1985]. 

Sarma, K. V. eind T. S. Kupp^mna Sastry. [A5. 1984]. “Vedahga 
Jyotisa of Lagadha (in its Rk ^md Yajus Recensions) with the 
Translation and Notes of T. S. Kuppemna S^lstry,” IJHS 19, 
1984, suppl. Reprinted New Delhi, 1985. 

Sarma, K. V. [A5. 1977]. “Tradition of Aryabhatiya in Ker^Ja: 
Revision of Plzmetary Paureimeters,” IJHS 12, 1977, 194-199. 

-. [A5. 1978]. “Astronomy and Mathematics in S^m- 

skrit Literature,” Technical Literature in Sanskrit, ed. S. 
Venkitjisubreunonia Iyer, Triv^lnd^um 1978, pp. 14-60. 

-. [A5. 1980]. “The Manuscripts Collection of the Jade 

F^lmily of Varanasi emd the Literary Output of the Jade 
Authors,” Bharatiya Vidya 40, 1980, 1, 26-34. 

-. [A5. 1984]. “Corrections in Indi^m Astronomy: Principles 

and Methods in Mediev^J Kerala,” Srijagannathajyotih 1, 
1984, 2, 127-133. 

-. [A5. 1985]. “A Survey of Source Materi£ds” in S. N. Sen 

eind K. S. ShuMa [A5. 1985], pp. 1-20. 

-. [A5. 1986a]. “Scientific Texts in Sainskrit in Aid of Modem 

Science,” Brahmavidya 50, 1986, 490-497. 

-. [A5. 1986b]. “Some Highlights of Astronomy and 

Mathematics in MedieveJ India,” Sanskrit and World Culture, 
Berlin 1986, pp. 595-605. 

-. [A5. 1987]. “Revision of Yug^ls ^md Yuga-constcints in In¬ 
dian Astronomy,” History of Oriental Astronomy, C£imbridge 
1987, pp. 77-83. 

-. [A5. 1988]. “Observational Astronomy in Mediev 2 J 

Kerala,” JAS 30, 1988, 31-38. 

S£uma, Mukunda Madhava. [A5. 1979/82]. “A Note on 

the Tradition of Sun-worship in Ancient Asseim,” Gauhati 
University Journal of Arts 30-33, 1979-82, 134-142. 

Sarma, N. N. [A5. 1977/78]. “A Study of the Tlrthakaumudl of 
PTtamb^u•a Siddhantavafpsa,” JARS 23, 1977-78, 39-44. 

^£irma, ^aradlata. [A5. 1981]. “Kal£isukta—eka vivecana,” 

Historical and Critical Studies in the Atharvaveda, NPS 53, 
Delhi 1981, pp. 357-368. 

S£uma, Sreer£imula Rajeswara. [A5. 1983]. “Varnamalika 

System of Determining the Fineness of Gold in Ancient £uid 
Mediev^d India,” Aruna-bharatf, Baroda 1983, 369-389. 

-. [A5. 1984]. “Th^lkkura Pheru’s Rayanaparikkha,” AJOS 

1, 1984, 1-84; reprinted Aligarh 1984. 

-. [A5. 1985]. “An Unpublished MS on Arab Astronomical 

Instnunents Attributed to Saw£u Jai Singh II—A Preliminary 
Report,” Studies in History of Medicine & Science 11, 1985, 
75-83. 

-. [A5. 1986]. “The Sources and Authorship of the 

Yuktik^dpat^l^u,” AJOS 3, 1986, 39-54. 


BIBLIOGRAPHY 


XXI 


-. [A5. 1986/87a]. “Astronomical Instruments in Brah¬ 
magupta’s BrahmasTphutasiddhanta" IHR 13, 1986-87a, 63- 
74. 

-. [A5. 1986/87b]. “Thetkkura Pheru £ind the Populau-ization 

of Science in India in the Fourteenth Century,” JJ 21, 1986-87, 
86-95. 

-. [A5. 1987]. “The Pavulu^ig^lmtamu. The First Telugu 

Work on Mathematics,” Studien zur Indologie und Iranistik 
13/14,1987, 163-176. 

-. [A5. 1991]. “Yantrapr£ik^a of Sawm Jm Singh,” Studies 

in History of Medicine and Science 10-11, 1986-87 [1991], 
suppl.; reprinted New Delhi, 1991. 

Saupotdar, Mrinalini. [A5. 1979/80]. “Scientific and Technical 
Contents in Kautilya’s Artheisastra,” JAS Bombay, NS 54/55, 
1979-80, 158-162. 

^astri, Bapudeva. [A5. 1911]. Mdna Mandira Observatory, 3rd 
ed., B£mareis 1911. 

^astrT, Bhujaball. [A5. 1947/48]. “Huinbuja ka granthabhanda- 
ra,” Jainasiddhantabhaskara 14, 1947-48, 2, 27-32. 

^astrT, Her£unba Chatterjee. (see H. Chatterjee). [A5. 1984/85]. 
“Divyatattva,” OH 32, 1984, 1, £irt. 11; 2, eirt. 6; 33, 1985, 1, 
art. 7; and 2, £irt. 5. 

Sastri, Kadalcingudi Natesa. [A5. 1986]. Strijdtaka (in Tamil), 
translated into English by K. N. S^u•^lswathy under the title 
Stree Jataka, KCBS 15, Madrets 1986. 

Sastri, Madhav^u•ama. [A5. 1950]. “Trailokya pradipa,” Jaina- 
siddhantabhaskara 17, 1950, 128-132. 

Sastri, N. Subramania. [A5. 1965]. “A Note on the Indologic 2 d 
Reseeirches of AlBiruni,” SVUOJ 8, 1965, 1-7. 

Sastri, Nemicandra. [A5. 1951]. “Jmnacarya I^iputra,” Jaina- 
siddhantabhaskara 18, 1951, 110-115. 

-. [A2. 1952]. 8th ed.. New Delhi 1978; 9th ed.. New Delhi 

1981; 10th ed., Varanasi 1983. 

-. [A5. 1954]. “M^lhavIra samvat,” J ainasiddhantabhaskara 

21, 1954, II 39-43. 

Sastri, S. Shrikantha. [A5. 1938/39]. “The Date of JaimbudvTpa 
prajfiapti Scimgr£dia,” Jaina Ant. 4, 1938-1939, 81-84. 

-. [A5. 1939/40]. “The Date of the Consecration of the 

Image of Gommatesveira,” Jaina Ant. 5, 1939-40, 107-114. 

-. [A5. 1947/48]. “The Date of ^rTdh 2 iracarya,” Jaina Ant. 

13, 1947-48, 2, 12-17. 

Sastri, T. V. G. [A5. 1971/72]. “Sun Sculptures from Al^unpur,” 
JAHRS 32, 1971-72, 86-93. 

-. [A5. 1989/90]. “Jaina Eras and their Chronology,” AV 2, 

1989-90, 2, 39-43. 

Sastri, Vijay^unitra. [A5. 1982]. “Vmdik 2 isuryavijnanam,” 

Proceedings of the First International Sanskrit Conference V, 
New Delhi 1982, pp. 60-78. 

Saxena, Pravesh. [A5. 1981]. “The Concept of Aditya in 

the Atharvaveda,” Historical and Critical Studies in the 
Atharvaveda, NPS 53, Delhi 1981, pp. 149-152. 

Schubring, Walther. [A2. 1969]. Reprinted in his Kleine 

Schriften, Wiesbaden 1977, pp. 402-413. 

Schuh, D. [A5. 1970]. “Studien zur Geschichte der Mathematik 
tmd Astronomie in Tibet, Teil I. Element£U'e Arithmetik,” 
Zentralasiatische Studien 4, 1970, 81-181. 

Sen, S. N., etnd K. S. Shukla. [A5. 1985]. eds.. History of 

Astronomy in India, New Delhi 1985. 

Sen, S. N. [A5. 1980]. “Scientific Works in Sanskrit Tr^lnslated 
into Foreign L^mguages and Vice Versa in the 18th and 
19th Centuries A.D.,” Proceedings of the First International 
Sanskrit Conference III 1, New Delhi 1980, pp. 100-118. 

-. [A5. 1982]. “Tieffenthaler on Latitudes and Longi¬ 
tudes in India—€m Eighteenth Century Study of Geographical 
Coordinates,” IJHS 17, 1982, 1-17. 


-. [A5. 1985]. “Survey of Studies in European Languages” in 

S. N. Sen and K. S. Shukla [A5. 1985], pp. 49-121. 

-. [A5. 1987]. “Pl£mietary Theories in Sanskrit Astronomical 

Texts,” History of Oriental Astronomy, Ceimbridge 1987, pp. 
113-124. 

-. [A5. 1988]. “Approach of Traditional Scholars and 

Modem Scientists in the Ev 2 duation of the Procedures by 
H«df in Computing the ^Ighra and Manda Corrections for 
Planet^lry Positions,” JAS 30, 1988, 55-65. 

Sen, Umapada. [A5. 1985]. “The Premier Science of Ancient 
India,” Proceedings of the Fifth World Sanskrit Conference, 
New Delhi 1985, pp. 833-836. 

Sengupta, Prabodh C£mdra. [1929]. Reprinted in D. Chattopad- 
hyaya [A5. 1982], vol. 2, pp. 537-590. 

-. [A5. 1955]. “A Short Note on Kh£ma’s Time,” JASB/L 

21, 1955, 59-61. 

Seshagiri, G. S. See G. S. S. Iyengar and G. S. Seshagiri [A5. 
1980]. 

Sethur 2 unan, N. [A5. 1977]. The Cholas. Mathematics 

Reconstructs the Chronology, Kiunbeikonam 1977. 

-. [A5. 1978]. “The RegneJ Year,” Studies in Indian 

Epigraphy 5, 1978, 105-109. 

Shaih, Prash£mt. [A5. 1987]. Essence of Hindu Astrology, 

Ahmedabad 1987. 

Sh^lrma, Arvind. [A5. 1982]. “Varaheimihira: an Ancient Indian 
Feminist?,” ZDMG 132, 1982, 142-149. 

Sh^lrma, B. N. [A5. 1981]. “Raj^lsth^mi Sculptxrres. Some 

Recent Acquisitions in the Nation«J Museum, New Delhi,” 
Cultural Contours of India, ed. Vijm Sheinkar Srivastava, 
Atlantic Highltmds, N. J., 1981, part II, pp. 192-196 (p. 194: 
Navagraheis). 

Sharma, Dash^u'atha. [A5. 1945a]. “Pippedika,” ABORI 26, 
1945, 152. 

-. [A5. 1945b]. “Kavindrakalpalata, A Hindi Work by 

Kavindracarya Sarasvatl,” ABORI 26, 1945, 153-154. 

Shamna, Hiir Dutt. [A5. 1938]. “Nirnayeikaustubha or Laghu- 
nir^yeikaustubha of Visvesv^u•abhatta,” IHQ 14, 1938, 345- 
352. 

Sharma, M. L. [A5. 1977a]. “Aryabhate’s Contribution to Indiatn 
Astronomy,” IJHS 12, 1977, 90-99. 

-. [A5. 1977b]. “Indian Astronomy at the Time of Aryabha¬ 
ta,” IJHS 12, 1977, 100-105. 

-. [A5. 1982]. “Jagannath S^lmrat’s Outstcinding Contribu¬ 
tion to Indian Astronomy in Eighteenth Century A.D.,” IJHS 
17, 1982, 244-251. 

Sheirma, P. V. [A5. 1976]. “Conunon Plants of the 6th Century 
A.D. ^ts Described in the Brhat S^lmhita of Var^amihira 
(505-587 A.D.),” Bulletin of the Indian Institute of History 
of Medicine 6, 1976, 8-27. 

Sheirma, Ram Charan. [A5. 1981], “Omens in Literature 

^md Art,” Cultural Contours of India, ed. Vijai Shankar 
Srivastava, Atl£mtic Highleinds, N. J., 1981, p^u•t II, pp. 
223-226. 

Sh£irma, Ram Dass. [A5. 1979]. “Baram^lsa Set of Miniature 
Paintings in Bikaner Musevun,” JRIHR 17, 1979, 3, 1-8. 

Sheirma, R. S. [A5. 1971]. “An Approach to Astrology and 

Divination in Mediaeval India,” Neue Indienkunde. New 
Indology, ed. H. Kruger, 2nd ed., Berlin 1971, pp. 51-56. 

Sharma, S. D. See S. S. Lishk and S. D. Sheirma [A5. 1975]; [A5. 
1977]; [A5. 1979]; [A5. 1980a]; and [A5. 1980b]. 

Sharma, S. D., eind S. S. Lishk. [A5. 1976]. “Time-units in 
Ancient Indiein Astronomy,” Tulast Prajnd, July-Dee. 1976, 
100-108. 

-. [A5. 1978]. “Length of the Day in Jeiina Astronomy,” 

Centaurus 22, 1978, 165-176. 


XXll 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Sharma, S. D. [A5. 1979]. “Astronomical Evidences Authenticate 
Historicity of Mahabharata W 2 ir” in G, C. Agcirwcila [A5. 1979] 
pp. 205-206. 

-. [A5. 1981]. “Pluto and a TrcUisplutonictn Planet as 

Predicted by Venkatesha Ketaikcira,” IJHS 16, 1981, 118-129. 

-. [A5. 1985a]. “Post-Vedic Astronomy” in S. N. Sen and K. 

S. Shukla [A5. 1985], pp. 131-144. 

-. [A5. 1985b]. “Eclipses, PareiUax and Precession of 

Equinoxes” in S. N. Sen and K. S. Shukla [A5. 1985], pp. 
188-211. 

-. [A5. 1985c]. “Astronomical Observatories” in S. N. Sen 

and K. S. Shiikla [A5. 1985], pp. 337-362. 

-. [A5. 1987]. “Periodic Nature of Comet^u•y Motions 

as Known to Indian Astronomers before Eleventh Centiury 
A.D.,” History of Oriental Astronomy, Cambridge 1987, pp. 
109-112. 

Shcirma, Saktidhara (= S. D. Shcirma). See J. Sisodiya, S. 
Sairma, and S. S. Liska. [A5. 1977]; and N. K. Cheuidel and 
S. Sharma [A5. 1991]. 

-. [A5. 1982]. “Jciinajyautisesuryadvayasiddhantcisyanavya- 

jyautisaparipreksye vyavastha sauravarsamanasamsodh<in 2 m 
ca,” Visvasamskrtam 19, 1982, 33 sqq. 

Shcirma, Virendra N., ^lnd Lila Huberty. [A5. 1984]. “Jesuit 
Astronomers in Eighteenth Century India,” AIMS 34, 1984, 
99-108. 

Sharma, Virendra Nath. [A5. 1982a]. “Jeii Singh, His European 
Astronomers and the Copemican Revolution,” IJHS 17, 1982, 
333-344. 

-. [A5. 1982b]. “The Impact of the Eighteenth Century 

Jesuit Astronomers on the Astronomy of India and China,” 
IJHS 17, 1982, 345-352. 

-. [A5. 1984]. “The Great Astrolabe of Jaipm and its Sister 

Unit,” JHA 15 (= Archaeoastronomy 7), 1984, S126-S128. 

-. [A5. 1987]. “Astronomical Efforts of Sawai Jcii Singh—A 

Review,” History of Oriental Astronomy, Cambridge 1987, 
pp. 233-240. 

-. [A5. 1990]. “Zlj-i Muhammad ShahJ and the Tables of de 

La Hire,” IJHS 25, 1990, 34-44. 

-. [A5. 1991a]. “The Kap^a Yantras of Sawai Jai Singh,” 

IJHS 26, 1991, 209-217. 

-. [A5. 1991b]. “Precision Instrmnents of Sawai Jai Singh,” 

IJHS 26, 1991, 249-276. 

Shcistri, Manoranjan. [A5. 1974]. “The Author of the Smiti- 
sagara,” JARS 22, 1974, 1, 25-31. 

Shastri, Udaya Veera. [A5. 1979]. “Editorial Note” in G. C. 
Agarwala [A5. 1979] pp. 41-68. 

Shelat, Bhairati Kirtikmnar. [A5. 1987]. The Chronological 

Systems of Gujarat, Paldi, Ahmedabad 1987. 

Shen, K. S. See A. K. Bag and K. S. Shen [A5. 1984]. 

Sheshagiri, G. S. See G. S. Sampath lyangar and G. S. Sheshagiri 
[A5. 1979]. 

-. [A5. 1982]. Discourse on Ancient Hindu Astronomy, 

Madras 1982. 

Shimkhoda, Deepak. [A5. 1984]. “The Masquerading Sim: a 
Unique Syncretic Image in Nep^ll,” Artibus Asiae 45, 1984, 
223-229. 

Shukla, B. G. See H. M. Jcini, B. H. Yagnic, eind B. G. Shukla 
[A5. 1984]. 

Shukla, Kripa Sh£ink£ir. See B. Datta amd A. N. Singh [A5. 
1980]. 

-. See S. N. Sen and K. S. Shukla [A5. 1985]. 

-. [A5. 1971]. “Sadvimsa Brahm^lna—A Study,” SSP 11, 2, 

1971, 31-37. 

-. [A5. 1976]. “Aryabhata,” Cultural Leaders of India. 

Scientists, New Delhi 1976, pp. 83-99. 


-. [A5. 1977a]. “The Pahca-siddhantika of Varahamihira 

(2),” Ganita 28, 1977, 99-116 (a continuation of K. S. Shukla 
[A4. 1973b]). 

-. [A5. 1977b]. “Glimpses from the Aryabhata-siddhanta,” 

IJHS 12, 1977, 181-186. 

-. [A5. 1980]. “Series with Fractional Number of Terms,” 

Bhdratibhanam, PUIS 26, Hoshieupm-1980, pp. 475-481. 

-. [A5. 1984]. “A Note on Raymond P. Mercier’s Review of 

Karanaratna of Devdcdrya," GB 6, 1984, 25-28. 

-. [A5. 1985]. “Phases of the Moon, Rising amd Setting of 

Pl£inets and St£irs £ind their Conjunctions” in S. N. Sen and 
K. S. Shukla [A5. 1985], pp. 212-251. 

-. [A5. 1987]. “Main Chaireicteristics and Achievements of 

Ancient Indian Astronomy in Historicad Perspective,” History 
of Oriental Astronomy, C^lmbridge 1987, pp. 9-22. 

Sidheirth, B. G. [A5. 1978]. “Glimpses of the Amazing 

Astronomy of the Rig-Veda,” Ind. Taur. 6, 1978, 289-292. 

Sikdcir, J. C. [A5. 1975]. “Jaina Concept of Space (akasa),” 

Contribution of Jainism to Indian Culture, Delhi-V^lranasi- 
Patna 1975, pp. 146-161. 

-. [A5. 1977]. “Eclipses of the Sun and Moon According to 

Jaina Astronomy,” IJHS 12, 1977, 127-136; repr. in Jaina 
Journal 20, 1985-86, 61-75. 

Sing^ll, Asha Rani. [A5. 1986]. “The Misplaced Credit,” GB 8, 
1986, 35-38. 

Singh, Avadesh Narayein. See B. Datta and A. N. Singh [A5. 
1980]; [A5. 1983]; and [A5. 1984]. 

-. [A5. 1949/50]. “History of Mathematics in India from 

Jaina Sources,” Jaina Ant. 15, 1949, 46-53, and 16, 1950, 
54-69. This replaces A. N. Singh [1949]. 

Singh, M. Kirti. [A5. 1982]. “M£impuri System of Astrology and 
Astronomy,” PAIOC ZO, Poona 1982, 423-431. 

Singh, MahendraPratap. [A5. 1989]. Planets in Orbit (Transit), 
Varancisi 1989. 

Singh, Navjyoti. [A5. 1988]. “Jmn Theory of ActucJ Infinities 
and Tr^lnsfinite Numbers,” JAS 30, 1988, 77-111. 

Singh, Parm^lnand. [A5. 1979]. “A CriticcJ Study of the 

Contribution of Ncirayana Pandita to Hindu Mathematics,” 
GB 1, 1979, 5-6. 

-. [A5. 1981]. “N^ayana’s Treatment of Net of Niunbers,” 

GB 3, 1981, 16-31. 

-. [A5. 1982]. “Total Number of Perfect Magic Squares: 

Narayana’s Rule,” ME 16, 1982, 1, 32-37. 

-. [A5. 1983]. “Contributions of Some Jeiin acaTy6is 

to Combinatorics,” Vaishali Institute Research Bulletin 4, 
[1983?], 90-110. 

-. [A5. 1983/84]. “QuadrilateraJ and its Third Diagonal,” 

VIJ 21, 1983-84,219-227. 

-. [A5. 1984a]. “Varga-Prakrti: the Cakravdla Method of 

its Solution emd the Regular Continued Fr^lctions,” IJHS 19, 
1984, 1-17. 

-. [A5. 1984b]. “Narayana’s Method for Evaluating Quadra¬ 
tic Surds eind the Reguljir Continued Fraction Expansions of 
the Surds,” ME 18, 1984, 2, 63-65. 

-. [A5. 1984c]. “N^ayeina’s Rule for Finding Integreil 

Triangles,” ME 18, 1984, 4, 136-139. 

-. [A5. 1985]. “The So-called Fibonacci Numbers in Ancient 

and Medieval India,” HM 12, 1985, 229-244. 

-. [A5. 1986]. “Narayana’s Treatment of Magic Squares,” 

IJHS 21, 1986, 123-130. 

-. [A5. 1987]. “ ‘Ratna Manjusa’, a Jetin Work on S^lnskrit 

Prosody and Binomial Coefficients,” ME 21, 1987, 2, 44-50. 

-. [A5. 1988/89]. “Acarya Jayadeva’s Treatment of 

Permutations and Combinations,” AVI, 1988-89, 2, 43-48. 


BIBLIOGRAPHY 


Singh, Prahlad. [A5. 1978]. Stone Observatories in India, 

Varemasi 1978. 

Singh, Sheo Bahadur. [A5. 1981]. “Aditya-Surya 2 uid his Rare 
Image,” VIJ 19, 1981, 220-225. 

Singh, Tcihsildar. [A5. 1981]. ^^Bhavisya-Purdna and Brhatsarn- 
hitd on Temple Architecture: A Collective Study,” VIJ 19, 
1981,226-236. 

Singh, Tej. [A5. 1976]. “Reciprocity of Astrology to Patanjali 
Yoga,” Proceedings of the First International Sanskrit Con¬ 
ference II 2, New Delhi 1976, pp. 338-347. 

Sinha, Kripa Nath. [A5. 1985]. “^rlpati: ^m llth-Centm-y 

Indian Mathematician,” HM 12, 1985, 25-44. 

-. [A5. 1986]. “Algebra of SrTpati: An Eleventh Centiu-y 

Indian Mathematiciam,” GB 8, 1986, 27-34. 

-. [A5. 1988]. “Vyaktaganitadhyaya of SrTpati’s Siddhantet- 

sekhara (English Tremslation with Introduction),” GB 10, 
1988, 40-50. 

Sircar, D. C. [A5. 1971a]. Studies in the Religious Life of 

Ancient and Medieval India, DeUii-Patna-Varanasi 1971. 

-. [A5. 1971b]. “Srm Temple at Mun^ra,” in D. C. Sirc£U'. 

[A5. 1971a] pp. 246-252. 

-. [A5. 1971c]. “Gems for the Propitiation of Plcmets,” in D. 

C. Sircar [A5. 1971a] pp. 258-264. 

-. [A5. 1972]. “The Number of Ratneis,” S. K. De Memorial 

Volume, Calcutta 1972, pp. 75-81. 

Sisodiya, Jagadlsasimha, Saktidhara ^«irma, and Sajjana Siinha 
Liska. [A5. 1977]. “Bharatiya ev^lm talamlya jyotisa ka 

tulematmaka adhyayana,” Tulasi Prajnd, Apr.-Sept. 1977, 
108-123. 

Sivapriy6inamda, Sweimi. [A5. 1990]. Astrology and Religion in 
Indian Art, New Delhi 1990. 

Snodgrass, Adrian. [A5. 1990]. Architecture, Time and Eternity, 
2 vols., Delhi 1990. 

Sohoni, S. V. [A5. 1989]. “GeographiceJ Bfisis of Kalidasa’s 

Works,” ABORI 70, 1989, 221-233. 

Somayaji, D. Arka (see D. Arkasomayaji). [A5. 1980]. “Some 
New Mathematic£j Facts in Ancient Hindu Astronomy,” Pro¬ 
ceedings of the First International Sanskrit Conference III 1, 
New Delhi 1980, pp. 210-217. 

-. [A5. 1985]. “The Yuga System and the Computations of 

Mean and True Planet^lry Longitudes” in S. N. Sen and K. S. 
Shukla[A5. 1985], pp. 145-187. 

Srinivasacharicir, M. [A5. ?]. An Ideal Guide to Success in Life 
thro’ Astrology and Mantras, Madreis [N. D.]. 

Srinivas^ln, Saradha. [A5. 1979]. Mensuration in Ancient India, 
Delhi 1979. 

-. [A5. 1982]. “Evolution of Weights and Mecismes in 

Ancient India,” GB 4, 1982, 17-25. 

Srinivaseiraghavan, K. [A5. 1979]. “Date of the Mediabharata 
Wax” in G. C. Ag^lrw^lla [A5. 1979] pp. 210-215. 

Sri Rcuna Murthi, Govindu. [A5. 1978]. Geocentric Planetary 
Potency, Srikakulam 1978. 

Sriv£istava, M. P. [A5. 1990]. Astrology in Aid of Heart Trouble 
and Blood Pressure, Delhi 1990. 

Sriv^lstava, R. S. L. [A5. 1985]. Ganita Kaumudi, Kanpur 1985. 

Srivastava, V. C. [A5. 1987]. “Temtricism and the Sun-cult in 
India: A HistoriceJ Perspective,” Purdna 29, 1987, 166-184. 

Staail, Frits. [A5. 1982]. The Science of Ritual, Poona 1982. 

Stone, Anthony Philip. [A5. 1981]. Hindu Astrology: Myths, 
Symbols and Realities, New Delhi 1981. 

-. [A5. 1985]. “Indian Shadow Formulae Using the Foot as 

Unit,” GB 7, 1985, 1-12. 

Stuhrmann, Rmner. [A5. 1982]. Der Traum in der altindischen 
Literatur im Vergleich mit altiranischen, hethitischen und 
griechischen Vorstellungen, Tubingen 1982. 


xxiii 

Subbarava, Rallabau<h. [A5. 1933]. “The Initial Yeeir of 

the Little Known E€istem Gamga Era,” Bhdrattya Anusilana 
Grantha, Prayaga Sain. 1990 = A.D. 1933, p£irt II, pp. 20-22. 

Subbarayappa, B. V., and K. V. Sarma. [A5. 1985]. Indian 
Astronomy. A Source Book, Bombay 1985. 

Subrahmcinya Scistri, P. P. [A5. 1941]. “Problems of Identity— 
Visvarupa, the Author of Balakrlda, emd Visveirupacarya alias 
Suresvciracarya,” A Volume of Studies in Indology, POS 75, 
Poona 1941, pp. 405-407. 

Supekar, S. G. See P. P. Apte and S. G. Supekar [A5. 1983]. 

Tagare, G. V. [A5. 1974/76]. “A propos ‘Aryabhate and 

Lokayatas’,” JAS Bombay 49-51, 1974-1976, 218-219. 

Thakura, B. L. [A2. 1968/81]. Sacitra jyotisa siksd, vol. 3, 
pt. 3, Dilll-Varanasi-Patana 1975; vol. 4, Dilll-V^anasl- 
Pat^ma 1976; vol. 5, DiUl-Varanasi-Patana 1978; vol. 6, 
DiUl-Varanasi-Pa^na 1979; vol. 8, DiUl-Varanasi-Pa^na 
1981. 

Thakura, N. P. [A5. 1978]. Hastarekhd sdmudrika siksd, 

DiUl-Varanasi-Pa^a 1978. 

Thibaut, George Frederick. [1875]. Reprinted in D. Chattopa- 
dhyaya [A5. 1982], vol. 2, pp. 415-478. 

-. [1877]. Reprinted in D. Chattopadhyaya [A5. 1982], vol. 

2, pp. 479-502. 

-. [A5. 1984]. Mathematics in the Making in Ancient India, 

CeJcutta-DeUii 1984. This is a reprint of G. F. Thibaut [1875] 
on pp. 3-66, and a reprint of G. F. Thibaut [1874/77] on pp. 
69-134; the Sanskrit text is omitted from the latter. 

Thieme, Paul. [1937]. Reprinted in P. Thieme [A5. 1971] pp. 
532-536. 

-. [A5. 1971]. Kleine Schriften, Wiesbaden 1971; reprinted 

Wiesbaden 1984. 

Threisher, Allen W. [A5. 1979]. “Some Sanskrit Works on 

Karmiis £md their Results,” Ludwik Sternbach Felicitation 
Volume, 2 pts., Lucknow 1979 [1981], pp. 721-724. 

Tileik, Bal Gangadhar [—]. French translation by J. and C. 
Remy as Origine polaire de la tradition vedique, Milano 1979. 

TirthajI Maharaja. [1965]. Partied Marathi version in B. G. 
Bapa^, Vaidika ganita, Pune 1982. 

Tiirstig, Hems-Georg. [A5. 1980]. Jyotisa. Das System der 

indischen Astrologie, Wiesbaden 1980. 

Upadhyaya, S. A. [A5. 1965]. “Syadvadamuktavall or Jainavi- 
sesatarka of ^rl Yeiseisvatsagara,” Bhdrattya Vidyd 25, 1965, 
3-4, 51-73. 

Upadhye, A. N. [A5. 1938/41]. “TiloyapemnattI,” Jainasiddhdn- 
tabhdskara 5, 1938-1939, 1 (pp. 49-56), 2 (pp. 57-64), 3 (pp. 
65-72), and 4 (pp. 73-80); 6, 1939-1940, 1 (pp. 81-88), 2 
(pp. 89-96), and 3 (pp. 97-104). Another two gatherings 
appeetred in vol. 7; and pp. 1-120 were published at Arredi in 
[1941]. 

Upadhye, P. M. [A5. 1976]. “Contribution of Ancient India to 
Astronomy,” Tulasi Prajnd, July-Dee. 1976, 82-87. 

Ursekar, H. S. [1958]. Reprinted in his Essays on Indology, 
Aiu-angabad 1981, pp. 1-20. 

-. [A5. 1962]. “Some Mathematical Achievements of Ancient 

India,” JUB 1962, reprinted in his Essays on Indology, 
Aureingabad 1981, pp. 112-122. 

-. [A5. 1968]. “The Sun in the R^eda,” Bhdrattya Vidyd 28, 

1968, 55-63; reprinted in his Essays on Indology, Aur£uigabad 
1981, pp. 21-30. 

Vaiidya, R. V. [A5. 1967]. A Study of Mahabharat, Poona 1967. 

van der Waerden, Bartel Leendert. [A5. 1980a]. “Ewige Taifeln,” 
Festschrift Fleckenstien, 1980, pp. 285-293. 

-. [A5. 1980b]. “Two Treatises on Indiein Astronomy,” JHA 

11, 1980, 50-58. 


XXIV 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


-. [A5. 1980c]. “The Conjimction of 3102 B.C.,” Centaurus 

24, 1980, 117-131. 

-. [A5. 1983]. Geometry and Algebra in Ancient Civiliza¬ 
tions, Berlin-Heidelberg-New York-Tokyo 1983. 

-. [A5. 1985]. “Greek AstronomiwJ Calendars V. The 

Motion of the Smi in the P^lrapegma of Geminos and in the 
Romaka-Siddh^ta,” AHES 34, 1985, 231-239. 

-. [A5. 1987a]. “The Heliocentric System in Greek, Persian 

^lnd Hindu Astronomy,” Annals of the New York Academy of 
Sciences 500, 1987, 525—545. 

-. [A5. 1987b]. “The Astronomical System of the Persian 

Tables II,” Centaurus 30, 1987, 197-211. 

-. [A5. 1988a]. “On the Romaka-Siddhanta,” AHES 38, 

1988,1-11. 

-. [A5. 1988b]. “The ‘Day of Brahman’ in the Work of 

Aryabhata,” AHES 38, 1988, 13-22. 

-. [A5. 1988c]. “Reconstruction of a Greek Table of Chords,” 

AHES 38, 1988, 23-38. 

-. [A5. 1988d]. “A Sununeuy of Roger BiIl^u•d’s L’astronomic 

indienne," GB 10, 1988, 21-30. 

Vciradarajan, Lotika. [A5. 1977]. “A Note on the Ciurency 

aind Mensiu-ation of Smat cmd Ahmedabad during the Late 
Medieval Period,” Indica 14, 1977, 21-28. 

V£trma, Kaiilash Ch^mdra. [A5. 1979]. “Editorial Note” in G. C. 
Agarwala. [A5. 1979], pp. 69-142. 

-. [A5. 1980]. “Astronomical Lore of Observationcd 

Natm-e Possessed by the Vedic Aryans and Some Extremely 
Primitive African, Australian and South American Tribes. 
A Comp 2 irison,” ABORI 61, 1980, 101-130. Reprinted in 
Rtambhard. Studies in Indology, Ghaziabad 1986, sect. V, 
pp. 171-190. 

-. [A5. 1985]. “The Date of the Ramay^ma, Vedic Chronology 

eind the Kfdiyuga Era,” JAHRS 38, 3, 1985, 99-128. 

Vcirma, V. K. [A5. 1984]. “Is there Cosmology in the Metaphor- 
iccd Episode of Indra-Vrtra in Rgveda (I),” PAIOC 31, Poona 
1984, 243-249. 

V^u■t^lk, Padmakar Vishnu. [A5. 1979]. “Time of Mahabharata 
War” in G. C. Agarwala [A5. 1979] pp. 293-297. 

-. [A5. 1985/87]. “Determination of the Date of M 2 iha- 

bharata by Astrononlic^ll Method,” Bharatiya Vidya 45-47, 
1985-87, 272-278. 

Vasudev, Gayathri Devi. See B. V. Reimem ^md G. D. Vasudev 
[A5. 1980/81]. 

Vedapraikasa. See L. Jaina and Vedaprcikasa [A5. 1976]. 

Vedavycis, E. [A5. 1981]. “The Mediabharata War—A Red-letter 
Date in India’s History,” Proceedings of the First International 
Sanskrit Conference IV, New Delhi 1981, pp. 86-105. 

-. [A5. 1986]. Astronomical Dating of the Mahabharata 

War, Delhi 1986. 

Venkatached 2 un, Kota. [A5. 1955]. Chronology of Kashmir 

History Reconsidered, Kollur 1955. 

VidyabhuMina, An^uldac^lndra. [A5. 1892]. Sriraghunandana- 
bhattdcaryaviracitatithyudvdhatattvayor dksepasamddhdnam, 
Dacca 1892. 

Vidyavacaspati, ^iv^lnatha. [A5. 1897]. Smrtivicdrasdrakaumu- 
di, Calcutta 1897. 


Vogel, Claus. [A5. 1974]. “Ameirakirti’s Vyakhyalesa,” ZDMG, 
suppl. 4, 1974, 419-433; English tr^ulslation in German 
Scholars on India, vol. 2, Delhi-Varanasi-Patna 1976, pp. 
327-341. 

Volodarsky, Alexemder I. [A5. 1977]. “MathematiceJ Achieve¬ 
ments of Aryabhate,” IJHS 12, 1977, 167-172. 

-. [A5. 1986]. “Mathematical Knowledge in the Epoch of 

the H^u'appa Cultme—On the Materials from the Excavations 
in Loth^J,” Sanskrit and World Culture, Berlin 1986, pp. 
606-611. 

von Simson, Georg. [A5. 1984]. “The Mythic Background of the 
Meihabh^ata,” Indologica Taurinensia 12, 1984, 191-223. 

von Stietencron, H. [A5. 1985/87]. “A Note on Surya Worship 
and the Ircuiian Cult of Mithra,” Bhdratiya Vidyd 45-47, 
1985-87, 13-22. 

Wadekar, M. L. [A5. 1987/88]. “Utsav^lnirMy^unanjarT—A 

Rare and Unpublished Work of Gahgadh^lra, A SchoW from 
Gujarat,” JOI Baroda 37, 1987-88, 89-125 and 253-284. 

Weilhouse, M. J. [A5. 1876]. “Archaeological Notes. IX— 

Folklore,” lA 5, 1876, 21-25. 

Weber, Albrecht. [1859]. Repr. in his Indische Streifen, vol. 1, 
Berlin 1868, pp. 274-307. 

-. [A5. 1861]. “Vedische Angaben iiber Zeittheilimg xmd 

hohe Zahlen,” ZDMG 15, 1861, 132-139; repr. in his Indische 
Streifen, vol. 1, Berlin 1868, pp. 90-103. 

Witzel, Michael. [A5. 1984]. “Siu* le chemin du ciel,” BEI 2, 
1984, 213-279. 

WojtiUa, Gyula. [A5. 1976]. “Kreipar^ara,” Wissenschaftliche 
Zeitschrift der Humboldt-Universitdt zu Berlin, Ges.-Sprachw. 
R 25, 1976, 377-378. 

Yagnic, B. H. See H. M. J^mi, B. H. Yagnic, and B. G. Shukla 
[A5. 1984]. 

Yamo, Michio. See T. Hayeishi, T. Kusuba, £md M. Yano [A5. 
1990]. 

-. [A5. 1977]. “Three Types of Hindu Sine Tables,” IJHS 12, 

1977, 83-89. 

-. [A5. 1980]. “Aryabhate’s Possible Rebutted to Objec¬ 
tions to his Theory of the Rotation of the Earth,” Historia 
Scientiarum 19, 1980, 101-105. 

-. [A5. 1984]. “Kushyar ibn Labban’s Book on Astrology,” 

Bulletin of the International Institute for Linguistic Sciences, 
Kyoto Sangyo University 5, 1984, 2, 67-89. 

-. [A5. 1986a]. “Knowledge of Astronomy in Sanskrit 

Texts of Architecture (Orientation Methods in the Isdnasiva- 
gurudevapaddhati)," IIJ 29, 1986, 17-29. 

-. [A5. 1986b]. Mikkyosenseijyutsu, Kyoto (?) 1986. 

-. [A5. 1987a]. “The Hsiu-yao Ching emd its Sanskrit 

Sources,” History of Oriental Astronomy, Ceimbridge 1987, 
pp. 125-134. 

-. [A5. 1987b]. “Trigonometry in India,” Chusei no Sugaku, 

Kyoto 1987, pp. 466-483 (in Japanese). 

-. [A5. 1987c]. “Science eind Religion in Ancient India,” Zen 

Buddhism Today 5, 1987, 50-59. 

Zeller, Gabrielle. [A5. 1990]. Die vedischen Zwillingsgotter, FBI 
24, Wiesbaden 1990. 

Zimmermeum, Fremcis. [A5. 1981]. “Les aspects medicaux du 
Yavanajdtaka," Sudhoffs Archiv 65, 1981, 299-305. 


LIST OF CATALOGS OF SANSKRIT MANUSCRIPTS AND BOOKS 


Aligarh: S. R. Setrma, A Catalogue of Sanskrit Manuscripts. 
(A) Jyotihsdstra, undated typescript. Preserved in the De- 
peirtment of Seinskrit, Ahgeirh Muslim University. 

AS Bengal: Kvmja Vih^lri KavyatTrtha, Catalogue of Printed 
Books and Manuscripts in Sanskrit Belonging to the Oriental 
Library of the Asiatic Society of Bengal, Calcutta 1904. 

*AS Bengcil I 3: Narendra Chandra Vedemtatirtha, Pulinbihciri 
Chakraveirti, eind Amitabha Bhattacharyya, A Catalogue of 
Sanskrit Manuscripts in the Collections of the Asiatic Society, 
vol. 1, Vedic Manuscripts, part 3, Calcutta 1973. 

*AS Beng£j XIII: Ajit Bhattachauya, A Descriptive 

Catalogue of the Sanskrit Manuscripts, vol. 13, fasc. 1-2, 
Ceilcutta 1958-66; Satya Ranjcin Bainerjee, idem, f£isc. 3, 
Calcutta 1987. 

*AS Bengal XIV: MM. Hciraprasada ShastrT and Chinteih«iran 
Chcikravcirti, A Descriptive Catalogue of the Sanskrit Manu¬ 
scripts in the Collections of the Asiatic Society, vol. XIV, 
Calcutta 1955. 

BHU: Rama Scihkar TripathJ, Descriptive Catalogue of Samskrit 
Manuscripts in Gaekwada Library, Bharat Kald-bhavana Li¬ 
brary and Samskrit Maha-vidyalaya Library, Banares Hindu 
University, BHUSS 6, Va^^m^lsi 1971. 

BHU (ayurveda): Rama Sheuikar Tripathi, A Descriptive Cat¬ 
alogue of Manuscripts on Ayurveda in the Banaras Hindu 
University, V^lran^lsi 1984. 

Bhubcmesweir 2: N. Mishra, An Alphabetical Catalogue of San¬ 
skrit Manuscripts in the Collection of the Orissa State Mu¬ 
seum, Bhubaneswar, peirt II, Bhubemeswar 1974. 

*Bhubaneswar III: Kedaxnath M^lhapatra, A Descriptive Cata¬ 
logue of Sanskrit Manuscripts of Orissa in the Collection of 
the Orissa State Museum, Bhubaneswar, volume III, Bhuba¬ 
neswar 1962. 

^Bhubaneswar IV: Kedamath Meihapatra, idem, Vol. IV, Bhu- 
banesw^lr 1963. 

*Bhubaneswax VII: Nilamani Mishra, idem, vol. VII, Bhubcmes- 
war 1971. 

*BM: J. P. Losty, A Catalogue of Sanskrit and Prakrit Manu¬ 
scripts in the British Museum, vol. 2, [London 1972]. 
Typescript. 

*BM: “Manuscript Acquisitions, 1975,” BLJ 6, 1980, 77-85; «md 
BLJ 9, 1983, 79-80. 

*BORI (Agama): Hir£d£Ll R£isikdas Kapadia, Descriptive Cata¬ 
logue of the Government Collections of Manuscripts, vol. 17, 
Part I, Poona 1935; Peirt II, Poona 1936; Peirt III, Poona 
1940; Part IV, Poona 1948; and Peirt V, Poona 1954. 

*BORI (Dharma): Heir Datta Sharma, Descriptive Catalogue of 
the Government Collections of Manuscripts, vol. VII: Paxt I, 
Dharmasastra, Poona 1975. 

Coochbeheir: D. K. Kemjilal, A Descriptive Catalogue of Sanskrit 
Manuscripts Preserved in the Sdhitya Sabhd of Coochbehar, 
Coochbehar 1978. 

Delhi Jaina (Dharmapma): Kundein Led Jain, Delhi Jina Gran- 
tha Ratndvali (Catalogue of Sanskrit, Prakrit & Apabhramsa 
Manuscripts of Dig. Jain Saraswati Bhandar, Naya Mandir, 
Dharmapura, Delhi), Delhi 1981. 

Finlemd: Henry Heden, Handbook of Oriental Collections in 
Finland, London emd Mahno 1977. 


Florence (Add.): imcatalogued Semskrit memuscripts in the 
BibUoteca Nazionede, Firenze; in the sequence of mss. Indieini. 

*GJRI: Descriptive Catalogue of Sanskrit Manuscripts in Gan- 
ganatha Jha Kendriya Sanskrit Vidyapeetha, vol. 2, Alla¬ 
habad, 2 pts., 1973; emd vol. 3, AUahabad 1975. 

Hindi (1902): Syeunstmdeir Deis, Annual Report on the Search 

for Hindi Manuscripts for the Year 1902, AUahabad 1906. 

Jedna Bhandareis: Treasures of Jaina Bhandaras ed. U. P. Sheih, 
LDS 69, Ahmadabad 1978. 

Jedpur (Dheirma): Goped Neirayem Bahura, Catalogue of Manu¬ 
scripts in the Maharaja Sawai Man Singh II Museum (Pothi- 
khana Collection; (a) Dharmasastra), Jaipur 1984. 

Jaipvu: (Kheismohor): Goped Narayem Bahura, Literary Heritage 
of the Rulers of Amber and Jaipur, Jaipiu* 1976, pt. 2, pp. 
3-342 (Kheismohor CoUection in the Maharaja Sawed Mem 
Singh II Museum, Jedpur). 

Jeimmu: M. M. Patkar, Descriptive Catalogue of Manuscripts in 
the Shri Ranbir Sanskrit Research Institute, Jammu (Kash¬ 
mir), vols. 1-3, Jammu 1970-1984. 

JGB: Prem Chand Jedn, Jain Granth Bhandars in Jaipur and 
Nagaur, Jaipur [1978]. 

Jodhpur: A Catalogue of Manuscripts in Maharaja Mansingh 
Pustak Prakash, Jodhpur, peirt 2, compiled by Kuleiram Vyeis 
and D. B. Kshirsageir, Shri Umed Oriental Series 3, Jodhpur 
1986. 

Jodhpur (Hindi/Rajeisthan!): Kedu Reim Vyeis, A Catalogue 
of Manuscripts in Maharaja Mansing Pustak Prakash Jodh¬ 
pur, Peirt 1 (Hindi and Rajeisthani Memuscripts), Shri Umed 
Oriental Series 2, JocUipm 1981. 

Kathmemdu (1964): Nepdfardstriya pustakdyasthahastalikhita- 
pustakdndm suctpatram. Jyotisavisayah; dvitiyo bhdgah, 
PGM 27, Kathmemdu [1964]. 

Kathmandu (1965): Hastalikhita granthaharuko sucipatra bhdga 
3, PGM 32, Kathmemdu 1965. 

Kyoto: Kiyoteika Goshima emd Keiya Noguchi, A Succinct 
Catalogue of the Sanskrit Manuscripts in the Possession of 
the Faculty of Letters, Kyoto University, Kyoto 1983. 

LDI (Gujarati): Muniraja Sri Punyavijayaji and Vidhatri Vora, 
Catalogue of Gujarati Manuscripts. Munirdja Sri Punyavi- 
jayaji’s Collection, LDS 71, Ahmedabeid 1978. 

Mysore (1905): A Classified Catalogue of Sanskrit and Kannada 
Manuscripts in the Sarasvati Bhanddram (Palace Sanskrit 
Library) of H. H. the Maharaja of Mysore. Collections of 
1900-1905, Mysore 1905. 

Mysore ORI: Descriptive Catalogue of Sanskrit Manuscripts, 
vol. 1, ed. G. Meirulasiddaiah, Mysore 1978; vol. 2, ed. idem, 
Mysore 1978; vol. 3, ed. idem, Mysore 1979; vol. 4, part A, 
ed. idem, Mysore 1980; vol. 4, part B, ed. H. P. MaUedeveiru, 
Mysore 1984; vol. 5, ed. G. Maruleisiddiah, Mysore 1980; 
vol. 6, ed. idem, Mysore 1981; vol. 7, peirt A, ed. H. P. 
MaUedeveiru, Mysore 1984; vol. 8, ed. idem, Mysore 1982; 
vol. 9, ed. idem, Mysore 1983; vol. 10, ed. idem, Mysore 
1984; vol. 11, ed. idem, Mysore 1985; vol. 12, ed. idem, 
Mysore 1987; vol. 13, ed. idem, Mysore 1986; vol. 14, ed. 
idem, Mysore 1988; emd vol. 15, ed. idem, Mysore 1987. 

Nagaur: P. C. Jain, A Descriptive Catalogue of Manuscripts in 
the Bhattarkiya Granth Bhandar, Nagaur, Jeupm-1981. 


XXV 


XXVI 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*NCC vol. 10, Madras 1978; vol. 11, Madras 1983; vol. 12, 
Madras 1988. 

New Delhi, N. M.: Nationeil Museum, New Delhi; list of jyotisa 
mss. from Takao Haycishi. 

*NPS (Sanskrit): vols. 3-5, Var^asT 1975-1977. 

Peinjab JB I: Bamarsi Das Jain, A Catalogue of Manuscripts in 
the Panjab Jain Bhandars, peirt 1, Lahore 1939. 

Pattan II: Muni PunyavijayajT, Patana-Srihemacandracaryajai- 
najndnamandirasthita Jaina Jndnabharnddronurn sucipatra, 
vol. 1, Patana 1972. 

Pondicherry: V. Varadeohari, Catalogue descriptif des manu- 
scrits, PIFI 70.1, Pondichery 1986. 

Poona, Mandhk: Catalogue of Books and Manuscripts in the 
Mandlik Section of the Fergusson College Library, Poona 
1914. 

Prayaga: Ramakumara Varma and others, Hastalikhita hindi 
grarnthorn kt vivarandtmaka suci, Prayaga 1971 (belonging to 
the Hindi Sahitya Sammelcma, Prayaga). 

*PrSB: Klaus L. J£mert imd N. N. Poti, Indische Handschriften, 
Teil 5, Wiesbaden 1979; Teil 6, Wiesbaden 1980; Teil 7, 
Wiesbaden 1985; Teil 8, Stuttgcirt 1987; and Teil 9, Stuttgart 
1990. 

*RORI Cat. IV: Catalogue of Sanskrit and Prakrit Manuscripts 
in the Oriental Research Institute, part 4, ed. Muni Jinavijaya, 
RPG125, Jodhpiu'1976; Cat. V: idem, pcirt 5, ed. Ompraikash 
Sharma, RPG 126, Jodhpur 1978; Cat VI: idem, part 6, ed. 
Ramanand Saraswat, RPG 127, Jodhpur 1979; Cat. VII: 
idem, pcirt 7, ed. M. Vinayasagar £ind D. B. Khsirsagar, RPG 
130, Jodhpur 1979; Cat. VIII: idem, part 8, ed. Thakurdatta 
Joshi ^lnd Dwarkanath Sharma, RPG 131, Jodhpur 1979; Cat. 
IX, idem, part 9, ed. M. Vinayasagar and D. B. Khsirsagar, 
RPG 132, Jodhpur 1979; and Cat. XVI: idem, part 16, 
ed. Omprakash Sharma and Brijesh Kumar Singh, RPG 148, 
Jodhpur 1984. 

RORI (Alwcir): idem, part 21, ed. O. L. Men^lria, V. M. Sharma, 


and M. Vinayasag£ir, RPG 151, Jodhpur 1985. 

RORI (Bikaner): idem, peirt 13, ed. BhooramaJ Yati, RPG 139, 
Jodhpur 1984. 

RORI (Chittorgarh): idem, part 10, ed. D. B. Kshirsagar and 
Sweiroop Narayem Sh 2 uma, RPG 136, Jodhpur 1982; pcirt 19, 
ed. D. B. Kshirsagar, RPG 147, Jodhpm: 1984. 

RORI (Jaipur): idem, p 2 irt 11, ed. M. Vinayasagar and 
Jamimalal Baldwa, RPG 137, Jodhpiu- 1984; and p^lrt 18, ed. 
eidem, RPG 150, Jodhpur 1984. 

RORI (Udaipur): idem, part 12, ed. Brajmoh^ln Jawalia, RPG 
138, Jodhpur 1983; and peirt 22, ed. idem, RPG 152, Jodhpur 
1984. 

Udaipur RVSS: D. Peiliwal, D. Kotheu-i, H. L. Bolia, and S. 
Sahdev, Descriptive Catalogue of Sanskrit Manuscripts in 
R. V. Sahitya Sansthan Research Library, Udaipur, vol. 1, 
Udaipur 1978; vol. 2, Udaipur 1985. 

Varendra: Sachindra Nath Siddhanta, A Descriptive Catalogue 
of Sanskrit Manuscripts in the Varendra Research Museum 
Library, vol. 1, Rajshahi 1979. 

Visvabharatr (Adyar): E. R. Sreekrishna Sarma, Descriptive 
Catalogue of Sanskrit Manuscripts. Volume Thirteen. Visva- 
bhdratt Collection, 2 vols., ALS 103, Madras 1976. (in the 
Adyar Library). 

Vmdavana: A Catalogue of Sanskrit Manuscripts in the Vrind- 
aban Research Institute, p^lrt I, comp. R. D. Maiduly, Vrinda- 
b£m 1976; peirt II, comp. V. Hemmnantachar, Vrindab£m 1978; 
peirt III, comp. V. B. Gosv^lmi, Vrindaban 1981. 

Vmdavana (micro): V. B. Gosvami, A Catalogue of Manuscripts 
Microfilmed by the Vrindaban Research Institute, Vrindaban 
1982. 

VSM (Upadhye): Descriptive Catalogue of Sanskrit Manuscripts. 
Volume III. Upadhye Collection, ed. T. N. Dheirmadhikari, 
Pxme 1985. (in the Vmdika Samsodhema Mandala, Pxme). 

Wien UB: Utz Podzeit, Die indischen Handschriften an der 
Universitdtsbibliothek Wien, Biblos-Schriften 142, Wien 1988. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 









■, ■ ■» ■ il:r-'iii*»* '4 -M !*»■ —i4' I 51^'/ 


.- , . 







5Wi»il^w'^ Tw?A'./5ajW' 


liWKa Z>4i&-:- •%. 


Ti^'H^fAA'ri- VH te>5ps38 TO.V^mapipO'' .a. ■•. 



« t 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


3 


*AGASTYA 

Additional manuscripts of the version of the 
Agastyasamhita (see CESS A3, 11a, and A 4, 11a) 
that contains material relative to the interconnection 
between jyoti§a and santi; note that Anup 2141, 
which was recorded in CESS A 4, 1 la, does not con¬ 
tain part of this Agastyasamhita, but part of the spu¬ 
rious Pancaratra work of that title described in H. D. 
Smith, A Descriptive Bibliography of the Printed 
Texts of the Pahcardtragama, vol. 1, GOS 158, 
Baroda 1975, pp. 4-24: 

GOME Madras D. 14443. Ff. 35-35v. Telugu and 
Nandinagari. Incomplete (gandanaksatrasanti). 
Mysore ORI P.9428/13. Ff. 5-6. Nandinagari. 
Incomplete (gandado§ajananasanti). 


AGASTYA 

Alleged author of a Karmavipdka. Manuscript: 

GOME Madras R.6703(a). Ff. 17-23v. Grantha. 
Incomplete (ends in patala 5). Purchased in a.d. 
1938/39 from Cakravarti Jagannathacaryar of 
Kumbakonam. 

Verse 1 is: 

pura maghavata prstah agastya idam abravit / 
granthah karmavipakakhyah kriyate karunavata // 


AGASTYA 

Alleged author of a Citragastya on silpa. Manu¬ 
script: 

Kerala 5572 (4009 B). 800 granthas. Grantha. 
Incomplete. 


AGASTYA 

Alleged author of a Purusamana. Manuscript: 
Mysore ORI P.7110/1. Ff. 8-11. Telugu. 


AGASTYA 

Alleged author of a Vdstusastra. Manuscript: 

GOME Madras R.3828. Ff. 1-113. Copied in a.d. 
1921/22 from a manuscript belonging to Subrah- 
manya Nambudirippad of Peruttipallamanakkal, 
Vallapula Post, Patambi. Incomplete (adhyayas 
1-5 and 20-32). 


AGASTYA 

Alleged author of a Sakaladhikara = Agastya- 
kalpa = Agastyasdstra. Manuscripts: 

Adyar Cat. 38 D 17. 993pp. 

GOME Madras D. 13046. Ff. 251-255. Telugu. 
Incomplete. 

GOME Madras D. 13047. 24pp. Grantha. Incomplete 
(ayadilaksana). 

lO 6463 (Mackenzie III 190). Ff. 131-131v. Telugu. 

Incomplete. From Colin Mackenzie. 

Mysore ORI P.763/8. Ff. 144-165. Kannada. Incom¬ 
plete (adhyaya 2). 

Mysore ORI P.2986/3. Ff. 179-242. Telugu. Incom¬ 
plete (adhyayas 1-7). 

Mysore ORI P.5108/62. Ff. 184-194. Telugu. Incom¬ 
plete (adhyaya 16). 

Tanjore D. 15417 (BE 11075). 26ff. out of an original 
74ff. Grantha. Incomplete. 

Tanjore D.15418 (BE 11071). Grantha. With a 
Tamil artha. Incomplete. 


^'ACALA DVIVEDIN (fi. 1518) 

Additional manuscripts of his Nirnayadipaka 
(see CESS A 4, lla-12a): 

RORI (Alwar) 3642 = *Alwar 1368. 359ff. Copied 
in Sarn. 1912 = a.d. 1855. With an anukramani- 
ka. 

AS Bengal III.D.ll. 


^ACYUTA (before ca. 1650?) 

Additional manuscripts of his Devakerala (see 
CESS A 1, 35b-36a, and A 4, 12b): 

Mysore (1905) 1229. 167pp. Telugu. No author 
mentioned. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI A.761. Ff. 1-99. Incomplete (bhava- 
phala). 

Mysore ORI B.55/56. Ff. 1-260. Telugu. (gurunadi; 
incomplete). 

Mysore ORI *B.57. Ff. 1-130. Telugu. (sukranadi; 
incomplete). 

Mysore ORI *B.58. Ff. 1-162. Kannada, (sukra¬ 
nadi). 

Mysore ORI *B.60. Ff. 1-257. Telugu. (candranadi). 
Mysore ORI *B.61. Ff. 1-246. Telugu. (candranadi). 
Mysore ORI *B.62 and B.63. Ff. 1-258. Telugu. 
(Keralanadi). 

Mysore ORI B.356. Ff. 1-282. Kannac^a. (gurunagli; 
incomplete). 

Mysore ORI B.1043 and B.1044. Ff. 1-499. Kan¬ 
nada. (sukranadi). 

Mysore ORI B.7372. Ff. 1-252. Grantha and Telugu. 
Incomplete. 

Mysore ORI P.2988/1. Ff. 76-366. Grantha. (sukra¬ 
nadi; incomplete). 

Mysore ORI P.5112. Ff. 1-172. Grantha. (sukra¬ 
nadi; incomplete). 

PrSB 3608 (Berlin or. 6311). 114ff. Grantha. 

*ACYUTA (fl. 1505/1534) 

Additional manuscript of his Bhdsvatlratnamdld 
(see CESS A 1, 36b): 

AS Bengal I.A.59. Bengali. 

■*ACYUTA PI$ARATI (ca. 1550-7 July 1621) 

3. Additional manuscripts of his Uparagakriydkrama 
(see CESS A 1, 37b; A 2, 11a; and A 4, 12b): 

Visvabharati (Adyar) 745(a). 18ff. Grantha. With a 
Malayalam fika. Incomplete (beginning of adh- 
yayas 1 and 2 missing). 

Visvabharati (Adyar) 745(b). 9ff. Grantha. With a 
Malayalam fika on adhyaya 4. 

*ACYUTANANDA JHA (fl. 1939/1958) 

Author also (see CESS A 1, 39a, and A3, 
1 la-1 lb) of a Vastupujdpaddhati, a Grhapravesa- 
paddhati, and a Grdhrddipatanasantipaddhati, pub¬ 
lished together as HSS 153, 6th ed., KasT 1978 (pre¬ 
face dated 1942). 


^AJITADEVA sum (fl. 1570/1641) 

Additional manuscript of his Lokasdrayantra (see 
CESS A 1, 39a): 

Anup 4763. 3ff. The Lokasdrayantra is the second of 
two works in this manuscript. 


ATRI 

Alleged author of an Atrisamhitd which contains 
material on santi. Manuscripts: 

GOME Madras D.17758. Ff. 103-104. Telugu. 

Incomplete (adr§tartavagarbhinisanti). 

Mysore ORI P.9764/36. Ff. 73-74. Telugu. Incom¬ 
plete (pancamari§lasanti). 

Mysore ORI P.9764/37. Ff. 74-75. Telugu. Incom¬ 
plete (pahcamari§tasanti). 

ADHARA PATJANAYAKA 

Orissan author of works on ganita in Oriya. 

1. Ganita, composed in collaboration with Bala- 
bhadra, Lambodara, and others. Manuscripts: 

Bhubaneswar IV ganita 27 (G/45). 43ff. Oriya. Cop¬ 
ied on 13 suklapaksa of Magha in aiika 44 of 
Ramacandra. Incomplete. Formerly property of 
Narayana Mahapatra. From Puri. 

Bhubaneswar IV ganita 15 (G/14) = Bhubaneswar 

2.G/14. 87ff. Oriya. Incomplete. From Khurdha, 
Puri District. 

Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 
From Ranapur, Puri District. 

2. Goplgopdldhkapu^patold. Manuscript: 

Bhubaneswar IV ganita 31 (G/49) = Bhubaneswar 
2.G/49. 44ff. Oriya. From Bhubaneswar. 

3. Part of a Pd(hasamudra. Manuscript: 

Bhubaneswar IV ganita 47 (G/52). 102ff. Oriya. 
Incomplete. From Khurdha, Puri District. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


5 


ANANTA 

Author of a Smtiprayoga. Manuscripts; 

Benares (1953) 7151. 2ff. Incomplete (goprasava- 
santi). 

Benares (1953) 8975. Ff. 1-4. 


ANANTA 

Author of a bhasya on the Sulbasutra of Katya- 
yana. Manuscript: 

RORI (Alwar) 237. 232ff. Copied by Mahadeva in 
Saka 1721 = a.d. 1799. 


*ANANTA PANDITA 

Additional information concerning a manuscript 
of his Kalakrtyaviveka (see CESS A 1, 40a): 

*Jammu 2512. 34ff. Incomplete. 


* ANANTA (fl. 1525) 

Additional manuscripts of his Anantasudharasa- 
sdranl (see CESS A 1, 40b): 

RORI Cat. VII 25471. 4ff. Copied by Premacandaji 
Brahmana at Argalapura on Tuesday 10 sukla- 
pak§a of Phalguna in Sam. 1870 = 1 March 
1814. 

WHMRL j3 802. Ff. 3-5 and 7-10. Incomplete. 


^ANANTA {fl. ca. 1600) 

Additional manuscripts of his Nak^atre^iprayoga 
(see CESS A 1, 40a and 41a; A 2, 11b; A3, 12a; and 
A 4, 13b-14a): 

RORI Cat. IX 28414. llff. Copied by Mahadeva Sar- 
adananda in Sarn. 1782 = a.d. 1725. (Nak^atra- 
sattraprayoga). 

WRI 6688. 26ff. Copied in Saka 1677 = a.d. 1755. 
Wai 2227. 20ff. Copied in Sam. 1821 = a.d. 1764. 
Benares (1953) 3525. Ff. 1-18. Copied in Saka 1693 
= A.D. 1771. (Naksatreuipaddhati of Ananta- 
deva). 

Jodhpur 2411. 38ff. 

Wai 2226. 22ff. 


^'^ANANTA DlK^ITA {fl. ca. 1600/1650) 

Additional manuscripts of his Prayogaratna (see 
CESS A 4, 14a-14b): 

BHU B.3701. 39ff. Incomplete. 

BHU B.3702. 171ff. 

BHU C.1724. 34ff. Incomplete. 

RORI (Alwar) 3776 = *Alwar 1394. 113ff. Copied 
by Gyarasirama. Incomplete (ends in prayascitta- 
prayoga). 

RORI (Udaipur) 3138. 171ff. 

VSM (Upadhye) 11263. 3ff. Incomplete (calarcavi- 
dhi). 


* AN ANT A {fl. ca. 1625/1650) 

Additional manuscripts of his Rdmakalpadruma 
(see CESS A 2, lib; A3, 12a-12b; and A 4, 
14b-15a): 

RORI (Udaipur) 155 (1). 140ff. (danakanda); (2). 
lOlff. (ff. 60-61 missing), (samayakanda); and 
(3). 25ff. (f. 3 missing), (utsargakanda. Incom¬ 
plete (tadagotsargavidhi)). Copied under the 
inspiration of purohita Garibadasa during the 
reign of Maharana Rajasirnha of Mewar 
(1652-1680). 

RORI Cat. VIII 27666. 20ff. Copied in Sam. 1748 = 
A.D. 1691. 

Mysore ORI C.4111/1. Ff. 1-305. Copied on 7 suk- 
lapak^a of Asadha in Sarn. 1854 = ca. 27 Sep¬ 
tember 1797. 

RORI Cat. XVI 34589. 206ff. Copied in Sam. 1854 
= A.D. 1797. Incomplete. 

AS Bengal III.E. 19. 

CP, Kielhorn XIX 223. 308ff. Ascribed to Rama. 

Property of Laksmana Sastri of Sagar. 

IM Calcutta 3076. Incomplete (kundamandapa- 
prasahganirmitasloka with a tika). See NCC, vol. 
4, p. 181. 

Oppert II 5022. Property of the Sahkaracarya- 
svamimatha at Srngeri, Mysore. 

Oppert II 7719. 231pp. Two copies, one in Grantha. 
Incomplete (sraddha). No author mentioned. 
Property of the Maharaja of Pudukofa, Tanjore 
District. 


6 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


MNANTA {fl. ca. 1650?) 

Additional information concerning a manuscript 
of his Samhitadlpaka (see CESS A 1, 41a): 

RORI (Alwar) 2567 = *Alwar 1984. 39ff. Copied in 
Sarn 1912 = a.d. 1855. 

Verse 1 at the beginning is: 

patai§yakalavi§ayagamane sphutaya 
vedamrtaikanilayaya tamoharaya / 
bhuyo ’bhisarnmatagunair vilasan mahimne 
pitre ’maraya ca namah puru§ottamaya // 

The colophon begins: iti sribhal tapurusottamMma- 
japanditanantaviracite. 

ANANTA {fl. 1693) 

The son of Siddhesvara and a resident of 
Pallipattana, Ananta completed a tika, Prabhd, on 
the Kundamdnanda of Govinda (fl. 1691) on Satur¬ 
day 1 kr$napaksa of Nabhas in Saka 1614 = 5 
August 1693. Manuscripts: 

WRI 6661. 72ff. Copied in Saka 1656 = a.d. 1734. 
BORI 770 of 1882/83. 26ff. Copied in Saka 1672 = 
A.D. 1750. 

Baroda 8619. 72ff. Copied in Saka 1673 = a.d. 
1751. 

BORI 101 of 1895/1902 = BORI (Dharma) 313. 
47ff. (f. 12 repeated). Copied by Raghunatha, the 
son of Parasurama Somana, on 13 suklapaksa of 
Karttika in Saka 1674 = ca. 19 November 1752. 
PUL I Dharma 176. Ff. 6-11, 18-31, 34-39, 42-43, 
and 46-125. Copied in Saka 1692 = a.d. 1770. 
Wai 3025. 62ff. Copied in Saka 1703 = a.d. 1781. 
Baroda 8733(b). Ff. 15-58. Copied in Saka 1707 = 
A.D. 1785. 

Wai 3027. 38ff. Copied in Saka 1714 = A.D. 1792. 
Incomplete. 

PUL I Dharma 175. 32ff. Copied in Sam. 1869 = 
A.D. 1812. 

Baroda 2301. 46ff. Copied in Sarn. 1874 = a.d. 
1817. 

VVRI 118. 37ff. Copied in Sarn. 1894 = a.d. 1837. 
RORI (Alwar) 3751 = Alwar 1302. 34ff. Copied in 
Sam. 1909 = a.d. 1852. 

Adyar Cat. 10 E 47. 71 pp. 

Anandasrama 397; and 1948. See NCC, vol. 4, p. 
184. 

AS Bengal III.F.175. 


Baroda 4618. 58ff. 

Baroda 11554. 19ff. (ff. 9-11 missing). Incomplete. 
Benares (1953) 3968. Ff. 1-73. 

Benares (1953) 4047. Ff. 1-37. 

BHU C.3518. 39ff. Incomplete. 

Bombay U 553. 45ff. Incomplete (ends in verse 50). 
CP, Hiralal 919. (Kundamandapa). Property of 
Tukaram Govind Pathak of Yeoda, Amraoti Dis¬ 
trict. 

CP, Hiralal 920. (Kundamandapa). Property of Vasu- 
dev Kale of Mulekhedi, Buldana District. 

CP, Kielhorn XIX 59. 39ff. Property of Gadipanta 
Patalavara of Chanda. 

Dahilak^mi XLI 4. See NCC, vol. 4, p. 184. 

Kerala 3806 (7331 B). 800 granthas. 

Nagpur 424 (889). No ff. given. From Nasik. 

Rajapur 378; and 767. See NCC, vol. 1, p. 169. 

SOI. See NCC. 

VVRI 935. 45ff. 

Wai 3026. 55ff. 

Verse 2 at the beginning is: 

herambasya padarn natva pratyuhavyuhanasakam / 
mudananto vitanute prabhakhyam vivrtirn krti // 

Verse 3 at the end is: 

prapte sakrarasenduvanmitasake ramye ’hgirobde 
ravau 

karkasthe nabhasi dvitiyakadale candre tithau 
bhanuje / 

revatyarn sasabhrty alarn ganitavit <tarn> 
kundamartandajarn 

srisiddhesvarasunur isaniratas tikam ananto vya- 
dhat // 

The colophon begins: iti srimatpallipattananivasy- 
anantadaivajhakaviviracita. 

ANANTA YAJNESVARA DHUPAKARA (fl. 1940) 

Author of a tippani, Tattvadarsinl, on 
Nilakantha’s Prayascittamayukha, published at 
Bombay in 1940. 

ANANTAKR$NA BHATTARAKA 

Author of a tika, Pramanabodhinl, on the Vas- 
tusastra of Visvakarman. Manuscripts: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


7 


GOME Madras R.5555. Ff. l-380v. Copied in 
1931/32 from a manuscript belonging to Tata 
Desikacariyar of Villiambakam, Chingleput Dis¬ 
trict. 

Baroda 13727-13728. Ff. 1-400 and 401-635. 
Tirupati 8606 (6706(a)). Grantha. 

The colophon begins: iti srimadanantakr^na- 
bhat tarakaviracitayarn. 


ANANTADEVA 

Author of a Vrataprakasa. Manuscript: 
Benares (1956) 13097. 73ff. Incomplete. 


^ANANTADEVA (fl. ca. 1625/1675) 

Concerning this author see P. Aithol [A5. 

1980/81]. Parts of his Smrtikaustubha are sometimes 

attributed to Jivadeva {fl. ca. 1700), the son of his 

brother, Apadeva. 

1. Additional manuscripts of his Samskarakaustubha 

(see CESS A 2, 12b, and A 4, 15b-17b): 

RORI (Alwar) 3350. 346ff. Copied in Sarn. 1809 = 
A.D. 1752. 

Benares (1956) 13710. Ff. 1-244 and 1-5. Copied in 
Sarn. 1830 = A.D. 1773. With the Asaucadidhiti 
of Jivadeva and a suci. 

RORI (Jaipur) 4646. 5ff. Copied in Sarn. 1906 = 
A.D. 1849. Incomplete (vinayakasanti). 

Benares (1953) 2389. Ff. 2-143. Copied in Sarn. 
1920 = A.D. 1863. Incomplete. No author men¬ 
tioned. 

AS Bengal III.E.116. Incomplete (grahayajha- 
nirupana). 

AS Bengal III.F.68. Incomplete (brhaspatisanti). 

Benares (1953) 2380. Ff. 30, 36-39, 52-124, 

127-133, 136-201, and 218-264. Incomplete. No 
author mentioned. 

Benares (1953) 2381. Ff. 1-23. Incomplete. No 

author mentioned. 

Benares (1953) 2382. Ff. 1-170 and 173-408. 

Incomplete. 

Benares (1953) 2385. 124ff. Incomplete. No author 
mentioned. 

Benares (1953) 2387. Ff. 2-27. Incomplete. No 

author mentioned. 

Benares (1953) 2624. Ff. 1-290. 

Benares (1953) 9607. 8ff. Incomplete. No author 


mentioned. 

Benares (1956) 11982. Ff. 6-45, 47, and 53-211. 
Incomplete. 

Benares (1956) 12187. Ff. 1-8 and 10-32. Incom¬ 
plete. 

Benares (1956) 13735. Ff. 1-384. 

Benares (1956) 13996. Ff. 215-244. Incomplete. 

BHU B.1888. 33ff. Incomplete. No author men¬ 
tioned. 

BHU B.1891. 126ff. Incomplete. No author men¬ 
tioned. 

BHU B.2867. lOff. Incomplete. 

BHU C.l. 244ff. Incomplete. Ascribed to Jivadeva. 

BHU C.3055. 3ff. Incomplete. 

BISM 58,84 (not 58,85 as in CESS A 4, 16a). 

Jaipur (Khasmohor) 1992. 

Mysore ORI P.692/1. Ff. 16-30. Telugu. Incomplete 
(dattavidhi). 

RORI Cat. II 4538. 14ff. Incomplete (dattaka- 

didhiti). 

RORI Cat. IV 18296. 14ff. No author mentioned. 

RORI (Alwar) 3351. 192ff. 

RORI (Alwar) 3352. 276ff. 

RORI (Jaipur) 4540. 9ff. Incomplete (mulajana- 
nasanti). 

RORI (Jaipur) 5462. 22ff. Incomplete (rajodarsa- 
nasanti). 

VSM (Upadhye) 12195. 78ff. Incomplete. No author 
mentioned. 

VSM (Upadhye) 12196. 234ff. Incomplete (to pin- 
dapitryajha). No author mentioned. 

3. Additional manuscripts of his Rdjadharma- 

kaustubha (see CESS A 4, 17b-18b): 

Benares (1953) 7975. Ff. 1-38. Copied in Saka 1628 
= A.D. 1706. Incomplete (purttadidhiti). 

Benares (1953) 8368. Ff. 1-56. Copied in Sarn. 1857 
= A.D. 1800. Incomplete (rajyabhisekapaddhati). 

BHU B.1780. 2ff. Copied in Sarn. 1858 = A.D. 1801. 
Incomplete (sahksiptacalarcavidhi). 

Baroda 14037. 57ff. Copied in Sarn. 1988 = a.d. 
1931. Incomplete (abhisekadidhiti). 

Alwar 1430. {Rdjdbhiseka of Ananta). 

AS Bengal III.D.30. Incomplete. 

AS Bengal (IM) 371 = IM Calcutta 5857. Ff. 1-18. 
Incomplete (purttadidhiti). 

Benares (1953) 7343. Ff. 1-4. Incomplete (calarcavi- 
dhi). 

Benares (1953) 8034. Ff. 1-14; and 1-15. Incomplete 
(purttadidhiti; incomplete). 

BORI 113 of 1895/1902 = BORI (Dharma) 447. 4ff. 
Copied by Bhaskara, the son of Krsnabhatta 
Paradakara. Incqmplete (calarcavidhi). 


8 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GOME Madras R.2567. 87ff. Purchased from Cirra- 
vuri Sitarama Somayajulugaru of Vizianagram, 
Vizagapatam District, in 1917/18. 

Mysore ORI A. 184. Ff. 1-32. Incomplete (didhiti). 
Rajputana, p. 7. No author mentioned. At Ujjain. 
RORI (Alwar) 3372 = Alwar 1429. 89ff. 

RORI (Udaipur) 231. 67ff. 

Sastri, Not. 1907. 248. 29ff. Incomplete (jalasa- 
yotsarga). Property of Pandita Vamanacarya of 
Bibihati, Benares. 

Varendra 728. Ff. 1-40. Bengali. Incomplete (vyava- 
hara). 

6. Additional manuscripts of his Samvatsaradldhiti 
(see CESS A 2, 12b; A3, 12b; and A 4, 19a): 

Jaipur (Dharma) 671. 238ff. 

Oppert II 7822. 257pp. Grantha. (Samvatsara- 
kaustubha). No author mentioned. Property of 
the Maharaja of Pudukota, Tanjore District. 

RORI (Alwar) 3655. 215ff. Incomplete. 

7. Additional manuscripts of unspecified or unidenti¬ 
fied portions of the Smrtikaustubha (see CESS A 4, 
19a-19b): 

Benares (1956) 13147. 282ff. Incomplete. No author 
mentioned. 

Benares (1956) 13151. Ff. 5-27, 32, and 35-50. 

Incomplete. No author mentioned. 

Benares (1956) 13827. Ff. 1-676; and 1-104. 

Benares (1956) 14007. Ff. 1-234. Incomplete. 

Jammu 2529. 222ff. (ff. 62-71, 88-93, 121-129, 
185-190, and 203-204 missing). Incomplete. 
Jammu 2533. 20ff. Incomplete. 

The Tithidldhiu, Samvatsaradldhiti, and 
Asaucadidhiti, ed. by Vasudeva Panasikara, were 
reprinted at Dilli-Varanasi-Patana-Madrasa in 1986. 

8. Additional information concerning a manuscript 
of his Nirnayabindu (see CESS A 2, 12b; A3, 12b; 
and A 4, 19b): 

Mysore ORI *P.2705/1. 12ff. Telugu. 


AN ANTAP ALA PALLIPALA {fl. ca. 1200) 

The son of Amana and the older brother of Dha- 
napala of the Pallipala family of Anahillapura, 
Anantapala is said by his younger brother to have 
composed a Ganitapaiikd\ Dhanapala states this in 
the Tilokamahjarisdra (ed. by Narayan Manilal 


Kansara as LDS 23, Ahmedabad 1969), which he fin¬ 
ished on Thursday 8 suklapak§a of Karttika in Sam. 
1261 = 9 December 1204. Verses 1 and 3 of the last 
section are: 

anahillapurakhyatah pallipalakulodbhavah / 
jayaty ase^asastrajnah sriman sukavir amanah //!// 
catvaras tanujas tasya jye§thas te§u vise§avit / 
anantapalas cakre yah spa^farn ganitapafikam //3// 

^ANANTABHATTA {fl. 1625/1631) 

Additional manuscripts of his Vidhdnapdrijdta 
(see CESS A 1, 42a, and A 4, 20a-21b): 

RORI Cat. XVI 34980. Ff. 137-452. Copied by 
Rama in Sarn. 1802 = a.d. 1745. Incomplete. 
RORI (Alwar) 3806-3810. 102ff.; 95ff.; 85ff.; 129ff.; 
and 275 ff. Copied in Sarn. 1802 = a.d. 1745. 
With an anukramanika. 

BORI 409 of 1891/95 = BORI (Dharma) 165. 58ff. 
Copied by Mayarama Vyasa in the house of 
Radhakr^na $adelaka in Nirasahghavi in Sarn. 
1821 (read 1831), Saka 1696 = a.d. 1774. 
Incomplete (ahnika). 

RORI (Alwar) 3728 = Alwar 1350. 285ff. Copied in 
Sarn. 1911 = A.D. 1854. (Ddnapdrijdta). 

Alwar 1445; and 1467 (vr§otsargaprayoga). 

AS Bengal I.E.52. Incomplete (stabakas 2-3). 

Benares (1953) 8623. Ff. 1-2 and 4-14. Incomplete 
(bhojanadiprakarana). No author mentioned. 
Benares (1953) 8636. Ff. 1-31. Incomplete (mQla- 
santi). No author mentioned. 

Benares (1953) 8641. Ff. 1-13. Incomplete (bala- 
grahavidhana). No author mentioned. 

Benares (1956) 12370. Ff. 1-2. Incomplete (bala- 
rak§anavidhana). No author mentioned. 

Benares (1956) 12393. Ff. 1-136 and 138-260. 

{Ddnapdrijata\ incomplete). 

Oppert II 4934. No author mentioned. Property of 
the Sahkaracaryasvamimatha at Sriigeri, Mysore. 
RORI (Alwar) 3729. 106ff. (Ddnapdrijdta-, incom¬ 
plete). 

RORI (Udaipur) 5667. 30ff. (ff. 1-2 missing). 
Incomplete (rtusanti; incomplete). 

*ANANTABHA TTOPADHYA VA 

Additional manuscript of his Tithinirnaya (see 
CESS A 1, 42a; A 2, 12b; A3, 13a; and A 4, 21b): 

Jaipur (Khasmohor) 2499. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


9 


*ANANTARAMA DVIVEDIN 

Additional manuscripts of the Erasnasahgraha 
attributed to him (see CESS A 1, 42a): 

AS Bengal 7176 (G 9337). llff. Copied in Sarn. 
1867 = A.D. 1810. 

Oxford CSS I 537 (d. 783 (5)). Ff. 1-11. Copied on 
6 kr§napak§a of Magha in Sarn. 1916 = ca. 12 
February 1860. 

Oxford CSS I 538 (d. 754 (6)). Ff. 1-5. 

Oxford CSS I 539 (d. 773 (2)). Ff. 1-6 and 8-9. 
Incomplete. 

ANANTARAMA SURI 

The son of Niryamamba and Kodanda Suri of the 
Cintalapallivarnsa, Anantarama wrote a tika in San¬ 
skrit and Telugu on the Jatakacandrika of Veii- 
katesa. Manuscript: 

Mysore ORI P.9626/2. Ff. 1-24. Telugu. 

The colophon begins: iti srimacchaiikaraprasada- 
labdhakavitamadhuridhurinacintalapallivarnsapayah- 
paravararakasudhakarasamuddandakodandasQriputra- 
niryamambagarbhasuktimuktayamanasarnskrtandhra- 
bhasapravinanantaramasuriviracita. 

ANANTASAMBHU 

Author of a Dipotsavakalanirnaya. Manuscripts: 

Mysore ORI P.899. Ff. 1-8. Nandinagari. Incom¬ 
plete (krttikadipotsavanirnaya). 

Mysore ORI P.4897/2. Ff. 69-103. Grantha. 

Mysore ORI P.8822/2. Ff. 3-4. Grantha. No author 
mentioned. 


ANIRUDDHA 

Author of a Ganita. Manuscript: 
Bhubaneswar 2.G/110. 


*ANUPA MISRA (fl. 1923/1948) 

This author (see CESS A 2, 17b) also edited and 
wrote a Hindi vivrti on the Manasagari ascribed 
variously to Kalyana R§i {fl. after 1629) or to Mana- 


sagara; the 4th ed. was published at Kasi in 1948. A 
tikakarasahk§iptaparicaya printed at the end and 
dated 29 July 1931 gives additional information 
about the author. His family, belonging to the 
Bharadvajagotra, came from Campa in Darabhatiga, 
Mithila. His grandfather, Somadatta Misra, had two 
sons, Badarinatha and Kedara Misra. The latter had 
three sons: Moti, Janaka, and Anupa. When Anupa 
was nine years old, his father died, and his mother 
took him and his brothers to her brothers’ home in 
Nagavasa. His first guru was Rajavamsi of Barahi; 
later he studied jyotihsastra at Kasi under 
Muralidhara Sarman—that is, Muralidhara Jha (fl. 
1902/1916), who taught at the Kasi Sarnskrta Pafha- 
sala. Anupa received the Ripon Gold Medal, and 
became Professor at the Vinayaka Mehata Sarnskrta 
Vidyalaya at Pratapagadha. His preface to the 4th 
ed. of the Manasagari is dated Government Sanskrit 
College, Banarasa, 1 March 1948. Verses 1, 3-4, 
6c-d, 8a-b, 9c-12, 14, 21-22, 24, and 26-28 of his 
tikakarasahk§iptaparicaya are: 

sardhaikanejanante janakapurad agnikonasthah / 
darabhaiigantas campanama gramah subho yasmin 

//!// 

si§yopasi§yayukto bharadvajavatarnso ’bhut / 
srisomadattamisrah pitamaho mamako dhirah //3// 
tasyatmajah susilo badarinatho ’grajah sriman / 
kedaramisra adyanujah pita me vibhur dhiman HAH 
tasya suto ’vadhalalo motinamna prasiddho yah //6// 
viras tad anu vinito janako nama dvitiyo ’tha / 
tabhyam aharn kani§tho ’nupasamakhyo ’bhavarn 
dinah H9H 

navamitavarsavayaske ’nupanite mayy abhagyatas 
tatah / 

tyaktva vapur vinasvaram atularn lokantararn 
gatavan //lO// 

pitari gate dyarn khinnah saha matrbhratrbhir 
nitah / 

krosantare praticyarn campato ’nuttamarn gramam 

HWH 

sanmatulabhyarn sadayarn nagavasarn tannijavasam / 
katipayavarsani pura tatra ca bahudha sahaivasam 
H\2H 

pathitum ayuhkta pracuracchatraganair avrtan 
nityam / 

srirajavarnsiguruto barahisthac chrimato ’sau mam 

//14// 

protsahitas ca daturn kasikamadhyarn parik^an ca / 
agatya kasikayam abhigayan gauravirn kirttim //21// 
srilasrimuralidharasarmagurunam udaracaritanam / 
alabhe mahamahopadhyayanam asrayarn pracuram 
Him 

uttirnaprathamatvenaharn lebhe visi^tapadakan ca / 


10 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


ripanagavarnaradattam sauvarnam rajaniyamena 
HIAH 

samyogatas tadaiva hi vi. yan. mehatamahodayair 
vihite / 

vidyalaye niyuktas chatran adhyapayan bahusah 

//26// 

kasibhargavapustakamaladhyak§arthito nitaram / 
tikam ativa ramyam etadgranthasya sarvato 
vimalam HllH 

ganitopapattiyuktam kartum vrtto yathadesam / 
adhuna jatah purnas tattrutipurttyai sato yace //28// 

ANNAMACARYA 

Author of a tika in Telugu on the Mayamata of 
Maya. Manuscripts: 

Mysore ORI P.5108/10. Ff. 42-67. Telugu. Incom¬ 
plete (adhyayas 1-3). 

Mysore ORI P.9733/1. Ff. 1-55. Telugu. 


^APARADITYA = APARARKA (fl. ca. 1115/1130) 

Additional manuscripts of his Apararka (see 

CESS A 4, 22a-23a): 

Jaipur (Dharma) 55. 722ff. Copied in Sam. 1797 = 
A.D. 1740. 

Jaipur (Dharma) 56. 805ff. Copied by Hiramani on 
Monday 1 suklapaksa of Pau^a in Sarn. 1797 = 8 
December 1740. 

Poona, Mandlik. Smrti and Dharma 56. No ff. given. 
Copied in Sarn. 1876 = A.D. 1819. (prayascitta). 

GJRI 5427/458. Ff. 1-43. Copied in Sam. 1884 = 
A.D. 1827. (snataka). 

Poona, Mandlik. Smrti and Dharma 57. 87ff. (vyava- 
hara); 58. 51ff. (acara); and 59. No ff. given, 
(dana). Copied in Saka 1795 = A.D. 1873. 

AS Bengal II.A.5. Bengali, (vyavahara). 

Benares (1956) 11911. Ff. 1-8, 8b, 13, 13b-14, 
16-155, 157-295, and 297-325. Incomplete. 

Benares (1956) 12342. 24ff. (dvitiyadhyaya; incom¬ 
plete). 

Benares (1956) 12401. Ff. 4-124 and 131-212. 
(acara; incomplete). Ascribed to Kamalakara. 

Benares (1956) 12408. 362ff. Incomplete. No author 
mentioned. 

Benares (1956) 12489. Ff. 68-79. (vyavahara; incom¬ 
plete). 

Benares (1956) 13677. Ff. 54-165. (vyavahara; 

incomplete). 

BHU C.1066. 123ff. Sarada. Incomplete. 


BHU C.4524. 715ff. (Pararkadharmasastranibandha 
of Adityadeva). 

GJRI 5425/456. Ff. 1-25. (brahmacariprakarana). 

GJRI 5426/457. Ff. 1-16. (vivahaprakarana). 

GJRI 5428/459. Ff. 1-15. (dravyasuddhiprakarana). 

GJRI 5429/460. Ff. 1-8. (bhak§yabhak§yapra- 
karana). 

Jammu. No number given (Dharmasastra 422). 6ff. 

Jodhpur 855(A). 450ff. 

PrSB 671 (Gottingen, Mu I 25(38)). 2ff, Ssrada. 
Incomplete (on 1, 255). 

RORI Cat. VIII 27496. 19ff. (acara). 

RORI Cat. VIII 27497. 163ff.; and 55ff. (vyavahara; 
incomplete). 

RORI (Alwar) 3836. 96ff. (sraddha and rajaniti). 

RORI (Alwar) 3838. 67ff. (acara; incomplete). 

RORI (Alwar) 3885. 175ff.; and [5]6ff. (ff. 16-21 
missing), (acara; incomplete). 

RORI (Alwar) 3886. 104ff. (vyavahara). 

RORI (Alwar) 3887. 141ff. (prayascitta). 

RORI (Udaipur) 3167. 582ff. (ff. 264 and 322 miss¬ 
ing). 

WHMRL B.n.b. Ff. 9-32. Incomplete. 


^APPAYA DIK$ITA 

Additional manuscripts of his Pahcasvaravrtti 
(see CESS A 1, 44a, and A 4, 23a): 

Oxford CSS I 196 (*d. 776(1)). Ff. 1-21. 

RORI (Alwar) 2978. 28ff. 


ABHAYADEVA SURI 

Author of a Jayatihuyanastotra at Thambhana on 
the bank of the Sedhi (see NCC, vol. 7, p. 172), 
Abhayadeva also composed a K^etrasamdsa. Manu¬ 
script: 

BORI 694 of 1892/95. 8ff. Incomplete (uddesaka 1; 
on Jambudvipa). The manuscript also contains 
his Jayatihuyanastotra. 

^'AMARA SADHU 

Additional information on his Vivdhapa(ala with 
its Gujarati tika, Bdldvabodha (see CESS A 1, 45a). 
In the Bikaner and Udaipur manuscripts Amara, 
who is said to be the pupil of Somasundara, is cred¬ 
ited only with the tika, which is claimed to have 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


11 


been composed in Rajasthani; in the Jaipur manu¬ 
script he is given the same teacher, but is named 
Abhayasoma and is said to have written the tika in 
Hindi. Manuscripts: 

RORI (Jaipur) 6698. 30ff. (ff. 1-6 missing). Copied 
at Vaghavasa in Sam. 1808 = a.d. 1751. Incom¬ 
plete. 

RORI (Bikaner) 14721. 23ff. Copied at Navahara in 
Sam. 1828 = a.d. 1771. 

RORI (Udaipur) 4834. Ff. 7-19. Incomplete. 

RORI (Udaipur) 6497. 43ff. 


*AMIRACANDRA 

1. Additional manuscript of his Bhavijhana (see 
CESS A 1, 46a): 

BHU C.303. 30ff. Incomplete. 

3. Additional manuscript of his fika, Amrtadhara, 
on KaUnatha’s Slghrabodha (see CESS A 1, 46a): 

BHU C.3103. 52ff. Incomplete. 

^AMRTANATHA JHA SARM AN (b. 1755) 

Additional manuscripts of his Krtyasdra- 
samuccaya (see CESS A 3, 13b-14a, and A 4, 23b): 

GJRI 5263/294. Ff. 1-76. Maithili. 

GJRI 5264/295. Ff. 1-76. Maithili. 

GJRI 5265/296. Ff. 1-3. Maithili. Incomplete. 

GJRI 5266/297. Ff. 1-80. Maithili. Incomplete. 

GJRI 9439/591. Ff. 1-21. Maithili. Incomplete. 


AMRTALALA {fl. 1848/1879). 

The son of Rahgalala, Amrtalala wrote several 
works on astronomy that survive mainly in copies 
made by himself. 

1. Bhaumddigrahamadhyamasddhanoddharana. 
Manuscript: 

RORI Cat. XVI 37182. 6ff. Copied in Sam. 1905 = 
A.D. 1848. 

2. Sarvagrahanaksatranalikdbandhana. Manuscript: 
RORI Cat. XVI 37184. llff. Copied by Amrtalala in 


Sarn. 1905 = a.d. 1848. 

3. Suryacandranalikdbandhana, composed in Sam. 
(read a.d.) 1856. Manuscript: 

RORI Cat. XVI 37183. 6ff. Copied by Amrtalala. 

4. Siddhdntarahasya or Amrtajyotihsdrakalpalatd in 
21 adhyayas. Manuscripts: 

RORI Cat XVI 37179. 47ff. (f. 46 repeated). Copied 
by Amrtalala in Sarn. 1935 = a.d. 1878. 

RORI Cat. XVI 37178. 3Iff. Copied by Amrtalala in 
Sam. 1936 = a.d. 1879. With a fippana. 

5. Karanakutuhala. Manuscripts: 

RORI Cat. XVI 37180. 15ff. Copied by Amrtalala. 

Incomplete (adhikara 6: suryaparvasadhana). 

RORI Cat. XVI 37181. 17ff. Copied by Amrtalala. 
Incomplete (adhikara 8). 

^AMRTANANDA 

Additional information concerning a manuscript 
of his Amnaca^aka (see CESS A 1, 46a-46b, and 
A3, 14a-14 b): 

Mysore ORI C.2406. Ff. 1-14. Kannada. Copied on 
Wednesday in the krsnapak§a of Caitra in Saka 
1712 = 31 March or 7 April 1790. 

The colophon begins: iti srimanmadhavananda- 
padaravindamandamarandasvadanami j indayamanahr- 
dayenamrtanandena viracite. 

AMBIKACARYA 

Author of a Pahcapak^X. Manuscript: 

Vrndavana 8441. 9ff. Incomplete. 

ARUNADATTA 

Author of a Manusydlayacandrikd on silpasastra. 
Manuscripts: 

Oppert I 2658. 150 pp. Malayalam. Property of the 
Raja of Patihhare Kovilakam, Kolikkotu, Mala¬ 
bar District. 


12 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oppert I 2942. Property of the Raja of Cochin at 
Tiruppunittura, Malabar District. 

Oppert I 6108. Ascribed to Arunadatta. Property of 
the Maharaja of Travancore. 

WRI 3836. 79ff. Malayalam. With a bha§atika. 


*ALAVESVARA 

Further information concerning the manuscript 
of his Jatakakalpavain (see CESS A 1, 47a): 

*AS Bombay 349. Ff. 4-56. Copied by Gadadhara, 
the son of Pandita Kamanatha, the son of Pandita 
NaganMha of the Medapatajhati at Ahimadavada 
on Sunday the amavasi of Pau§a in Sarp. 1543 = 
13 January 1488. 

*ALASINGARA CAR YA 

Additional manuscript of his Jatakaraja (see 
CESS A 1, 47a): 

Visvabharati (Adyar) 331(b). 20ff. Telugu. Incom¬ 
plete (ends in verse 293). 

In this copy the first verse (slightly emended) is: 

srikasyapakulinena sihgararyena dhimata / 
namna jMakarajo ’y^Ti balabodhaya tanyate // 

^ALASINGARARYA 

Additional information concerning the manu¬ 
script of his tika, Karmapradlpika, on the Ltlavau 
(see CESS A 4, 24a): 

Mysore ORI *B.587/2. Ff. 1-95. Kannada. Incom¬ 
plete. 


*ALLADANATHA 

Additional manuscripts of his Nirnayamrta (see 
CESS A 1, 47a; A 2, 13b-14b; A3, 14b-15a; and A 
4, 24a-25a): 

RORI Cat. XVI 35189. 21 Iff. Copied by Narapati in 
Sarn. 1597 = a.D. 1540. Said to be the Nirna¬ 
yamrta of Suri Sena Maharaja with the Kdla- 
nirnayafika of Laddanatha Sudhi. 

RORI Cat. IX 30007. 165ff. (f. 71 repeated). Copied 


by Dhiracandra in Sarn. 1643 = A.D. 1586. 
Ascribed to Suryasena. 

Jaipur (Dharma) 366. 326ff. Copied by Madhava, a 
Brahmana residing in Kasi, in the kr§napak§a of 
Magha in Sam. 1656 = ca. 20 January to 3 Feb¬ 
ruary 1600. Formerly property of Liladhara and 
NMhurama, the sons of JagannMha Tha < kura >. 

Jaipur (Dharma) 84. 234ff. Copied by Bhimasena 
Kayastha on Friday 12 suklapak^a of A^adha in 
Sam. 1657 = 13 June 1600. 

BHU B. 635. 6ff. Copied in Sam. 1676 = A.D. 1619. 
Incomplete. Ascribed to Suryasena. 

RORI Cat. VII 26564. 161ff. (f. 100 missing). Cop¬ 
ied at Toda in Sam. 1699 = A.D. 1642. Incom¬ 
plete. 

RORI (Udaipur) 4347. Ff. 1-191. Copied by Sripati 
Brahmana, the son of Pura, a resident of Khana- 
pura, at Mau on the Rupavatl for Jayadeva in 
Sarn. 1739 = A.D. 1682. Incomplete. Ascribed to 
Suryasena. 

Benares (1956) 13920. Ff. 1-21. Copied in Sam. 
1783 = A.D. 1726. Incomplete (ekadaslnirnaya). 
Ascribed to Suryasena. 

GJRI 5349/380. Ff. 1-210. Copied in Sam. 1817 = 
A.D. 1760. Incomplete (to end of asauca). 
Ascribed to Suryasena. 

RORI (Alwar) 3619 = Alwar 1372. 235ff. Copied in 
Sam. 1844 = A.D. 1787. 

RORI (Alwar) 3618. 372ff. Copied in Sam. 1902 = 
A.D. 1845. With an anukramanika. 

Jaipur (Dharma) 611. 248ff. Copied in Sarn. 1933 = 
A.D. 1876. Incomplete. 

Jaipur (Dharma) 354. 277ff. Copied by Damodara 
Parasvara in Sam. 1945 = a.d. 1888. 

AS Bengal II.A.6. Bengali. 

BHU B.634. 4ff. Incomplete. Ascribed to Suryasena. 

BHU B.2596. 282ff. Incomplete. No author men¬ 
tioned. 

BHU C.25. 93ff. Ascribed to Suryasena. 

BHU C.3869. 186ff. Sarada. Incomplete. No author 
mentioned. 

BM Or. 13300 A. Sarada. 

GJRI 10014/714. F.l. Maithili. Incomplete (vijaya- 
dasaminirnaya). Ascribed to Suryasena. 

Jaipur (Dharma) 82. 364ff. Copied by Madhava 
Bhatfa at Ambavati. 

Jaipur (Dharma) 83. 155ff. 

Oppert II 4686. Property of the Sahkaracaryasvami- 
matha at Srtigeri, Mysore. 

RORI Cat. IV 20970. 75ff. (f. 33 missing). 

RORI Cat. IX 29277. 289ff. (ff. 1-7, 20-21, 47-50, 
55-64, 67-69, 84-89, 142-154, 170-175, 179-184, 
203-207, 209, 233-241, and 284 missing). Incom¬ 
plete. Ascribed to Suryasena. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


13 


RORI Cat. XVI 36212. 12ff. Incomplete. 

RORI Cat. XVI 36578. 99ff. Incomplete. Ascribed to 
Suryasena. 

RORI (Alwar) 3825. 204ff. 

RORI (Jaipur) 9082. 2ff. Incomplete (prado§a- 
nirnaya). No author mentioned. 

Vrndavana 4867. 78ff. Incomplete. 

Vrndavana 7191. 2ff. Incomplete (tithikrtyanirnaya). 
Ascribed to Suryasena. 

ASOKA KUMARA GAUD A {fl. 1979) 

A resident of Varanasi, Asoka wrote a Nava- 
grakarahasya published at Varanasi in 1979. 

*AHOBALABHATTA 

This author (see CESS A 1, 47b) was the son of 
Nrsirnha of the Kausikagotra and a devotee of Viru- 
paksa at Hemakuta on the bank of the Pampa, 
where the noon equinoctial shadow is 3^ digits; cf. 
the Ahobalapanditlya of Gali Nrsirnha Kavi, and 
also Yanamandra Nrsirnha Suri {fl. ca. 1650), the 
son of Ahobala of the Kausikagotra. Additional 
manuscript of his Pahcdhgapaddhati: 

Visvabharati (Adyar) 448(c). llff. Grantha. Incom¬ 
plete. 

Verses 2-3 are: 

laksmirn dadyac chrivirCtpaksadevah 
pampatire hemakute nivistah / 
yasmin sardhatryahgulaksaprabha syad 
yarn ca ksonimadhyalekhadhirudhah // 
srimatkausikagotravaridhividhuh 
srimannrsirnhatmajah 

prajho ’hobalabhattasurir atulo jyotirvidam agra- 
nih / 

srisuryaryabhatadisastranivahavyakhyanasamrajyarat 
pahcahgasya supaddhatirn budhajanaprityai cakara 
sphutam // 

^'ADITYADEVA 


MDITYABHATTA (between 1200 and 1325) 

Additional manuscripts of his Kdlddarsa (see 
CESS A 1, 48a-48b; A 2, 14b-15a; A 3, 15b; and A 
4, 26a): 

*BORI 325 of 1880/81 = BORI (Dharma) 257. 
190ff. Copied at Sthalanagaragrama in the kr§na- 
pak§a of Bhadrapada in Sarn. 1581 = ca. 12-26 
September 1524. 

BHU B.633. 7ff. Copied in Sarn. 1847 = a.d. 1790. 
Incomplete (parvadvayanirnayaprakarana). 

Ascribed to Aditya Suri. 

*BORI 142 of Vishrambag I = BORI (Dharma) 
258. 171ff. 

Jaipur (Dharma) 154. 27ff. With the seal of Rama- 
sirnha. 

Mysore ORI P.2251/6. Ff. 46-69. Telugu. Incom¬ 
plete. 

Mysore ORI P.2531. Ff. 1-114. Telugu. 

Mysore ORI P.3001/1. Ff. 52-136. Grantha. 

Mysore ORI P.5986/3. Ff. 1-56. Nandinagari. 
Incomplete. 

Mysore ORI P.8342. Ff. 1-137. Nandinagari. No 
author mentioned. 

ADIS ARM AN {fl. 1456) 

Additional manuscripts of his Jdtakdmrta (see 
CESS A 1, 49a; A 2, 15a; A 3, 15b; and A 4, 26b): 

Oxford CSS I 253 (*d. 771 (8)). Ff. 1-4. Copied by 
Caturthadeva Lala on Thursday 14 suklapak§a of 
Asvina in Sarn. 1676 = 7 October 1619. With his 
own tika. Incomplete (ayurdaya). 

New Delhi, NM 63/889. 77ff. Copied in Sam. 1887 
= A.D. 1830. With his own t ika. 

RORI Cat. XVI 36754. 38ff. With his own tika. 
Incomplete. 

MA/AVDA SURI {fl. ca. 1225) 

Additional manuscript of his tika on the Ksetra- 
samdsa of Jinabhadra Gani {fl. 609) (see CESS A 1, 
49b, and A 4, 26b): 


Additional manuscript attributing the Narapati- Pattan II 3349. 33ff. (Laghuk^etrasamdsavrtti). 
jayacaryd to him (see CESS A 1, 48a and A 3, 

15a-15b): 


AS Bengal I.A.60. 


14 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


ANANDARAMA (fi. ca. 1730) 

A resident of Kara in the province of Allahabad, 
Anandarama wrote a Dastur al- amal in Persian. See 
C. A. Storey, Persian Literature, vol. 2, part 3, Lon¬ 
don 1977, pp. 371-372. 

ANANDASUNDARl 

The daughter of Tapanacarya and the wife of the 
r§i Varaha, Anandasundari wrote two works in 
Oriya: 

1. DvMasamasMhiphala. Manuscript: 

Bhubaneswar IV 134 (Jy/58b). 13ff. Oriya. From 
Jagatsirnhapur, Cuttack District. 

2. Palakaphalavidhana. Manuscripts: 

Bhubaneswar IV 117 (Jy/58a). 53ff. Oriya. From 
Jagatsirnhapur, Cuttack District. 

Bhubaneswar IV 118 (Jy/108). 19ff. Oriya. Incom¬ 
plete. From Ranapur, Puri District. 

APADEVA 

Author of a Kundakdrikdh. Manuscript: 

Kerala 3792 (10145). 45 granthas. 

APADEVA (fi. 1702) 

1. Additional manuscript of his Grahapi thamald 
(see CESS A 1, 49b-50a; A 3, 15b; and A 4, 27a): 

Benares (1953) 7222. Ff. 1-34. Copied in Sarh. 1943 
= A.D. 1886. With his own vyakhya. 

4. Additional manuscript of his Khe{atarahginl (see 
CESS A 4, 27a-27b): 

VSM (Upadhye) 11747. 5ff. 

*APASTAMBA 

Manuscripts of his Sulbasutra (see CESS A 1, 
50a, and A 3, 15b; see also C. G. Kashikar [A5. 
1985]): 


AS Bengal 535-536 (G.1041) = AS Bengal I 2.945. 
74ff. Copied at KaU on Monday 11 kr§napak§a 
of Margasir§a in Saka 164<3> =4 December 
1721. With the bhasya of Karavindasvamin. The 
mula is incomplete. Formerly property of Daiva- 
para Sadasiva Diksita. 

Bombay U Desai 121. 66ff. Copied in Sam. 1825 = 
A.D. 1758. With the tika of Kapardisvamin. 

Baroda 8214. 36ff. Copied in Saka 1708 = A.D. 
1786. With the fika of Sundararaja. 

VSM 4613. 30ff. Copied by Mayuresvara Abhyahk- 
ara in Saka 1709 = A.D. 1787. With the tika of 
Sundararaja. 

Baroda 8522(a). Ff. 1-11. Copied in Saka 1712 = 
A.D. 1790. 

Benares (1953) 4179. Ff. 1-11. Copied in Sam. 1847 
= A.D. 1790. 

VSM 1049. 75ff. Copied in Saka 1717 = A.D. 1795. 
With the tika of Karavindasvamin. 

VSM 4588. 324ff. Copied in Saka 1759 = A.D. 1837. 
(With the Srautasutra). 

VSM 3373. 61ff. Copied by Govinda Manohara in 
Saka 1767 = a.d. 1845. With the tika of Kara¬ 
vindasvamin. 

VSM 3374. 30ff. Copied by Govinda Manohara in 
Saka 1767 = a.d. 1845. With the tika of Sunda¬ 
raraja. 

VSM 3371. 31ff. Copied by Govinda Manohara in 
Saka 1768 = a.d. 1846. With the tika of 
Kapardisvamin. 

Baroda 529. 66ff. Copied at Janasthana in Saka 1770 
= A.D. 1848. (Srautasutra", the Sulbasutra is 
prasna 24). 

RORI (Alwar) 568. 2Iff. Copied by Ramajivana in 
Sarn. 1911 = a.d. 1854 (Sulvopddhdnapraka- 
rana). 

VSM 1048. 20ff. Copied by Ganesa in Saka 1808 = 
A.D. 1886. With the f ika of Sundararaja. 

VVRI 6808. 335ff. Copied in Sam. 1978 = a.d. 
1921. With the fika of Karavindasvamin. 

AS Bengal 537 (G.2774) = AS Bengal I 2.944. 15ff. 

AS Bengal I 2. 978 = IM Calcutta 2271. Ff. 1-7. 
Incomplete. 

Baroda 6789 (H). Ff. 86-158. Grantha. (paribha§a 
and sulba). 

Baroda 7125. 269ff. (Kalpasutra", the Sulbasutra is 
prasna 28). 

Baroda 7853. 12ff. Telugu. 

Baroda 8564. 14ff. 

Baroda 9804(c). Ff. 41-55. Grantha. With the tika 
of Kapardisvamin. Incomplete. 

Baroda 9908(a). 31ff. Grantha. With the tika of 
Sundararaja. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


15 


Baroda 9908(b). Ff. 32-82. Grantha. With the tika 
of Karavindasvamin. 

Baroda 9991(a). 114ff. {Kalpasutra\ the Sulbasiitra is 
prasna 24). 

Baroda 10145(b). Ff. 135-172. Grantha. With the 
tika of Kapardisvamin. 

Cocanada, Telugu Academy 3308. See NCC, vol. 2, 
p. 131. 

GOME Madras D.1058. Ff. 17-17v. Grantha. Incom¬ 
plete (1, 10-21). 

GOME Madras D. 15403. 69ff. With the fika of 
Sundararaja. Incomplete (pafalas 1-6). 

GOME Madras D. 15656. 47ff. Telugu. With the 
tika of Sundararaja. 

GOME Madras D. 15728. 256ff. With the tikas of 
Kapardisvamin, Karavindasvamin, and Sundara- 
raja. 

GOME Madras D. 16882. 32ff. Grantha. With the 
tika of Sundararaja. 

GOME Madras R.151(a). Ff. 1-11. Grantha. Pur¬ 
chased in 1910/11 from Minak^iyamma} of 
Koduvayar. 

GOME Madras R.911(a). Ff. 1-54. Telugu. With the 
tika of Sundararaja. Purchased in 1913/14 from 
Kumarasvami Sastrin of Pedakallepalli, Kr§na 
District. 

GOME Madras R.5057. llff. Telugu. Purchased in 
1925/26 from Pendyala Veiikata Subrahmanya 
Sastri of Pithapuram. 

IE Calcutta 36. (pafala 6); and 194. See NCC. 

lO 4671 (Burnell 209). 20ff. Grantha. From A. C. 
Burnell. 

lO 4672 (Burnell 507a). 15ff. Grantha. From A. C. 
Burnell. 

Jodhpur 1514. (viharaprasna). See NCC. 

Kerala 1679 (2985 D). 2000 granthas. Grantha. With 
the tika of Karavindasvamin. 

Kerala 1680 (2997 B). 2000 granthas. Grantha. With 
the tika of Karavindasvamin. 

Kerala 1681. (5179). 1900 granthas. With the tika 
of Karavindasvamin. Incomplete. 

Kerala 1683 (2985 C). 950 granthas. Grantha. With 
the tika of Kapardisvamin. 

Kerala 1684 (2997 A). 950 granthas. Grantha. With 
the tika of Kapardisvamin. 

Mysore ORI C. 1366/2. Ff. 1-30. Telugu. 

Mysore ORI C.1367/1. Ff. 1-85. 

Mysore ORI P.2288/6. Ff. 57-64. Telugu. 

Mysore ORI P.2712/1. Ff. 1-7. Nandinagari. 

Mysore ORI P.2885/1. Ff. 139-144. Nandinagari. 

Mysore ORI P. 5711/23. Ff. 41-46. Telugu. 

N-W P VI (1881) Veda 17. 7ff. Property of Gopina- 
tha Dik§ita Atale of Ulvar. 

Oppert II 5357. Property of Haridasasrauti of 


Ammalagrahara, Tanjore District. 

Poona, Mandlik. Sutras 31. 48ff. With the bha§ya of 
Karavindasvamin. 

PUE I Srauta 92. 14ff. 

Rajapur 857. See NCC. 

RORI (Alwar) 566. 125ff. With the tika of Kara¬ 
vindasvamin. 

Tanjore D.1983 = BE 3846(b). Ff. 194-203. 

Tanjore D.2053 = BE 3852. 84ff. With the tika of 
Karavindasvamin. 

Tirupati 668 (3939). Grantha. Incomplete. 
Visvabharati (Adyar) 63(a). 9ff. Telugu. 
Visvabharati (Adyar) 81(b). 4ff. Grantha. 
Visvabharati (Adyar) 362(d). 17ff. Grantha. 
Visvabharati (Adyar) 402(b). 7ff. Telugu. Incom¬ 
plete. 

Visvabharati (Adyar) 412(d). 5ff. Telugu. Incom¬ 
plete (ends with 9, 3). 

VSM 1047. 35ff. With the tika of Sundararaja. 

Incomplete (patalas 1-6). 

VSM 4611. 59ff. With the tika of Sundararaja. 

VSM 4612. 29ff. With the tika of Sundararaja. 

VSM 4614. 42ff. With the tika of Sundararaja. 

VSM 4615. 32ff. With the tika of Kapardisvamin. 
VSM 4616. 41ff. With the tika of Karavindasvamin. 

Formerly property of Ealla Babubhatta. 

WRI 182. 56ff. With the tika of Karavindasvamin. 
WRI 192. 33ff. With the tika of Gopala. 

WRI 3545. 27ff. With the tika of Sundararaja. 
Incomplete. 

WRI 3914. 36ff. Telugu. With the tika of Kara¬ 
vindasvamin. 

WRI 3995. 56ff. With the tika of Karavinda¬ 
svamin. 

WRI 4358. 16ff. 

WRI 4367. 216ff. With the tika of Karavinda¬ 
svamin. Incomplete. 

WRI 6017. 104ff. Tamil. With a vyakhya. 

Wai 1755. 12ff. 

Wai 1756. 8ff. 

Wai 1757. 8ff. 

Wai 1758. lOff. 

Wai 1775. 36ff. With the tika of Sundararaja. 

Wai 1776. 34ff. With the tika of Sundararaja. 

Wai 1777. 36ff. With the tika of Kapardisvamin. 

The Apastambasulbasutra was edited with a 
Marathi translation in R. P. Kulakarni [A5. 1978] 
pp. 143-207, and with an Apastambiyasulba- 
parisi^(a by Satya Prakash and Usha Jyotishmati 
[A5. 1979] pp. 41-105; translated into Japanese by 
Yasuke Ikari in Kagaku no Meicho, vol. 1, ed. M. 
Yano, Tokyo 1980, pp. 373-488; and edited, trans- 


16 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


lated into English, and commented on by S. N. Sen 
and A. K. Bag, The Sulbasutras, New Delhi 1983, pp. 
39-53, 101-119, and 234-263. 

^AMARAJA ifl. ca. 1200) 

Additional manuscript of his Vasanabhasya (see 
CESS A 1, 50a-50b, and A 2, 15a-15b): 

RORI (Udaipur) 1804(2). Ff. 35-43. Copied by 
Gopinatha Jyoti§i, the son of BhQdhara, in Sarn. 
1612 = A.D. 1555. (Khandakhadyakabija of 
Durga; cf. Amaraja’s Vasanabhasya, pp. 22-23). 

ARATA DAS A 

Author of a Ganita. Manuscript: 

Bhubaneswar 2.G/104. 


ARAMA DlKSlTA 

A resident of Koccipura, Arama Dik§ita wrote a 
KeraTiyaparasara in at least 3 sahgrahas. Manuscript: 

Visvabharati (Adyar) 1057(c). lOff. Nandinagari. 

The colophon begins: iti srikeraliyaparasare 
koccipura aramadik^itaviracite. 

ARYAGRAHA 

Alleged author of a Grahagocan Manuscript: 

Kathmandu (1964) 81 (7404). No ff. given. Incom¬ 
plete. 

^'ARYABHATA (b. 476) 

An entire issue of IJHS (12, 2) was devoted to 
the Proceedings of the Symposium on the 1500th 
Birth Anniversary of Aryabhata I Held in New 
Delhi, November 2-4, 1976. This issue includes: R. 
Behari [A5. 1977]; R. Billard [A5. 1977]; G. M. Bon- 
gard Levin [A5. 1977]; S. L. Dhani [A5. 1977]; K. 
Elfering [A5. 1977]; E. G. Forbes [A5. 1977]; R. C. 
Gupta [A5. 1977]; L. C. Jain [A5. 1977a]; M. S. 
Khan [A5. 1977]; S. S. Lishk and S. D. Sharma [A5. 
1977]; R. Mercier [A5. 1977]; W. Petri [A5. 1977]; 


K. V. Sarma [A5. 1977]; M. L. Sharma [A5. 1977a] 
and [A5. 1977b]; K. S. Shukla [A5. 1977b]; A. Volo¬ 
darsky [A5. 1977]; and M. Yano [A5. 1977]. Con¬ 
cerning this author (see CESS A 1, 50b-53b; A 2, 
15b; A 3, 16a; and A 4, 27b) see also G. V. Tagare 
[A5. 1974/76]; K. S. Shukla [A5. 1976]; D. S. Hooda 
[A5. 1979]; M. Yano [A5. 1980]; A. Ahmad [A5. 
1981]; P. Jha [A5. 1982b]; E. M. Bruins [A5. 1983]; 
V. G. Nair [A5. 1983]; S. C. Sarbhai [A5. 1983]; I. 
Bhola [A5. 1984]; J. Bhattacharyya [A5. 1985]; P.-S. 
Filliozat and G. Mazers [A5. 1985]; S. C. Sarbhai 
[A5. 1985]; S. Kale [A5. 1986]; R. C. Gupta [A5. 
1987]; P. Jha [A5. 1988a]; and B. L. van der Waer- 
den [A5. 1988b] and [A5. 1988c]. Additional 

manuscripts of his Aryabhailya: 

*Kerala 1823 (475 A). 7ff. Malayalam. Copied on 
ahargana 1699817 = ca. 20 December 1552. For¬ 
merly property of a Namputiri family of Kutal- 
lur. See Shukla and Sarma ed., p. Ixix. 

Poona, Mandlik. Jyotisha 16. 9ff. Copied in Saka 
1628 = A.D. 1706. {Vrddharyabhatasiddhdnta). 
RORI Cat. IX 28625. 9ff. Copied at Mathura in 
Sam. 1788 = a.d.1731. 

*Kerala 1825 (5131 B). 4ff. Malayalam. Formerly 
property of Vasudevan Namputiri of Marappadi. 
See Shukla and Sarma ed., p. Ixix. 

*Kerala 1827 (13300 A). 7ff. Malayalam. Formerly 
property of Karuvelil Nilakantha PiHai of Kar- 
thikappalli. See Shukla and Sarma ed., p. Ixx. 
*Kerala 1828 (13305 B). 12ff. Malayalam. Formerly 
property of the family of Patinnaretattu 
Pi§aram of Kitahiiur. See Shukla and Sarma ed., 
p. Ixx. 

*Kerala 1835 (501 A). 12ff. Malayalam. Incomplete 
(dasagitika missing). Formerly property of the 
Desamahgalam Variyam. See Shukla and Sarma 
ed., pp. Ixx-lxxi. 

*Kerala 1856 (C.2475 B). If. Malayalam. Incomplete 
(ends with ganitapada 2). Formerly property of 
the Raja of Edappal H. See Shukla and Sarma ed., 
p. Ixxi. 

Mysore (1905) 954. 63pp. Telugu. With a fika. 
Incomplete. 

Mysore ORI A.877/1. Ff. 10-68. Incomplete (gola- 
pada). 

Mysore ORI P.3698/2. If. Grantha. Incomplete (kuf- 
takara). 

Paris BN Sanscrit 1794. 30ff. Grantha. With the 
vyakhyana of Yallaya. Incomplete (kalakriya). 
Tripunithura 542 A. llff. Malayalam. See Shukla 
and Sarma ed., p. Ixx. Perhaps identical with 
*Trippunittura I 1054. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


17 


*Visvabharati (Adyar) 88(c). 12ff. Grantha. Incom¬ 
plete (golapada). 

The Aryabhafiya was translated into Japanese by 
Michio Yano in Kagaku no Meicho, vol. 1, ed. M. 
Yano, Tokyo 1980, pp. 19-138. 

"^ARYABHATA (fl. between ca. 950 and 1100) 

Additional manuscripts of his Mahasiddhmta (see 
CESS A 1, 53b-54a; A 2, 15b-16a; and A 4, 28a): 

RORI Cat. IX 28614. 57ff. Copied by Sukharama at 
Madhupuri in Sarn. 1787 = a.d. 1730. Incom¬ 
plete (goladhyaya). 

Poona, Mandlik. Jyotisha 7. 26ff. Copied in Saka 
1799 = A.D. 1877 from a manuscript belonging 
to Vyavahare Josi of Poona. No author men¬ 
tioned. 

Poona, Mandlik. Jyotisha 11. 27ff. Copied in Saka 
1801 = A.D. 1879 from BORI 5 of 1869/70. 
{Aryabha tasiddhanta). 

*NPS (Sanskrit) 6911. 29ff. Copied in Sarn. 1950 = 
A.D. 1893. This manuscript is complete. 

ASADHARA 

Author of a Grahasantividhdna. Manuscript: 

Nagaur 963. lOff. Copied on 8 suklapak§a of Sra- 
vana in Sarn. 1919 = ca. 19 July 1862. 

^ASADHARA (fl. 1132) 

Additional manuscripts of his Grahajhdna (see 
CESS A 1, 54b; A 2, 16a; and A 4, 28a): 

Oxford (Vyasa) 19. Ff. 1-3 and 7-14. Copied by 
Vallabha Raiila, the son of Vasu<deva> of the 
Kuchagotra on Friday 14 Vaisakha of Saka 1593 
= 12 May 1671. (sarani; incomplete). Formerly 
property of Mulaji Sivasaiikara Vyasa. 

Pattan II 2784. 35ff. Copied at Harnsofa on Tuesday 
14 suklapak§a of Bhadrapada in Sarn. 1729, Saka 
1594 = 27 August 1672. (sarani). 

Oxford (Vyasa) 89. If. (sarani; incomplete). 

RORI (Jaipur) 11032. 4ff. 


^'^ASVALAYANA 

Additional manuscripts of the Asvaldyanagrhya- 
paris'ma (see CESS A 4, 28a-29b): 

Benares (1953) 4202. Ff. 1-14. Copied in Sam. 1869 
= A.D. 1812. 

Mysore ORI C.4220/1 and 2. Copied by Rama on 9 
suklapak§a of A§adha in Saka 1739 = ca. 22 
June 1817. With an anukramanika. 

VSM (Upadhye) 11245. 54ff. Copied by Gahgadhara 
Damodara in Saka 1760 = a.d. 1838. 

VSM (Upadhye) 12213. 43ff. Copied in Saka 1773 
= A.D. 1851. 

Benares (1953) 4144. Ff. 1-34. 

Benares (1953) 4201. Ff. 1-9. Incomplete. 

Bombay U Desai 130. 17ff. 

*BORI 287 of 1884/87 = BORI (Dharma) 143. 36ff. 

(f. 24 repeated). Incomplete (adhyayas 1-3). 
Dharwar 31 (95). 54ff. Copied by Nrhari Devali. 
Dharwar 32 (96). 35ff. Incomplete (adhyayas 1-3). 
Mysore ORI C. 1348. Ff. 1-34. Nandinagari. 

Mysore ORI C.3068/2. Ff. 1-16. 

Mysore ORI P. 5580/2. Ff. 36-100. Nandinagari. 
Mysore ORI P. 5952/4. Ff. 9-51. Nandinagari. 
Mysore ORI P.5952/11. Ff. 108-126. Nandinagari. 
Mysore ORI P.7025/2. Ff. 1-10. Nandinagari. 

Mysore ORI P.8089/4. 8ff. Telugu. 

Mysore ORI P.8841/1. Ff. 1-40. Nandinagari. 

Incomplete (adhyayas 1-2). 

Osmania University 923/b. 37ff. Telugu. 

PrSB 2324 (Hamburg, Palmbl. II 203). 49ff. Gran¬ 
tha. Incomplete (adhyayas 1-3). 

Visvabharati (Adyar) 411(c). 39ff. Grantha. Incom¬ 
plete (ends in adhyaya 4). 

Visvabharati (Adyar) 459(c). 26ff. Grantha. Incom¬ 
plete (ends in 3, 18). 

Wai 10317. 6ff. Incomplete (adbhutasanti). 

Wien UB 286 (I 67117). Ff. 1-9, 15-17. and 21-26. 
Acquired in 1891. 


ICCHAGIRI 

Author of a SvapnMhydya in Hindi. Manuscript: 

Prayaga 2167. 38pp. Copied on Saturday 2 sukla- 
pak§a of A§adha in Sam. 1841 = 19 June 1784. 


18 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


VNDRAVAMADEVA 

Additional manuscript of his Trailokyadipaka 
(see CESS A 1, 55a-55b; A 2, 16a-16b; A 3, 16a; 
and A 4, 30b; see also M. Sastri [A5. 1950]): 

Delhi Jaina (Dharmapura) 305 (a 12 (ka)). 67ff. 
Copied in Sana. 1827 = a.d. 1770. 

I LAB HATT A 

Author of a tippana on the $a(pancasikd of 
Haribhatfa. Manuscript: 

Delhi Jaina (Dharmapura) 242 (Loosed Papers). 5ff. 
Copied in Sarn. 1658 = a.d. 1601. Incomplete. 

ILASU (?) 

Apparent name of the author of a Sakunasdstra 
in Maithili. Manuscript: 

GJRI 8677/902. Ff. 3-4v. Maithili. 

MIR ""IWAD AL-RIDAWI 

In the service of Mirza Muhammad ^Ali Beg 
Kirmani at Lahore, Mir ‘^Iwad wrote a Khazdn u 
bahdr in 4 maqalas, of which the second is on 
astronomy. See C. A. Storey, Persian Literature, vol. 
2, part 3, London 1977, p. 370. 

ISVARA 
See Siva. 


ISVARA YAGA 

A resident of Naradapura in Gurjaradesa, Isvara 
wrote a Kundallkalpa. Manuscript: 

RORI Cat. VII 25409. 20ff. Copied by Ratirama in 
Sam. 1906 = a.d. 1849. 


MSVARADASA (fl. 1663) 

Additional manuscripts of his Muhurtaratna (see 
CESS A 1, 55b-56a, and A 3, 16a): 

RORI Cat. IV 21613. 67ff. Copied by Sobharama in 
Sarn. 1823 = a.d. 1766. 

BHU C.65. 226ff. Sarada. 

BHU C.681. 47ff. Sarada. Incomplete. 

RORI Cat. VI 24909. Ff. 2-24. Incomplete. 

RORI (Alwar) 2918 = *Alwar 1909. 38ff. Incom¬ 
plete (to yogaprakarana). 

RORI (Alwar) 2919 = *Alwar 1909. 131ff. 

UCCHAVANANDA 

Author of a Khadipothi. Manuscript: 

Bhubaneswar 2.G/112. 


*UTTAMAVIJAYA (fl. ca. 1820) 

Additional information concerning the manu¬ 
script of his Pahcavakyi sakundvali (see CESS A 1, 
56b): 

LDI (Gujarati) 3704 (8263) = *LDI (MPC) P/8263. 
5ff. Copied by Yasovijaya Gani, the pupil of 
Uttamavijaya, in Sam. 1881 = a.d. 1824. 

UDAYA SURI 

Author of a Vivdharatna Manuscript: 

RORI Cat. IV 21531. 18ff. Copied in Sam. 1784 = 
A.D. 1727. With a Rajasthani stabaka. 

UDAYANARAYANA SIMM A (fl. 1896/1906) 

A resident of Madhurapura, Viddupura, Jila Mu- 
japhpharapura, Udayanarayana, the youngest son of 
Sivarama Simha, wrote a Hindi bha§anuvada of and 
vivarana on the Suryasiddhdnta. This was published 
[at Meerut] in Sarn. 1960 = a.d. 1903; reprinted at 
Meerut in 1906 (lO 21.C.18); and reprinted at Kala- 
katta in 1986. The prastavana is dated 18 July 1896. 
His translation of the Siddhdntasiromani of Bhaskara 
was published at Bombay in 1905; and his transla¬ 
tion of the Aryabhaiiya at Madhurapura in 1906. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


19 


^UDAYAPRABHA SURI (fl. 1221/1243) 

Additional manuscripts of his Arambhasiddhi (see 
CESS A 1, 57a-58a, and A 4, 30b): 

*Pattan II 2745. 152ff. Copied in Sana. 1655 = a.d. 

1598. With the tika of Hemahamsa. 

*Pattan II 8814. 14ff. Copied in Sana. 1660 = a.d. 
1603. 

*Pattan II 2746. 119ff. Copied in Sana. 1666 = a.d. 

1609. With the tika of Hemaharnsa. 

*Pattan II 2747. 143ff. Copied in Sam. 1709 = a.d. 

1652. With the tika of Hemahamsa. 

*Pattan II 3298. 123ff. Copied in Sarn. 1956 = a.d. 

1899. With the tika of Hemaharnsa. 

*Pattan II 7367. 173ff. Copied in Sana. 1970 = a.d. 

1913. With the tika of Hemahamsa. 

Panjab JB I 209 (Ambala 829). 17Iff. With the tika 
of Hemaharnsa. 

Panjab JB I 210 (Zira 565). 107ff. 

*Pattan II 5098. 5Iff. With the tika of Hemaharnsa. 
*Pattan II 8815(1). 8ff. With an IsAakalacchayana- 
yana. 

*Pattan II 8816. llff. With an avacuri. 

*Pattan II 8817. 18ff. With the tika of Hemahamsa. 
Pattan II 12862. 146ff. With the tika of Hema¬ 
harnsa. 

Pattan II 14078. Ff. 4-10 and 12-17. Incomplete. No 
author mentioned. 

RORI Cat. IV 19414. 103ff. (f. 1 missing). With the 
tika of Hemahamsa. 

RORI Cat. IV 19957. 14ff. Incomplete (to surya- 
karnasadhana). 

RORI (Bikaner) 14691. 14ff. Copied by Jinasila 
Muni, the pupil of Vimaladharma Gani. 

RORI (Bikaner) 15918. 16ff. 

RORI (Chittorgarh) 2000. 8ff. Incomplete. No 
author mentioned. 

RORI (Jaipur) 7341. 5ff. (f. 1 missing). Incomplete. 
RORI (Jaipur) 7975. 3ff. Incomplete. 

The Bhavanagara edition of the Arambhasiddhi 
with the Sudhlsrhgara of Hemaharnsa was pub¬ 
lished in 1916. 

WDAYASAGARA {fl. 1599 or 1619) 

In LDI (Gujarati), p. 28, Udayasagara of the 
Kharataragaccha is said to have composed his 
Balavabodha on Ratnasekhara’s Laghuk^etrasamdsa 
(see CESS A 1, 58a; A 2, 16b; A3. 16b-17a; and A 


4, 31a) at Udayapura in Sarn. 1676 = A.D. 1619 
rather than in Sarn. 1656 = a.d. 1599 as previously 
reported. Additional manuscripts: 

RORI Cat. IV 27182. 99ff. Copied in Sam. 1686 = 
A.D. 1629. 

LDI (Gujarati) 248 (4913) = *LDI 4913. 53ff. Cop¬ 
ied at Serapura in Sarn. 1688 = a.d. 1631. 

LDI (Gujarati) 244 (2643) = *LDI 2643. 39ff. Cop¬ 
ied by Vi^nudasa in Sarn. 1706 = a.d. 1649. 

LDI (Gujarati) 246 (901) = *LDI 901. 56ff. Copied 
at Ambala in Sam. 1826 = a.d. 1769. 

AS Bengal XIII 273 (G.6640 XI). No ff. given. Cop¬ 
ied on 8 Magha in Virasarnvat 2328 = ca. 10 
February 1802. 

LDI (Gujarati) 245 (1813) = *LDI 1813. 36ff. Cop¬ 
ied by Viracanda at Daityaridurga in Sarn. 1883 
= A.D. 1826. 

RORI (Chittorgarh) 3558. 58ff. Copied by 

Hiravijaya, the pupil of Amivijaya, at Udayapura 
in Sarn. 1897 = a.d. 1840. 

AS Bengal XIII 272 (G.6632). 74ff. 

LDI (Gujarati) 247 (3529) = *LDI 3529. 57ff. 

Pattan II 4383. 58ff. 

Additional manuscripts of his Balavabodha on 
Dharmagho^a’s Lokanalikadvatrimsikd (see CESS A 
4, 31a), which he wrote for Ganga, the daughter of 
Dhanaraja: 

LDI (Gujarati) 249 (4255) = *LDI 4255. 3ff. Cop¬ 
ied in Sarn. 1850 = a.d. 1793. 

LDI (Gujarati) 250 (5242) = *LDI 5242. 8ff. 

Pattan II 4554. 14ff. 

Pattan II 12711. 9ff. 


UMESACANDRA PANDEYA 

Author of a Hindi vyakhya, Prakdsa, on the 
Ydjhavalkyasmrti, published in KSS 178, 2 vols., 3rd 
ed., Varanasi 1983. 


R$I 

Author (or title of the author) of a Kutida- 
mandapavidhdna. Manuscript: 

BHU B.302. 3ff. Incomplete. 


20 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RSIPVTRA MUNI JAIN A 

Author of an Utpatalak^anavali in Prakrta; cf. 
the Nimittasastra of R§iputra (see CESS A 2, 17b). 
See also N. SaStri [A5. 1945/46]; N. Jaina [A5. 
1945/46b]; and N. Sastri [A5. 1951]. Manuscript: 

Pattan II 8907 (1). Ff. 1-4. 


*R$IBUDDHA 

Additional manuscripts of his Samskarabhaskara 
(see CESS A 4, 31b): 

BORI 63 of 1895/98 = BORI (Dharma) 185. 12ff. 
Copied by Ramacandra Ganesabhaf Jhabare of 
Kurparagrama on Sunday 5 suklapak§a of Caitra 
in ^aka 1698 = 24 March 1776. Incomplete 
(cudakarana and upanayana). 

*BORI 538 of 1883/84 = BORI (Dharma) 358. 13ff. 

Incomplete (rtusanti and garbhadhana). 

RORI Cat. VI 25000. 16ff. Incomplete. 


*R$ISARMAN (fl. ca. 1225) 

In 25, 3 of his Jhanamahjari (see CESS A 1, 
59a-59b; A 2, 17b; and A 4, 31b) Rsisarman refers 
to Saka 1145 = a.d. 1223. Additional manuscripts: 

Kathmandu (1965) 64 (4036). 19ff. Copied on Satur¬ 
day 5 suklapak§a of Asadha in Sam. 1753 = 25 
July 1696. 

RORI Cat. IV 19974. 31ff. Copied by Rikhabadasa, 
the son of Avacala Gandhi, in Sam. 1770 = a.d. 
1713. Ascribed to Gadadhara. 

RORI (Udaipur) 6220. 44ff. (ff. 1-13 missing). Cop¬ 
ied in Sarn. 1825 = a.d. 1768. Incomplete. 

BHU B.3183. 27ff. 

Jaipur (Khasmohor) 5043. 

Kathmandu (1965) 65 (18). 172ff. Nevari. 

Poleman 4837 (Columbia, Smith Indie. 57). 14ff. 

Incomplete (ends in 27, 10). 

RORI Cat. IV 20484. 12ff. 

RORI Cat. XVI. 37409. 40ff. 

Vrndavana 314. 13ff. 


EKANATHA {fl. ca. 1300) 


Yadava ruler of Devagiri from 1271 till 1311, Eka- 
natha, a resident of KMambinagara, wrote a Svaro- 
daya or Rdjavijaya. Manuscript: 

Jaipur (Khasmohar) 4972. 

The last 2 verses are: 

as id devagirau girisaramanipadaravindadvaya- 
dhyanasaktamanah svarodayasudhapathodhi- 
manthavali / 

horasakunamantrayantraganitaranyaikakan f h i ravo 
holasahur iti k§itisatilake rame dharadhisvare // 
tasyabhut tanayah prabhutavinayo namnaikanathah 
sudhir 

horasastramahodadhih svaravidam uddama- 
cudamanih / 

kadambinagare krtadhivasatih satsangalabhas tatah 
kr§nakhye phanivarnsasambhava xxxxxxxxx// 

^'EKANATHA (fl. 1370) 

Concerning Ekanatha see D. Pingree [A5. 1985] 
160-165. Additional manuscripts of his Karana- 
kutuhalaflkd (see CESS A 1, 60a, and A 2, 18a): 

^Leipzig 969. Ff. 2-7, 9-10, 12-33, and 51-88. Cop¬ 
ied by Ramacandra on Wednesday 11 suklapaksa 
of Bhadrapada in Sarn. 1703, Saka 1568 = 9 Sep¬ 
tember 1646 from a manuscript copied by Visnu- 
dasa of the $andilyagotra on 6 suklapak§a of 
Magha in Saka 14<8>4, a Durmatisarnvatsara 
= ca. 10 January 1562. 

*BORI 386 of 1884/86. Ff. 1-42 and If. Copied by 
Govinda, the son of Jagadisa Pandya, at §imala- 
garnmapura on Friday 3 kr§napak§a of Pau§a in 
Sarn. 1854, Saka 1719 = 5 January 1798. Incom¬ 
plete (adhikaras 1-5). 

RORI Cat. VI 24027. Ff. 2-18. Incomplete (adhika¬ 
ras 1-4). 


KACARA (fl. 1809) 

Author of an Adhikamdsa copal in Gujarati in 
Sam. 1866 = a.d. 1809. Manuscript: 

Pattan II 5936. 4ff. Copied in Sam. 1872 = a.d. 
1815. With a stabaka. 


The son of Holasahur, an astrologer of Rama, the 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


21 


KANTHADASA 

Author of a Sindhusimharacaiitisa. Manuscript: 

Bhubaneswar 2.G/2B = Bhubaneswar IV ganita 62 
(G/2b). 20ff. Oriya. From Puri. 

^SUNRTAVADI KADAMBESVARA (fl. ca. 1525) 

Additional manuscripts of his Jyoti^asatrihitdrnava 
(see CESS A 2, 18a-19a, and A 4, 32a): 

Mysore (1905) 576. 147pp. Grantha. 

Mysore ORI *A.578. Ff. 1-130. Kannada. Incom¬ 
plete. 

Mysore ORI C.2656. Ff. 1-375; and ff. 1-15. Nandi- 
nagari. Incomplete (ends with vahanasuryadhi- 
kara). 

Mysore ORI *P.2294. Ff. 2-9, 11-15, 17-27, and 
29-183. Grantha. Incomplete. 

Mysore ORI *P.2433. Ff. 1-104. Telugu. Incomplete 
(tarahgas 1-13). 

Mysore ORI *P.4229. Ff. 1-152. Telugu. Incom¬ 
plete. 

Mysore ORI *P.4430. Ff. 1-145. Nandinagari. (Jyau- 
ti^arijava of Kadambesvaraprasada). Incomplete 
(bhaga 1). 

Mysore ORI P.10454/1. Ff. 1-58. Nandinagari. 
Incomplete (ends with upagrahayoga). 

KANlRAMA PANDITA 

Author of a sucanaka to the Jayasitnhakalpa- 
druma of Ratnakara {fl. 1714). Manuscript: 

Jaipur (Dharma) 615. 15ff. Copied in Sarn. 1928, 
Saka 1793 = a.d. 1871. 

The colophon begins: iti kaniramapanditakrta. 

^'KAPARDISVAMIN (fl. before 1250) 

Manuscripts of his Kapardibhd^ya (see CESS A 2, 
19b, and A 3, 17b): 

Benares (1953) 4399. Ff. 1-42. Copied in Sam. 1825 
= A.D. 1768. This is Mitra, Not. 657. 42ff. Cop¬ 
ied in Sarn. 1885 (for 1825). Property of Queen’s 
College, Benares. 

Bombay U Desai 121. 66ff. Copied in Sam. 1825 = 
A.D. 1768. 


VSM 3371. 3Iff. Copied by Govinda Manohara in 
Saka 1768 = a.d. 1846. 

AS Bengal I 2. 733 (II.B.39). Ff. 1-55. Copied in 
Sam. 1929 = a.d. 1872. 

GOME Madras R.777. 60ff. Copied in 1912/13 from 
Benares 4399. 

Baroda 9804(c). Ff. 41-55. Grantha. Incomplete. 

Baroda 10145(b). Ff. 135-172. Grantha. 

Benares (1953) 4303. Ff. 1-40. 

Cocanada, Telugu Academy 3308. See NCC, vol. 2, 
p. 131. 

GOME Madras D. 15728. 256ff. 

GOME Madras D. 15969. Ff. 8-49v. Grantha. 

GOME Madras R.151(b). Ff. ll-57v. Grantha. 
Incomplete (ends in pafala 6). Purchased in 
1910/11 from Minak^iyammal of Koduvayur. 

GOME Madras R.3294(d). Ff. 62-88v. Grantha. 
Purchased in 1921/22 from Narasirnha Sastrigal 
of Bhavani, Coimbatore District. 

Gwalior, Matrbhumi Karyalaya 79. See NCC. 

Hultzsch 1.445. 155ff. Telugu. Property of Gotfi- 
mukkula Viraraghava Somayaji of Brahmana- 
kraka. 

Hultzsch 2.752. 120ff. Grantha. With the agni sec¬ 
tion. Property of Suryanarayana Diksita of Tiru- 
vairayu. 

Hultzsch 2.903. lOOff. Grantha. Incomplete. Prop¬ 
erty of Balakr§na Sastri of Tiruvaiyaru. 

lO 4673 (Burnell 42a). Ff. 1, 3-10, and 12-29. 
Grantha. Incomplete. From A. C. Burnell. 

Kerala 1683 (2985 C). 950 granthas. Grantha. 

Kerala 1684 (2997 A). 950 granthas. Grantha. 

Mysore ORI P.2546/1. Ff. 1-23. Telugu. 

Mysore ORI P.2712/2. Ff. 1-16. Telugu. 

PUE I Srauta 93. 61ff. 

PUE I Srauta 94. Ff. 1-4 and 25-40. Incomplete. 

Tanjore D.2055 = BE 3851. 50ff. 

Visvabharati (Adyar) 53(a). 47ff. Grantha. Incom¬ 
plete (beginning of pa tala 1 missing). 

Visvabharati (Adyar) 399(a). 25ff. Telugu. Incom¬ 
plete. 

VSM 4615. 32ff. 

Wai 1777. 36ff. 


'^KAMALAKARA 

Additional manuscript of his Grahasdrini (see 
CESS A 2, 20a, and A 4, 33a): 

Kathmandu (1964) 32 (2933). 42ff. (KamaldkarXya- 
sdranl). Incomplete. 


22 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


^KAMALAKARA (fl. 1658) 

1. Additional manuscripts of his Siddhantatama- 

viveka (see CESS A 2, 21a-22b; A 3, 18a; and A 4, 

33a-33b): 

lO 2785 (252a). extra f. 2. Copied in a.d. 1798. 
Incomplete. From H. T. Colebrooke. 

BORI 38 of 1907/15. Ff. 1-4. Copied for Dinakara 
Jyoti§a on Tuesday 13 kr§napak§a of A§adha in 
Saka 1738 = 23 July 1816. Incomplete (triprasna 
55-127). No author mentioned. 

AS Bengal I.B.15. Bengali. 

BHU B.703. 49ff. Incomplete. No author mentioned. 

BHU B.704. 52ff. Incomplete. No author mentioned. 

GJRI 8426/651. Ff. 1-23. Incomplete. 

GJRI 8736/961. Ff. 1-30. Incomplete. 

Jaipur (Khasmohor) 5301 and 5303 = *Jaipur (II). 
72ff.; and 26ff. 

Oxford CSS I 23 (*d. 805 (3) A). Ff. 66 and 
140-151. Incomplete. 

Oxford CSS I 24 (*d. 805 (3) B). Ff. <2-4, 6-18, 
57>, 58-63, <66>, 67-81, 84-111, 115, and 
< 116>. Incomplete. 

Oxford CSS I 25 (*d. 805 (4)). Ff. < 1 > and 2-9; 
and ff. 10-14. Incomplete. 

RORI Cat. IX 29550. 256ff. (ff. 83-89 and 107 miss¬ 
ing). Incomplete. 

RORI Cat. IX 29551. 14ff. With the tika of Sada- 
siva. Incomplete (madhyama). 

RORI Cat. IX 29552. 43ff. (f. 37 repeated). With the 
tika of Sadasiva. Incomplete (prasna; incom¬ 
plete). 

RORI Cat. IX 29553. 15ff. With the tika of Sa¬ 
dasiva. Incomplete (chaya). 

RORI Cat. IX 29554. 15ff. With the tika of Sa¬ 
dasiva. Incomplete (grahana). 

RORI Cat. IX. 29555. 12ff. With the tika of Sa¬ 
dasiva. Incomplete (prasnottara). 

RORI (Alwar) 2618 = *Alwar 2004. 416ff. 

3. Additional manuscripts of his Sesavasana (see 

CESS A 2, 23a, and A 4, 33b): 

AS Bengal I.A.63. Bengali. (Asesavasana). 

Oxford CSS I 26 (*d. 746 (10)). If. and ff. 1-29. 

4. Additional manuscripts of his Sauravasana (see 

CESS A 2, 23a, and A 4, 33b): 

Jaipur (Khasmohor) 5187 and 5592; one of these is 
^Jaipur (II). 53ff. 


*KAMALAKARA BHATTA (fl. 1612) 

1. Additional manuscripts of his Vratakamalakara 
(see CESS A 4, 34a): 

RORI (Alwar) 3935 = Alwar 1473. 418ff. Copied in 
Sam. 1911 = A.D. 1854. 

Benares (1956) 12975. Ff. 1-50. Incomplete. 

Benares (1956) 13673. Ff. 1-111. Incomplete. (Vra- 
tarka). 

2. Additional manuscripts of his Dmakamalakara 
(see CESS A 4, 34a-34b): 

Kathmandu (1905) III 341. 236ff. Nevari. Copied in 
NS 883 = A.D. 1763. 

Benares (1956) 12982. Ff. 1-3. Copied in Sam. 1880 
= A.D. 1823. Incomplete (danasahksepacandrika). 
RORI (Alwar) 3936 = * Alwar 1349. 296ff. Copied 
in Sarn. 1911 = a.d. 1854. 

Benares (1956) 11984. Ff. 1-202 and 204-290. 
Benares (1956) 12130. Ff. 1-116, 132-162, 165-231, 
231b-263/4, and 265-311; and ff. 1-3. Incom¬ 
plete. 

Benares (1956) 12229. Ff. 90-93. Incomplete. 

Benares (1956) 13546. Ff. 1-157. 

Benares (1956) 13719. Ff. 224-238. Incomplete. 
Benares (1956) 13982. Ff. 1-104 and 106-159. 
Incomplete. 

BHU B.919. 21ff. Incomplete (kartaviryarjuna- 
dipadanaprayoga). 

BHU B.2609. 74ff. Incomplete. 

IIL Oxford 73. llff. Incomplete (kartavirya- 
dipadanapaddhati). Presented by M. Monier Wil¬ 
liams. 

RORI Cat. XVI. 36619. 268ff. 

WHMRL E.ll.aa. Ff. 1-5. Incomplete (tuladana- 
prayoga). 

3. Additional manuscripts of his Karmavipakaratna 
(see CESS A 4, 34b): 

Mysore ORI *C.892. Ff. 1-95 and 1-46. Copied in 
Sam. 1812 = a.d. 1755. 

RORI (Alwar) 3937 = * Alwar 1279. 225ff. Copied 
in Sam. 1911 = A.D. 1854. 

4. Additional manuscripts of his Santikamalakara = 
Sanuratna (see CESS A 2, 23b-24a; A 3, 18b; and A 
4, 34b-36a): 

Jaipur (Dharma) 105. Ff. 1-123 and 125-244. Cop¬ 
ied by Sumeri Rajaputa on Monday 8 kr§na- 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


23 


pak§a of Pau§a in Sam. 1729 = 2 or 30 Decem¬ 
ber 1672. With the seal of Ramasirnha, dated 
Sarn. 1718 = a.d. 1661. 

RORI Cat. IV 19769. 30ff. Copied by Kahnaji Josi 
in Sam. 1787 = a.d. 1730. 

VSM (Upadhye) 12388. 33ff. Copied in Saka 1683 
= A.D. 1761. Incomplete (satacandisahasra- 
candiprayoga). 

VVRI 612. 38ff. Copied in Saka 1706 = a.d. 1784. 
Incomplete (tvaritarudra). 

Benares (1953) 7045. Ff. 1-6. Copied in Sarn. 1857 
= A.D. 1800. Incomplete (kakamaithunasanti). 

Benares (1953) 8980. Ff. 1-27. Copied in Sarn. 1867 
= A.D. 1810. Incomplete (satacaiidividhana). 

BHU C.2391. 75ff. Copied in Sarn. 1882 = A.D. 
1825. Incomplete (satacaridisahasracaiidipra- 
yoga). 

RORI (Alwar) 4047. 195ff. Copied in Sarn. 1882 = 
A.D. 1825. Incomplete (caiidiprayoga). 

RORI (Jaipur) 5537. 36ff. Copied by Bhatambhatta, 
the son of Yadupati, in Sarn. 1900 = a.d. 1843. 
Incomplete (satacaridisahasracaridividhana). 

RORI (Alwar) 3938 = Alwar 1481. 298ff. Copied in 
Sarn. 1911 = A.D. 1854. 

RORI (Jaipur) 5578. 36ff. Copied by Bhatambhatta, 
the son of Yadupati Bhatta, in Sarn. 1920 = a.d. 
1863. Incomplete (sahasracaridlsatacaridyadi- 
prayoga). 

Benares (1953) 7728. Ff. 1-5. Incomplete (nava- 
grahasanti). 

Benares (1953) 8172. Ff. 1-4. Incomplete (mrty- 
uhjayamantravidhi; incomplete). 

Benares (1953) 8726. Ff. 1-8. Incomplete 

(vastusantiprayoga). 

Benares (1953) 8778. Ff. 2-6. Incomplete (vinaya- 
kasanti; incomplete). 

Benares (1953) 8814. Ff. 1-9. Incomplete (vinaya- 
kasanti). No author mentioned. 

Benares (1953) 8845. Ff. 1-33 and 32-36. Incom¬ 
plete. 

Benares (1953) 8982. Ff. 1-97, 97b-134, 157-298, 
298b-307, 312-316, 316b-338, 340-345, 348-478, 
and 478b-489. Incomplete. 

Benares (1953) 9031. Ff. 1-39. Incomplete (santi- 
prayoga). 

Benares (1953) 10154. Ff. 1-25. Incomplete (sata- 
caiidiprayoga). 

Benares (1953) 10523. Ff. 1-22. Incomplete (sata- 
caiic^ isahasracarid i prayoga). 

Benares (1953) 10819. Ff. 1-51 and 53-62. Incom¬ 
plete. 

BHU C.1682. 5ff. Incomplete. No author mentioned. 

BHU C.2560. 18ff. Incomplete (nak^atrasanti). 

BORI 260 of A 1883/84. 23ff. Incomplete (sahasra- 


candyadi). 

*BORI 189 of 1886/92 = BORI (Dharma) 490. 3ff. 
Incomplete (jye^fhasanti). 

Jodhpur 1184. 32ff. Incomplete (satacandyadi- 

paddhati). 

Mysore ORI C.496/7. Ff. 3-6. Kannada. Incomplete 
(Rudravidhana). 

Mysore ORI C.3946. Ff. 1-21. Incomplete (sata- 
caiidisahasracatidividhi). 

Mysore ORI C.4057. Ff. 1-281. Incomplete. 

Mysore ORI P.55/2. Ff. 1-2. Nandinagari. Incom¬ 
plete (Rudrasanti). 

PUL I Dharma 24. 3ff. Incomplete (anavr§fisanti). 

RORI Cat. XVI 35764. 23ff. 

RORI (Jaipur) 5128. 2ff. Incomplete (jye^thana- 
k§atrasanti). 

RORI (Udaipur) 185. 122ff. Incomplete. No author 
mentioned. 

RORI (Udaipur) 4694. Ff. 1-8. Incomplete (santi- 
prayoga). 

VSM (Upadhye) 12387. 28ff. Incomplete (satacandi- 
sahasracandi prayoga). 

VSM (Upadhye) 12546. 3ff. Incomplete (sadgra- 
hasantiprayoga). 

VSM (Upadhye) 12551. If. Incomplete (grahasanti). 

5. Additional manuscripts of his Purtakamalakara 

(see CESS A 4, 36a-37a): 

Benares (1956) 13376. Ff. 1-153. Copied in Sam. 
1707 = A.D. 1650. 

BHU B.1231. 4ff. Copied in Sam. 1760 = a.d. 1703. 
Incomplete (vapikupotsargavidhi). 

*BORI 74 of 1895/98 = BORI (Dharma) 464. 13ff. 
Copied by Nanasukha at Sapadajayapuragrama 
on Wednesday 1 krsnapaksa of Vaisakha in Sarn. 
1807, Saka 1672 = 11 April 1750. Incomplete. 

Benares (1956) 13525. Ff. 1-147. Copied in Sarn. 
1833 = A.D. 1776. 

ABSP 3497. 96ff. Copied on 8 krsnapaksa of Bha- 
drapada in Sarn. 1863 = ca. 5 October 1806. Pre¬ 
sented by Pandita Vindhyesvaran^ha Rajadana 
of Lakhanau. 

VSM (Upadhye) 12300. llff. Copied by Sakharama 
Marathe in Saka 1747 = a.d. 1825. Incomplete 
(prasadapratisthodyapana). Formerly property of 
Purusottama Kanakona. 

RORI (Alwar) 3939 = Alwar 1387. 16ff. Copied in 
Sarn. 1911 = a.d. 1854. 

RORI Cat. XVI 36556. 42ff. Copied by Sivadasa at 
Jodhapura in Sam. 1912 = a.d. 1855. Incomplete 
(sivapratisthavidhi). 

ABSP 5198. Ff. 1-9. Incomplete (setutsargaprayoga). 

AS Bengal ni.F.77. (with an aindrimahasanti). 


24 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


AS Bengal III.F.82. (prasadasivaprati§thavidhi). 

Benares (1953) 7973. Ff. 1-141. 

Benares (1953) 8367. Ff. 1-23. Incomplete (rajabhi- 
§ekaprayoga). 

Benares (1953) 8797. Ff. 1-4. Incomplete 

(vapikQpotsargavidhi). 

Benares (1953) 9936. Ff. 1-107. 

Benares (1953) 10863. Ff. 1-3. Incomplete 

(jirnoddhara). 

Benares (1956) 11891. 135ff. Incomplete. No author 
mentioned. 

Benares (1956) 11893. Ff. 2-5. Incomplete. No 
author mentioned. 

Jaipur (Dharma) 103. 95ff. 

Jaipur (Dharma) 328. 3ff. Incomplete (vapikupa- 
tadagotsargavidhi). 

RORI (Jaipur) 10719. 15ff. Incomplete (jalasa- 
yotsarga). 

Sastri, Not. 1907. 100. 14ff. Incomplete (jalasa- 
yotsarga). Property of Pandita Vamanacarya of 
Benares. 

VSM (Upadhye) 12303. 4ff. Copied by Jathare. 
Incomplete (vapikupotsarga according to the 
Saunakaparisis {a). 

WRI 6754. If. Incomplete (asvatthodyapana- 
prayoga). 

6. Additional manuscripts of his Acarakamalakara = 

Ahnikakamalakara (see CESS A 4, 37a-37b); 

RORI Cat II 5229. 62ff. (ff. 1-3 and 54-55 missing). 
Copied by Kisoradasa, the son of Dvarakadasa, at 
Sagavatakapura in Sarn. 1760 = a.d. 1703. (Acar- 
apradlpa). 

*BORI 70 of A 1879/80 = BORI (Dharma) 157. 
73ff. Copied by Maduskara on 5 kr§napak§a of 
Margasir^a in Saka 1<7>09 = ca. 29 Decem¬ 
ber 1787. 

RORI Cat. XVI 34962. 27ff. Copied in Saka 1711 = 
A.D. 1789. (Ahnikaprdyascitta). Cf. Benares 
13227. 

VVRI 618. 88ff. Copied in Saka 1720 = A.D. 1798. 
(Ahnikaprayoga). 

Osmania University B. 77/5. 68ff. (ff. 1-3 missing). 
Copied in a.d. 1805. (Acdradlpa). Incomplete. 

RORI (Alwar) 3940 = *Alwar 1268. 89ff. Copied in 
Sam. 1911 = A.D. 1854. 

Benares (1956) 12089. Ff. 1-11. (Acdradipa). 

Benares (1956) 12266. Ff. 1-45. (Acdradipa). 

Benares (1956) 13533. Ff. 1-114. (Acdrapradipa). 

Benares (1956) 13621. Ff. 1-21. (Acdradipa). 
Incomplete (bahvrcahnika). 

Mysore ORI C.211. Ff. 1-105. (Acdrapradipa). 

RORI Cat. XVI 34583. 126ff. (Acdrapradipa). 


8. Additional manuscripts of his Prdyascittakama- 
Idkara (see CESS A 4, 37b): 

Benares (1956) 13227. Ff. 1-97. Copied in Sam. 
1716 = A.D. 1659. (ahnikalopaprayascitta). Cf. 
RORI 34962. 

RORI Cat. II 9966. 13ff. Copied by Bhavanirama 
Brahmana at Manamandira in Somesvara on the 
banks of the Gaiiga in Sarn. 1843 = a.d. 1786. 
(ahnikalopaprayascitta). 

RORI (Alwar) 3941 = Alwar 1397. 173ff. Copied in 
Sam. 1910 = a.d. 1853. 

Benares (1956) 13319. Ff. 2, 5-87, and 87b-118. 

(Prdyascittaratna). Incomplete. 

Mysore ORI C.2511/6. Ff. 1-16; and 2ff. Incomplete. 

9. Additional manuscripts of his Siidrakamaldkara 
(see CESS A 4, 37b-38b): 

VSM (Upadhye) 12242. 93ff. Copied in Saka 1627 
= A.D. 1705. 

Benares (1956) 12467. Ff. 1-21, 39-57. 72-80, and 
131-172. Copied in Sam. 1763 = a.d. 1706. 
Incomplete. 

Benares (1956) 13717. Ff. 1-139. Copied in Sam. 
1764 = A.D. 1707. 

Gondal (Karmakanda) 416. 3ff. Copied in Sarn. 1841 
= A.D. 1784. Incomplete (sudrasnanavidhi). 

RORI Cat. VII 25325. 90ff. Copied by Sivarama in 
Sam. 1892 = a.d. 1835. 

RORI Cat. VI 24731. 78ff. Copied in Sam. 1902 = 
A.D. 1845. 

RORI (Alwar) 3942. 171ff. Copied in Sam. 1911 = 
A.D. 1854. 

RORI (Udaipur) 4592. Ff. 1-91. Copied in Sam. 

1913 = A.D. 1856. 

ABSP 4583. 62ff. 

ABSP 4700. 7ff. Copied by Balakr^na, the son of 
Govinda, at Tajanagara on Monday 7 suklapak^a 
of Magha in a Vindhavasu sarnvatsara. Incom¬ 
plete (pauranikaritya santi). 

Adyar Cat. 10 E 48. 88pp. 

Adyar Cat. 19 B 39. 35pp. Grantha. Incomplete. 
Adyar Cat. 35 C 7. 258pp. 

AS Bengal II.A.14. 

Benares (1956) 11894. Ff. 1-3 and 5-26. Incomplete. 
No author mentioned. 

Benares (1956) 12026. Ff. 35-42. Incomplete (sarn- 
skaravarnana). 

Benares (1956) 12280. Ff. 1-24. Incomplete (sudra- 
dharmanirupana). 

Benares (1956) 12566. Ff. 1-2. Incomplete (man- 
tradik^anirnaya). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


25 


Benares (1956) 13353. Ff. 1-113; and ff. 1-2. With 
an anukramanika. 

Benares (1956) 13402. Ff. 1-149. 

Benares (1956) 13406. Ff. 1-170. Maithili. 

Benares (1956) 13670. Ff. 1-45. Incomplete. 

Benares (1956) 13771. Ff. 1-163. 

Benares (1956) 13953. Ff. 1-31. Incomplete. 

BHU B.1279. 82ff. Incomplete. 

Jaipur (Khasmohor) 1650. 

Mysore ORI C.124. Ff. 1-99. 

NFS (Sanskrit) 8896. 78ff. Incomplete. 

RORI (Alwar) 3343. 139ff. 

Udaipur RVSS 1705. 7ff. (ff. 1-64 missing). Incom¬ 
plete. 

Wien UB 54 (I 14377). Ff. 1-98. Bought by A. 
Fuhrer in 1884/85. 

10. Additional manuscripts of his Tlnhakamalakara 

(see CESS A 4, 38b): 

Benares (1956) 11803. Ff. 1-13. Copied in Sarn. 
1811 = A.D. 1754. 

RORI (Alwar) 3943. 35ff. Copied in Sarn. 1911 = 
A.D. 1854. 

Benares (1956) 12272. Ff. 1-47. (Tlrthavidhi). 

Harvard Indie 2457. F. 1. Incomplete. 

11. Additional manuscripts of his Samskarakama- 

lakara (see CESS A 4, 38b-39a): 

BHU B.llll. 35ff. Copied in Sam. 1746 = A.D. 
1689. 

AS Bengal III.E.35; III E 119; III F 30; and III G 50. 
(Dasasamskaraprayoga or Samskdraprayoga). 

Jammu 4583. 20ff. (f. 8 repeated). Incomplete (dar- 
sasraddhaprayoga). 

12. Additional manuscripts of his Nirnayasindhu (see 

CESS A 4, 39a-46a): 

Rajputana, p. 42. Copied in Sarn. 1703 = A.D. 1646. 
At Bikaner. 

RORI (Udaipur) 213 (2). 317ff. Copied at Ratnasi 
in Sarn. 1734 = a.d. 1677. Incomplete (pari- 
ccheda 3). 

RORI Cat. IV 20093. 690ff. Copied by Dipacanda 
Svetambara at Yodhapura on Sunday 7 kr§na- 
pak§a of Bhadrapada in Sarn. 1750, Saka 1616 = 
13 August 1693, during the reign of Sujata 
Khana. 

Jodhpur 878. 701ff. Copied by Guraji Dhana at 
Jodhapura in Sam. 1761 = a.d. 1704. 

Jaipur (Khasmohor) 5566. Copied in Sarn. 1763 = 
A.D. 1706. 


NFS (Sanskrit) 6668. Ff. 1-11. Copied by 
Nilakantha, the son of Visvanatha Bhatfa 
Ramahrde, on Wednesday 11 kr§napak§a of 
Magha in Sarn. 1788 = 12 January 1732. Incom¬ 
plete (vivahaprayoga). 

Udaipur RVSS 1936. 27ff. (ff. 1-414 missing). Cop¬ 
ied in Sarn. 1800 = A.D. 1743. Incomplete. 

Udaipur RVSS 1553. 747ff. (ff. 1-4 missing). Copied 
by Lak§milala Gopala Revasaiikara in Sarn. 1814 
= A.D. 1757. Incomplete. 

RORI (Jaipur) 3451. 3ff. Copied in Sarn. 1818 = 
A.D. 1761. Incomplete (malamasavidhi). 

BHU C.1119. 215ff. Copied in Sain. 1863 = a.d. 
1806. 

RORI Cat. XVI 34392. 423ff. (ff. 165, 233-236, 260, 
and 267 missing). Copied by Motirama in Sarn. 
1865 = A.D. 1808. 

RORI (Jaipur) 3919. 13ff. Copied by Bhagatarama 
Vaisriava at Ramagadha in Sarn. 1869 = a.d. 
1812. Incomplete (sarvadevaliiigarcaprati- 
§thavidhi). 

RORI Cat. XVI 35254. 359ff. Copied in Sarn. 1879 
= A.D. 1822. Incomplete (to pariccheda 3). 

Mysore ORI A.323. Ff. 1-106. Copied on 11 sukla- 
paksa of Magha in Saka 1745 = ca. 10 February 
1824. Incomplete (pariccheda 1). 

Vrndavana 10676. 350ff. (ff. 2, 21-22, 27, and 230 
missing). Copied by Durgadatta on Sunday 4 
krsriapak§a of Karttika in Sarn. 1885 = 23 
November 1828. Incomplete. 

RORI Cat. VII 25363. 556ff. (ff. 1-5 and 289 miss¬ 
ing). Copied by Baladeva, a resident of Abhaneri, 
in Sarn. 1895 = a.d. 1838. 

RORI (Alwar) 3804. 253ff. Copied in Sarn. 1900 = 
A.D. 1843. 

RORI (Alwar) 3805. 586ff. Copied in Sarn. 1924 = 
A.D. 1867. 

Foona, Mandlik Smrti and Dharma 117. No ff. 
given. Copied in Saka 1801 = a.d. 1879. 

Ascribed to Mehendale. 

Mysore ORI C.4079/2. Ff. 1-47; 1-97; and 1-240. 
Copied on 11 suklapaksa of Sravaiia in Saka 
1818 = ca. 19 August 1896. 

Mysore ORI A.326. Ff. 1-112. Copied on 13 April 
1909. Incomplete (pariccheda 3). 

AS Bengal II.A.2. Bengali. 

Benares (1956) 13799. Ff. 11-122. Incomplete (pari¬ 
ccheda 2; incomplete). 

Benares (1956) 13800. Ff. 1-106/7 and 108-303. 

BHU B.638. 53ff. Incomplete. 

BHU C.1427. 27ff. Incomplete. 

BHU S.112. 72ff. Incomplete. 

GJRI 5348/379. Ff. 1-19. Maithili. Incomplete. 


26 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Jaipur (Dharma) 104. Ff. 1-134. Incomplete (varsa- 
prayoga; incomplete). 

Jaipur (Khasmohor) 1993; and 5565. 

Jammu 4583. 20ff. Incomplete (darsasraddhapra- 
yoga). 

Jodhpur 879. 393ff. 

Jodhpur 880. 308ff. Incomplete. 

Jodhpur 881. llff. Incomplete. 

Mysore ORI A.324. Ff. 1-110. Copied on Thursday 
9 kr§napak§a of Jye§tha in a Plavasarnvatsara. 
Incomplete (pariccheda 2). 

Mysore ORI A.325. Ff. 1-150. Incomplete (to Gah- 
gamahatmya). 

Mysore ORI C.4. Ff. 1-33. Telugu. Incomplete (to 
prakirnakaprakarana). 

Mysore ORI C.IOO. Ff. 1-285. 

Mysore ORI C.lOl. Ff. 1-264. Incomplete (pari- 
cchedas 1-2). 

Mysore ORI C.102. Ff. 1-336. Incomplete (to srad- 
dhanirnaya). 

Mysore ORI C.661. Ff. 4-362. Incomplete (to saii- 
krantinirnaya). 

Mysore ORI C.3216. Ff. 1-154. Incomplete (pari- 
cchedas 1-2). 

Mysore ORI C.3217. Ff. 5-49. Incomplete (pari¬ 
ccheda 1). 

Mysore ORI C.3228. Ff. 3 and 5-205. Incomplete. 

Mysore ORI C.3825. 285ff. 

Mysore ORI C.4079/1. Ff. 1-11. (vi^ayanukramani). 

Mysore ORI C.4122. Ff. 1-263. Incomplete (pari¬ 
ccheda 3). 

Mysore ORI P.1784. Ff. 1-220. Nandinagari. Incom¬ 
plete (to yatidharma). 

Mysore ORI P.1803. Ff. 1-270. Nandinagari. 
Incomplete. 

Mysore ORI P.4194/2. Ff. 193-228. Nandinagari. 
Incomplete. 

Mysore ORI P.4555/1. Ff. 1-47. Nandinagari. (Nir- 
nayasindfiusahgrafia). Incomplete. 

Mysore ORI P.5800/1. Ff. 76-184. Telugu. Incom¬ 
plete (to sraddhanirnaya). 

Mysore ORI P.5983/1. Ff. 1-168. Nandinagari. 
Incomplete (to vivahanirnaya). 

Mysore ORI P.6886/1 and 2. Ff. 1-8; and 1-237. 
Telugu. Copied on Sunday amavasya of Asvina in 
a Vikramasamvatsara. Incomplete (pariccheda 3). 
With a vi§ayanukramani. 

Mysore ORI P.7418. Ff. 1-168. Nandinagari. 
Incomplete (pariccheda 2). 

Mysore ORI P.7872/2. Ff. 1-4. Telugu. Incomplete 
(upakarmanirnaya). 

Mysore ORI P.7874. Ff. 1-3. Telugu. Incomplete 
(upakarmanirnaya). 

Mysore ORI P.7877/2. Ff. 5-11. Telugu. Incomplete 


(upakarmanirnaya). 

Mysore ORI P.7917/5. Ff. 1-2. Nandinagari. 

Incomplete (upakarmanirnaya). 

Mysore ORI P.8085/1. Ff. 187-345. Nandinagari. 

Incomplete (pariccheda 3). 

Mysore ORI P.8337. Ff. 1-110. Kannada. Incom¬ 
plete (end of navaratriparayananirnaya). 

Nagpur 1969 (255). 19ff. Incomplete (vivaha- 

prakarana). Ascribed to Nilakanfha. From 
Amraoti. 

NPS (Sanskrit) 8012. Ff. 1-502. Incomplete. 

NPS (Sanskrit) 8315. 5ff. Incomplete. No author 
mentioned. 

NPS (Sanskrit) 9218. Ff. 43-45. Incomplete. No 
author mentioned. 

PrSB 2690 (Berlin or. 6276). Ff. 1-143. Nandi¬ 
nagari. Copied by Veiikafanarayana on Monday 
2 suklapak^a of Asvina in an Isvarasarnvatsara. 
Incomplete (paricchedas 1-2). 

PrSB 3308 (Berlin or. 6282). Ff. < 4-198 >. Nandi¬ 
nagari. Incomplete (paricchedas 1-3). 

RORI (Jaipur) 19083. 2ff. Incomplete (karttikamasa- 
vratodyapana). 

RORI (Udaipur) 182. 416ff. 

RORI (Udaipur) 213. 182ff. Incomplete (pariccheda 

1 ). 

Visvabharati (Adyar) 153. 207ff. Grantha. Incom¬ 
plete (pariccheda 3). 

Visvabharati (Adyar) 469. 44ff. Telugu. Incomplete 
(pariccheda 1). 

Visvabharati (Adyar) 483. 143ff. Nandinagari. 

Incomplete (parts of paricchedas 1-2). 

Vrndavana 10431. 32ff. Incomplete. 

The Nirnayasindhu was published with the fip- 
pani of Narayana Rama Acarya, 5th ed., Mumbai 
1949. 

13. Additional manuscripts of his Grahayajha- 
paddhati (see CESS A 2, 23b): 

*BORI 544 of 1883/84 = BORI (Dharma) 403. 
23ff.; and If. Copied by Divakara Hadikara on 
Sunday 15 suklapak§a of A§adha in Saka 1722 = 
6 July 1800. 

BORI 545 of 1883/84 = BORI (Dharma) 404. 18ff. 
Copied by Haribhatta. 

KAMALESA KUMARA DAVE (fl. 1985/1988) 

The son of Syamalala, the son of Asulala, a 
Srimali Brahmana residing in Jodhapura, the pupil 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


27 


of Sivanarayana Saradara, also a Srimali Brahmana, 
Kamalesa wrote a Jyoti^a aura jlvana in Hindi 
(with ganita sections by Narayana Datta Dave), pub¬ 
lished at Jodhapura in 1985. He also wrote a Jyoti^a 
sabdako^a aura tdntrika bljako^a in Samskrta and 
Hindi that was published at Jodhapura in 1988. The 
final verses of his Jyoti^a aura jlvana are: 

rajasthanapradese ’sminn asti jodhapurarn puram / 
tatra brahmapuri hy asti brahmananam nivasabhuh 

11 VI 

srimali vipravaryo ’sau babhuvatrasulala vai / 
mukundah syamalalas ca tasya putrau babhuvatuh 

HIH 

syamalalasya sunur vai kamaleso vicak§anah / 
guroh prasadato ’kari grantham jyoti§ajivanam 112)11 
candravedakhanetrabde jye^fhamasasite subhe / 
caikadasyarn saner vare likhitarn pustakam maya 

HAH 


KARAMANATHA KARKARE (/?. 1884) 

Author of a bha^afika on a Palllpatana pub¬ 
lished at Kasi in Sarn. 1941 = a.d. 1884 (NFS (San¬ 
skrit) 8364). 

^KARA VINDASVAMIN 

Manuscripts of his Sulbapradlpikd (see CESS A 
2, 24a, and A 3, 19a): 

AS Bengal 535-536 (G.1041) = AS Bengal I 2. 945. 
74ff. Copied at Kasi on Monday 11 kr§napaksa 
of Margasirsa in Saka 164x = 5 January 1719, 4 
December 1721, 30 November 1724, or 27 
November 1727. Formerly property of Sadasiva 
Dik^ita. 

AS Bengal 557 (G.2883) = AS Bengal I 2. 744. Ff. 
1-55. Copied at Kasi on Sunday 11 kr§napak§a 
of Margasirsa in Saka 164x = 23 December 
1722 or 19 December 1725. 

VSM 1049. 75ff. Copied in Saka 1717 = a.d. 1795. 
VSM 3373. 61ff. Copied by Govinda Manohara in 
Saka 1767 = a.d. 1845. 

WRI 6808 335ff. Copied in Sam. 1978 = a.d. 1921. 
Adyar Cat. 8 F 36. 110pp. Incomplete. 

Adyar Cat. 19 K 91. 138pp. Telugu. 

Adyar Cat. 22 A 4. 128pp. Telugu. 

Adyar Cat. 38 F 32. 116pp. Telugu. Incomplete. 

AS Bengal I 2. 730 (III.F.150). Ff. 1-115. 

Baroda 9908(b). Ff. 32-82. Grantha. 

Benares (1953) 4094. Ff. 1-67. Apparently continu¬ 


ous with the following: 

Benares (1953) 4239. Ff. 68-84. 

BISM thi 220. See NCC, vol. 2, p. 131. 

Cocanada, Telugu Academy 3308. See NCC. 

GOME Madras D. 15728. 256ff. 

GOME Madras R.931(c). Ff. 28-80v. Telugu. Pur¬ 
chased in 1913/14 from Jaganmohana Rao of 
Masulipatam. 

GOME Madras R.3924(e). Ff. 88v-139v. Grantha. 
Purchased in 1921/22 from Narasirnha Sastrigal 
of Bhavani, Coimbatore District. 

GOME Madras R.5058. 33ff. Telugu. Incomplete. 
Purchased in 1925/26 from Pendyala Veiikafa 
Subrahmanya Sastri of Pithapuram. 

Hultzsch 2.727. 62ff. Grantha. Property of Maha- 
deva Srauti of Tiruvaiyaru. 

IE Calcutta 36; and 39. See NCC. 

lO 4674 (Burnell 435). lOOff. From A. C. Burnell. 

lO 4675 (Burnell 203). 68ff. Grantha. From A. C. 
Burnell. 

Jammu 4515. Ff. 1-36, 36b-49, and 50-51. 

Kerala 1679 (2985 D). 2000 granthas. Grantha. 

Kerala 1680 (2997 B). 2000 granthas. Grantha. 

Kerala 1681 (5179). 1900 granthas. Incomplete. 

Madurai, Ramesvaram Devasthanam Pathasala 317. 
See NCC. 

Mysore ORI B.15. Ff. 1-37. Kannada. No author 
mentioned. 

Mysore ORI B.178. Ff. 1-146. Telugu. Incomplete 
(patala 4 to the beginning of patala 7). 

Mysore ORI C. 1367/2. Ff. 1-85. 

Mysore ORI P.2281/2. Ff. 1-63. Grantha. 

Mysore ORI P.3163/1. 43ff. Grantha. 

Mysore ORI P.7651. Ff. 1-46. Kannada. No author 
mentioned. 

N-W P VI (1881) Veda 18. 62ff. Property of Gopi- 
natha Dik^ita Atale of Ulvar. 

PE, Buhler I D 36. 66ff. Property of Ramabhatfa 
Agnihotrin of Ahamadabada. 

Poona, Mandlik. Sutras 31. 48ff. 

PUE I Srauta 95. 74ff. 

RORI (Alwar) 566 = Alwar 65 = Alwar (1884) 
Taittiriya 48. 125ff. 

Tanjore D.2053 = BE 3852. 84ff. 

Tanjore D.2054 = JE 216. Ff. 17-18, 21-26, and 
45-66. Incomplete. 

VSM 4616. 41ff. Formerly property of Ealla Babu- 
bhatta. 

WRI 182. 56ff. 

WRI 3914. 39ff. Telugu. 

WRI 3995. 56ff. 

WRI 4367. 216ff. Incomplete. 


28 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*KARKA 

Manuscripts of his Sulbasutrabha^ya (see CESS A 
2, 24a, and A 3, 19a): 

N-W P VII (1882) Veda 6. 14ff. Copied in Sam. 
1631 = A.D. 1574. Property of Pandita Balasastri 
of Benares. 

Benares (1953) 4080. Ff. 5-16. Copied in Sarn. 1659 
= A.D. 1602. Incomplete. 

Anup 778. lOff. Copied in Sam. 1689 = A.D. 1632. 
Formerly property of Manirama Dik§ita (/?. ca. 
1650/1700). 

PUL I App. 52. 12ff. Copied in Sarn. 1733 = a.d. 
1676. 

AS Bengal I 2. 266 (III.D.54). Ff. 1-13. Copied in 
Sam. 1801 = a.d. 1744. 

Benares (1953) 4414. Ff. 1-10. Copied in Sam. 1880 
= A.D. 1823. 

Bombay U Desai 123. 8ff. Copied in Sarn. 1971 = 
A.D. 1914. 

Anup 779. 14ff. 

AS Bengal 969 (G.5042 A) = AS Bengal I 2. 475. 
Ff. 1-63. Udiya. 

AS Bengal 970 (G.5042 B) = AS Bengal I 2. 476. 

24ff. Udiya. Incomplete. 

Baroda 10500. lOff. 

Baroda 13801(b). 9ff. 

Benares (1953) 4158. Ff. 1-17. 
lO 364 (774c). Ff 1-16 and 18-19. From H. T. Cole- 
brooke. 

Jammu 4410. 7ff. 

Jammu 4456. 15ff. 

PL, Buhler I D 149. 7ff. Property of Manisaiikara 
Bhatta of Surata. 

RORI Cat. Ill 10388. llff. Copied by Markandeya 
Dik§ita Drauna, the son of Cintamani Drauna. 
RORI (Alwar) 418 = Alwar 150 = Alwar (1884) 
Yajurveda 100. 21ff. 

VVRI 3550. 12ff. 

VVRI 6198. 12ff. 


KARPURA PANDITA 

Author of a Karpuracakra Manuscript: 
GJRI 10978/1032. F. 1. 


^^KALADHARA SARM AN {fl. 1844) 

Additional manuscripts of his Sisubodha (see 
CESS A 2, 24a-24b, and A 4, 46b): 

GJRI 8683/908. Ff. 1-7. Maithili. 

GJRI 8684/909. Ff. 1-11. Maithili. 


^KALYANA (fl. 1605) 

Additional manuscripts of his Tithikalpadruma 
(see CESS A 2, 24b-25a, and A 4, 47a): 

*AS Bombay 236. 2ff. Copied by Muni Dharmacan- 
dra at Navyanagara on Friday 9 suklapak§a of 
Karttika in Sarn. 1743 = 15 October 1686. 

Oxford (Vyasa) 114. Ff. 1-5. Copied on Tuesday 15 
suklapak§a of Phalguna in Sarn. 1768, Saka 1634 
= 11 March 1712. Formerly property of Mulaji 
Sivasaiikara Vyasa; and of Madhavaji Visvanatha 
Vyasa. 

Oxford (Vyasa) 47. Ff. 1-5. (sarini; incomplete). 
Oxford (Vyasa) 48. Ff. 1-5. (sarini; incomplete). 
Oxford (Vyasa) 49. Ff. 1-4. (sarini; incomplete). 

Formerly property of Mulaji Sivasaiikara Vyasa. 
Oxford (Vyasa) 50. Ff. 1-5. (sarini; incomplete). 

Formerly property of Sakaladeva Saiikara. 

Oxford (Vyasa) 51. Ff. 1-3. (sarini; incomplete). 

Formerly property of Ramacandra Madhavaji. 
Oxford (Vyasa) 52. F. 9. (sarini; incomplete). With 
a Nrpanirnaya. 

Oxford (Vyasa) 53. Ff. 2 and 4. (sarini; incomplete). 

Formerly property of Mulaji Sivasaiikara Vyasa. 
Oxford (Vyasa) 64. F. 1. (sarini; incomplete). 

Oxford (Vyasa) 68. F. 6. Incomplete. Copied by Val- 
labha, the son of Sivasaiikara Vyasa. Formerly 
property of Ramakr^na Vyasa, the son of Siva¬ 
saiikara Vyasa. 

Oxford (Vyasa) 75. Ff. 1 and 3. (sarini; incomplete). 
Oxford (Vyasa) 190. F. 1. Incomplete (ends in verse 
8 ). 


^^KALYANA R^I (fl. after 1629) 

Additional manuscripts of the Mdnasdgari (see 
CESS A 2, 25a-25b; and cf. Manasagara in CESS A 
4, 419a-419b): 


WHMRL N.177. Ff. 2-20, 23-37, 39-130, and 
130b-147. Copied on Wednesday 6 kr§napak§a 
of A§adha in Sam. 1820 = 18 July 1764. The 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


29 


text is similar to that in *Leipzig 1102. Incom¬ 
plete. 

Leipzig 1100. llff. Incomplete (ends in dasaphala). 
WHMRL N.117.A. F. 1. A variant version. Incom¬ 
plete (1, 2-28). 

The first edition by Sitarama Jha was published 
[Kasi 1931], the fourth at Kasi in 1948. 


^KALYANA {fl. 1655) 

Additional manuscripts of his fika in GujarMi 
and Sarnskrta, Balavabodha, on Dharmagho§a’s 
Lokandlikd (see CESS A 4, 47a): 

LDI (Gujarati) 251 (3540) = *LDI 3540. 12ff. Cop¬ 
ied by Muni Premavijaya in Sarn. 1886 = a.d. 
1829. 

Berlin (Jaina) 801 (or. fol. 1921). 7ff. Copied by 
Darsanabdhi at Stambhatirtha. 

LDI (Gujarati) 252 (7054) = *LDI 7054. 14ff. 

Pattan II 12968. lOff. 

The last verse is: 

katukagacche kalyanena krto ’yarn balabodhakah / 
saptadasasate var§e pramite dvadasottare // 

^KALYANAKARA SUKLA 

Additional information concerning a manuscript 
of his Pancapaksl tippana (see CESS A 2, 25b): 

RORI (Alwar) 2854 = *Alwar 1827. 7ff. 


KALYANAJIT 

Author of a Kautuhalavydkhyd. Manuscript: 

Udaipur RVSS 1856. Ff. 1, 38, 66, and 79-80. Cop¬ 
ied in Sarn. 1528 = a.d. 1471. Incomplete. 


KALYANADASA (fl. ca. 1725) 

Author of a Navagrahl in bhasa for Savai Jaya- 
sirnha (1686/1743). Manuscript: 

Jaipur (Khasmohor) 3317. 


^KALYANAVARMAN (fl. ca. 800) 

Additional manuscripts of his Sdravall (see 

CESS A 2, 26a-29a; A 3, 19a; and A 4, 47a-47b): 

PrSB 2953 (Gottingen, Sanscr. Sham 101). Ff. 
69-174. Sarada. Copied by Narayaria Kaula in 
<Laukika> Sarn. 4528 = A.D. 1452. Incomplete. 

RORI (Chittorgarh) 3850. 148ff. (f. 138 repeated). 
Copied by Mahadeva in Sarn. 1546 = a.d. 1489. 

RORI (Udaipur) 5797. Ff. 11-14, 29, 31-44, 46-47, 
58-59, 64, and 67-83. Copied in Sarn. 1710 = 
A.D. 1653. Incomplete. 

RORI Cat. VII 26382. 73ff. Copied by ThakOrasi, 
the pupil of Jasakirti, in Sarn. 1717 = A.D. 1660. 

AS Bengal 7018 (G.7521) III. Ff. 13-18. Copied at 
Makasudavada on 4 kr§riapak§a of Pausa in Sarn. 
1821 = ca. 11 January 1765. Incomplete 

(strijataka; incomplete). 

RORI Cat. IV 18995. 83ff. Copied by Jivaiiarama, 
the son of Ramakisora, at Uniyara in Sarn. 1871 
= A.D. 1814. 

RORI (Chittorgarh) 1545. 87ff. Copied in Sarn. 1907 
= A.D. 1850. 

RORI (Alwar) 2780. 146ff. Copied in Sarn. 1908 = 
A.D. 1851. 

RORI Cat. IV 18793. 68ff. Copied by Balananda and 
Kanhaiyalala at Totika in Sarn. 1911 = a.d. 1854. 

Oxford CSS I 233 (*d. 800 (2)). Ff. lv-2. Copied in 
Sarn. 1919 = a.d. 1862. Incomplete (45, 1-6). 

BHU B.3187. 90ff. Incomplete. 

BM Or. 6613 (2). Sirnhalese. No author mentioned. 

GJRI 8734/959. Ff. 1-6, 8-11, 25, and 28-29. Incom¬ 
plete. 

Jaipur (Khasmohor) 5602 (8). One of the 3 copies in 
*Jaipur (II). 

Mysore (1905) 773. 122pp. 

Mysore (1905) 961. 43pp. Grantha. Incomplete (10 
adhyayas). 

Mysore ORI *P. 1802/6. Ff. 221-225. Telugu. Incom¬ 
plete (adhyayas 1-2). 

Mysore ORI *P.2284. Ff. 1-160. Telugu. Incomplete 
(ends with na§fajataka). 

Mysore ORI *P.3022. Ff. 1-140. Nandinagari. 
Incomplete (adhyayas 1-55). 

Mysore ORI *P.3171. Ff. 1-78. Grantha. 

Mysore ORI P.6953/d. Ff. 1-65. Kannada. Incom¬ 
plete. 

Mysore ORI P.8572. Ff. 1-79; and 1-30. Grantha. 

Mysore ORI P.9392/7. Ff. 144-233. Telugu. 

Oxford CSS I 234 (d. 799 (4)). Ff. 1-2. Incomplete 
(adhyaya 45). 


30 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oxford CSS I 249 (*d. 769 (8)). Ff. 1-4. Incomplete 
(adhyayas 17-19). 

Oxford CSS I 337 (*d. 770). If.; f. 4<8?>; and ff. 

185 and 202-288. Scattered excerpts. 

Pattan II 8838. 35ff. 

Rattan II 8839. 44ff. 

Pattan II 8840. 4ff. Incomplete. 

Pattan II 8841 (1). Ff. 1-10. Incomplete. 

Pattan II 13994. llff. No author mentioned. 

PrSB 2950 (Berlin or. 6322). Ff. 1-152. Grantha. 
PrSB 2951 (Berlin or. 6348). Ff. 1-72. Telugu. And 
ff. 1-14. Nandinagari. Incomplete (adhyayas 
1-49). 

PrSB 2952 (Berlin or. 6319). 89ff. Grantha. Incom¬ 
plete (adhyayas 4-34). 

PrSB 3650 (Berlin or. 6309). 84ff. Telugu. Copied 
by Cellaballarya. 

PrSB 3651 (Berlin or. fol. 1649). 153ff. 

RORI Cat. V 22330. 266ff. 

RORI Cat. VII 26167. 68ff. (ff. 1-2, 28-35, 59-61, 
and 63-64 missing). Incomplete. No author men¬ 
tioned. 

RORI Cat. XVI 35756. 41ff. 

RORI (Alwar) 5435. 18ff. Incomplete. 

RORI (Chittorgarh) 2602. 4ff. Incomplete (garbha- 
bhavaphala). No author mentioned. 

RORI (Jaipur) 5816. 6ff. Incomplete (rajayoga; with 
the rajayogabhahga from Dhundhiraja’s Jata- 
kabharana ). 

Vrndavana 8204. Ff. 14 and 35-44. Incomplete. 

The SaravaU was edited with his own Hindi 
tika, Kantimatl, by Muralidhara Caturveda, Dilli- 
Varanasi-Patana-Madrasa, 1977; reprinted 1981 and 
1986; and edited with an English translation and 
commentary by R. Santhanam, 2 vols.. New Delhi 
1983. 


*KAVARURAMA 

This author (see CESS A 2, 29a) is actually Keva- 
larama Jyotisaraya (ft. ca. 1730/1770). 


*KAVIKANTA SARASVATI (fl. ca. 1200/1225) 

Additional manuscripts of his VisvMarsa (see 
CESS A 4, 47b-48b): 

Vrndavana 486. 16ff. Copied by Narahari in Sarn. 

1660 = A.D. 1603. No author mentioned. 

Benares (1956) 13204. Ff. 4-16. Incomplete (vaidi- 
kanityacaradi). 


Benares (1956) 13275. Ff. 1-8. Incomplete. 

Benares (1956) 13326. Ff. 1 and 4-31. Incomplete 
(prayascittakanda; incomplete). No author men¬ 
tioned. 

Benares (1956) 13412. Ff. 1-5. Incomplete (prayas- 
cittavivarana). 

Benares (1956) 13413. Ff. 1-2. Incomplete. 

Benares (1956) 13432. Ff. 1-3. Incomplete (vyavaha- 
rakanda). 

Benares (1956) 13643. Ff. 5-32. Incomplete. No 
author mentioned. 

Benares (1956) 13651. Ff. 1-79. Incomplete (prayas¬ 
cittakanda). 

Benares (1956) 13777. Ff. 1-16. Incomplete. No 
author mentioned. 

Harvard Indie 2426. F. 5. Incomplete (verses 16-21). 

Jaipur (Dharma) 153. 17ff. Incomplete 

(kasivarnana). With two seals of Ramasirnha 
dated Sam. 1718 = a.d. 1661. 

Vrndavana 8501. 13ff. Copied by Vinayaka. No 
author mentioned. 


KAVICANDRA 

Author of a tika on the Jatakalahkara of Ganesa 
{fl. 1613). Manuscripts: 

Bhubaneswar IV 47 (Jy/73b). 34ff. Oriya. From 
Bhubaneswar. 

Bhubaneswar IV 49 (Jy/86a). 5Iff. Oriya. From Bhu¬ 
baneswar. 

The first verse is: 

harirn harimukharn natva bhaktamandalamadhya- 
gam / 

jatakalahkrtau vyakhya kavicandrena gadyate // 

^KAVICUDAMANI CAKRAVARTIN 

Additional manuscript of his Suryasiddhanta- 
navanlta (see CESS A 2, 29b, and A 3, 19a): 

Vrndavana 5129. 27ff. (Bhasvatl). 

^KAVICUDAMANI (fl. 1628/1643) 

Additional manuscripts of his Jyoli^akalpataru 
(see CESS A 2, 29a-29b; A 3, 19a; and A 4, 49a): 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


31 


RORI Cat. IV 20629. 50ff. Copied in Sam. 1721 = 
A.D. 1664. 

Vrndavana 9658. 107ff. Copied in Sam. 1788 = A.D. 
1731. Incomplete. 

RORI Cat. IV 21444. 78ff. Copied by Balamukunda 
Bhatta in Sam. 1917 = A.D. 1860. 

BHU B.3316. 80ff. Incomplete. 

BHU C.856. 5ff. Incomplete (jyoti§akalpataru- 
nirnaya). 

BHU C.2745. 12ff. Incomplete. 

BHU C.3816. 47ff. Incomplete. 

Dharwar 700 (690). 139ff. Incomplete. 

GJRI 8367/592. Ff. 1-53. Maithili. Incomplete. No 
author mentioned. 

Jammu 59-Ga-l. 48ff. No author mentioned. 

Mysore ORI P.8078/1. Ff. 1-30. Nandinagari. 

RORI Cat. VI 23905. 118ff. (f. 16 repeated; and ff. 
40 and 107-110 missing). Incomplete. No author 
mentioned. 

RORI (Alwar) 2926. 288ff. Incomplete (khanda 1, 
adhyayas 1-30). 

RORI (Alwar) 2927. 190ff. Incomplete (khanda 2; 
ends with misradhyaya). 

RORI (Alwar) 2928. 60ff. Incomplete (kanda 3; ends 
with adhyaya 11 of Laukikaskandha). 

RORI (Alwar) 2929. 20ff. Incomplete (khanda 4; 
prasnadhyaya). 


KAVINDRA KULAKALASA 

Author of a Siddantasdra. Manuscript: 

RORI (Udaipur) 5448. 4ff. Copied by Ramaratna 
Josi of Ajamera in Sarn. 1894 = A.D. 1837. 


^KASYAPA 

Additional manuscripts of his Kdsyapasamhitd 
(see CESS A 2, 30b, and A 4, 49b): 

Kathmandu (1964) 38 (4555). 49ff. 

Mysore ORI P.9942/4. Ff. 29-88. Telugu. Incom¬ 
plete (upanayana, vivaha, and sraddha). 

Mysore ORI P.9942/11. Ff. 154-167. Telugu. Incom¬ 
plete (end of ulkadhyaya). 

RORI Cat XVI 34880. Ff. 3-72. Incomplete. 


^KATYAYANA 

Manuscripts of his Sulbasutra or Sulbaparisis (a 
(see CESS A 2, 30b): 

N-W P VII (1882) Veda 8. 42ff. Copied in Sarn. 
1567 = A.D. 1510. Property of Kr§iia Sastri of 
Bhinda. 

Jammu 4524. 83ff. With a vrtti. Copied in Sarn. 

1600 = A.D. 1543. (Sulbaparisista). 

Jammu 4438. 5ff. Copied in Sarn. 1645 = A.D. 1588. 
(Sulbaparisis fa). 

Jammu 5136. 4ff. With a vrtti. Copied in Sarn. 1686 
= A.D. 1629. (Sulbaparisi^ (a). 

AS Bengal I 2. 682 = IM Calcutta 2553. Ff. 1-6. 

Copied in Sarn. 1705 = A.D. 1648. 

Benares (1953) 4264. Ff. 1-11. Copied in Sarn. 1714 
= A.D. 1657. (Sulbaparisis(a). 

Baroda 12011(e). Ff. 21b-34. Copied in Sarn. 1733 
= A.D. 1676. Incomplete (40 verses). 

Benares (1953) 4127. Ff. 1-10. Copied in Sarn. 1733 
= A.D. 1676. (Sulbaparisis (a). 

AS Bengal I 2. 681 = IM Calcutta 2529. Ff. 1-5. 

Copied in Sarn. 1792 = A.D. 1735. 

Benares (1953) 4039. Ff. 3-4, 6, and 8-9. Copied in 
Sarn. 1800 = A.D. 1743. Incomplete. 

Bombay U 748. 9ff. Copied by Maujirama, the son 
of Rama, on 10 suklapak^a of Magha in Sarn. 
1849 = ca. 21 January 1793. 

RORI (Alwar) 237. 232ff. Copied by Mahadeva in 
Saka 1721 = A.D. 1799. With the bhasya of 
Ananta. 

PL, Buhler I D 150. 9ff. Copied in Sarn. 1885 = 
A.D. 1828. Property of Ramasafikara Sukla of 
Ahamadabada. 

Benares (1953) 4124. Ff. 1-9. Copied in Sarn. 1897 
= A.D. 1840. (SulbapariU^(a). No author men¬ 
tioned. 

RORI (Alwar) 3747. 42ff. Copied in Sarn. 1909 = 
A.D. 1852. With the fika of Mahidhara. 

RORI (Alwar) 308. 150ff. Copied by Krsiiarama in 
Sarn. 1910 = A.D. 1853. With a Sampraddya- 
paddhati(lkd. 

RORI (Alwar) 335. 49ff. Copied by Sivarama in 
Sarn. 1910 = A.D. 1853. With the tlka of Mahi¬ 
dhara. 

RORI (Alwar) 326. 4ff. Copied in Sarn. 1911 = a.d. 
1854. 

RORI (Alwar) 417. Ff. 1-90; and 5ff. Copied in 
Sarn. 1911 = a.d. 1854. With the vrtti of Rama- 
candra. 

RORI (Alwar) 387. 90ff. Copied on Saturday 7 A§a- 
dha in Sarn. 1911 = 21 July 1855. With the 
bha§ya of Gahgadhara. 


32 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bombay U Desai 122. 48ff. Copied in Sam. 1937 = 
A.D. 1880. With the vrtti of Ramacandra. 

AS Bengal I 2. 1325 = IM Calcutta 3488. Ff. 1-28. 
Copied in Sam. 1961 = a.d. 1904. With the 
vivrti of Ramacandra. 

Bombay U Desai 123. 8ff. Copied in Sarn. 1971 = 
A.D. 1914. With the bha^ya of Karka. 

GOME Madras R.2467. Copied in 1917/18 from a 
manuscript obtained through the Sub-Magistrate 
of Kawuru, Yernagudem Taluk, Kr§na District. 
With the tika of Mahidhara. 

RORI Cat. XVI 36559. 60ff. Copied by Sridhara at 
Varanasi in Sarn. 1983 = A.D. 1926. With the 
bha§ya of Gahgadhara. 

Anup 777. 9ff. Formerly property of Anupasirnha 
(fl. 1674/1698). 

AS Bengal 968 (G.6145) = AS Bengal I 2. 474. 6ff. 
AS Bengal 969 (G.5042 A) = AS Bengal I 2. 475. 

Ff. 1-63. Udiya. With the bha§ya of Karka. 

AS Bengal 970 (G.5042 B) = AS Bengal I 2. 476. 
24ff. Udiya. With the bhasya of Karka. Incom¬ 
plete. 

AS Bombay 515. 7ff. Incomplete. From Bhau Daji. 
AS Bombay 516. 43ff. With the tika of Mahidhara. 
From Bhau Daji. 

Baroda 10407. 12ff. With the tika of Mahidhara. 
Incomplete. 

Baroda 10454. 6ff. Incomplete (39 verses). 

Baroda 10569. 4ff. Incomplete (25 verses). 

Baroda 11957. 2ff. (Sulbaparisis {akarika). 

Benares (1953) 4320. Ff. 1-6. 

Benares (1953) 4404. Ff. 1-16. 

Benares (1953) 4425. Ff. 1-9. Incomplete. 

Berlin 252 (Chambers 66a) 7. Ff. 21v-28v. (Sulba- 
parisis(a). 

CP, Hiralal 5880. Property of the Bhonsala Rajas of 
Nagpur. 

lO 363 (1158). lOff. (Sulbaparisisia). From H. T. 
Colebrooke. 

lO 4696 (Aufrecht 26c). Pp. 89-125. Copied from 
lO 1158 by T. Aufrecht. 

Jaipur (Khasmohor) 5941. 

Jammu 4407. 4ff. With a vrtti. (Sulbaparisis ia). 
Incomplete. 

Jammu 5143. 8ff. With a vrtti. (Sulbaparisis (a). 

N-W P VII (1882) Veda 7. 30ff. With the tika of 
Rama. Property of Pandita Narayana Sastri 
Mehakarkara of Benares. 

N-W P VII (1882) Veda 9. 32ff. Property of Ganesa 
Sukla of Benares. 

PL, Buhler I D 148. 6ff. (Sulbaparisisia). Property 
of Setha Bhimasi Manekar of Murpbai. 

RORI Cat. II 4952. 5ff. 

RORI (Alwar) 325. 9ff. 


RORI (Alwar) 418. 2Iff. With the vivarana of 
Karka. 

WRI 3550. 12ff. With the vivarana of Karka. 

The Katyayanasulbasutra was edited by Vidya- 
dhara Sarman with his own vrtti, Sarala, as AG ka 3, 
Kasi Sarn. 1985 = a.d. 1928; with a Marathi trans¬ 
lation in R. P. Kulakariii [A5. 1978] pp. 208-235; 
and by Satya Prakasa and Usha Jyotishmati [A5. 
1979] pp. 107-126; and was edited, translated into 
English, and commented on by S. N. Sen and A. K. 
Bag, The Sulbasutras, New Delhi 1983, pp. 54-57, 
120-125, and 264-271. 


^KATYAYANA 

Additional manuscripts of his Katyayanisanti 

(see CESS A 4, 49b-50a): 

Goiidal (Karmakanda) 326. 5ff. Copied in Sarn. 1879 
= A.D. 1822. (yamalajananasanti and mulasanti). 

Benares (1953) 6971. Ff. 1-7. Copied in Sarn. 1895 
(?) = A.D. 1838 (?). 

RORI (Alwar) 5397. 7ff. Copied in Sarn. 1923 = 
A.D. 1866. 

WHMRL E.ll.k. Ff. 4-14. Copied on Tuesday 11 
Vaisakha in Sarn. 1927 = 10 May 1870. Incom¬ 
plete. 

VVRI 1575. 12ff. Copied in Sarn. 1940 = a.d.1883. 

AS Bengal I 2. 679 = IM Calcutta 6105. Ff. 2, 6-7, 
and 10-13. (Santipaddhati). Incomplete. 

Benares (1953) 6977. Ff. 44-48. (mQlasanti). 

Benares (1953) 9281. Ff. 1-3. (jyesthavidhana). 

Benares (1953) 10979. Ff. 1-15. 

BHU C.2184. 3ff. Incomplete. 

BHU C.3545. 4ff. (grahasthapanavidhi). 

lO 5594 (3599a). If. Incomplete. From A. M. T. 
Jackson. 

Mysore ORI P.604/24. Ff. 28-29. Grantha. (a^tagra- 
hayogasanti). 

Mysore ORI P.604/76. Ff. 103-104. Grantha. (yama¬ 
lajananasanti). 

Mysore ORI P.2239/80. F. 103. Telugu. (grahayoga- 
santi). 

Mysore ORI P.4396/52. Ff. 1-4. Grantha. (pratha- 
martavasanti). 

Mysore ORI P.9254/196. F. 168. Nandinagari. (ya¬ 
malajananasanti). 

Mysore ORI P.9951/90. Ff. 108-109. Nandinagari. 
(yamalajananasanti). 

Mysore ORI P.9965/71. Ff. 70-71. Nandinagari. 
(yamalajananasanti). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


33 


Mysore ORI P.9965/76. Ff. 73-80. Nandinagari. 
(mulasle§ajananasanti). 

Mysore ORI P.10041/60. Ff. 96-97. Telugu. (graha- 
yogasanti). 

NPS (Sanskrit) 2434/2. 1^ ff. (grahasthapanavidhi). 
RORI Cat. Ill 15608 (5). 4ff. (mulasantiprayoga 
from the Katyayaniyaparis'ma). 

WHMRL a 1292. Ff. 3-8. Incomplete. 

KAMADATTA 

The son of Gaiigaprasada Dviveda, Kamadatta 
wrote a Karmadlpika. Manuscript: 

RORI (Udaipur) 6871. Ff. 1-45. Copied by Sivapra- 
tapa in Sam. 1926 = a.d. 1869. (The author’s 
name is written Kamadadatta in the Catalogue). 

^KAMADEVA 

Additional manuscripts of his Budhabhusana (see 
CESS A 2, 31a): 

Mysore (1905) 755. 24pp. Telugu. 

Mysore ORI B.578. Ff. 1-24. Kannada. 

Mysore ORI P.2559/3. Ff. 27-41. Telugu. 

The last verse is: 

iti laghiyasi kamayasurina 
viracite rucire budhabhusane / 
sasivi§anasamunnatisadhanarn 
prakaranam dasamad upariritam // 

The colophon begins: iti srikamadevacaryaviracitarn. 
^'KAMADEVA d1k$ITA 

Additional manuscripts of his Mulasanti (see 
CESS A 4, 50a): 

Benares (1953) 8280. Ff. 1-8. Copied in Sam. 1784 
= A.D. 1727. (Midasdnnpaddhati). 

Poleman 3141 (Harvard 1493). 7ff. Copied in Sarn. 
1798 = A.D. 1741. 

Benares (1953) 8273. Ff. 1-13. Copied in Sarn. 1922 
= A.D. 1865. 

He also wrote a commentary on this. Manu¬ 
scripts: 


Benares (1953) 8258. Ff. 1-19. Copied in Sam. 1842 
= A.D. 1785. (Mulasantivyakhydna). Incomplete. 
Benares (1953) 10006. Ff. 1-26. Copied in Sarn. 
1842 = A.D. 1785. (Mulasanukandikabhd^ya). 

^VELLALA KAMADEVACARYA 

Additional manuscripts of his Kavtndra- 
kanfhabharana (see CESS A 2, 31a): 

Mysore (1905) 755. 18pp. (Kavlndrakarnabharana 
in 4 parikarmas). 

Mysore ORI *B.582/2. Ff. 6-15. Kannada. (Lllava- 
titantraganita or Kavindrakan(habharana). 

The colophon begins: iti srimadvellalakama- 
devacaryaviracite. 

KAMAK^I 

Author of a Jatakakalanidhi. Manuscripts: 

Mysore ORI P.8816/1. Ff. 1-83. Nandinagari. 
Copied on Monday 10 suklapak§a of Margasir§a 
in l^aka 1676 = 25 November 1754. 

Mysore ORI C.4686/51. Ff. 1-14. Telugu. Incom¬ 
plete. 

At the end are the verses: 

ityadi sakalarn jhatva subhasubham udirayet / 
dharmasastroktamargena khecaranam balabalam // 
kamak§inamadheyena kamaksicaranarpitam / 

< catu > rdasakalarn caiva sa jatakakalanidhih // 

KAMESVARA UPADHYAYA (fl. 1987) 

A pupil of Ramacandra and a resident of Kasi, 
Karnes vara wrote a Golaparibhasa which was 
published with his own Sarnskrtavyakhya, 
Gudharthavati, and Hindi tika as KSS 257. Vara¬ 
nasi 1987. 

KALABHASKARA 

Alleged in at least one manuscript (GJRI 
8678/903) to be the author of the Pasakevali usu¬ 
ally associated with Garga {fl. ca. 900). 


34 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


^KALIDASA 

Additional manuscripts of his Ka(apaya (see 
CESS A 2, 32a); 

Bhubaneswar IV 14 (Jy/55 E). 5ff. Oriya. With the 
Oriya translation of Vanamalin. 

Bhubaneswar IV 39 (Jy/22c). Last folia. Oriya. With 
a tika. From Ranapur, Puri District. 

Bhubaneswar IV 51 (Jy/136a). Last folia. Oriya. 

From Parlakhemendi, Ganjam District. 
Bhubaneswar IV 94 (Jy/26c). Last folia. Oriya. From 
Jagatsimhapur, Cuttack District. 

^KALIDASA 

Additional manuscripts of his Grahamafiga- 
la^iaka (see CESS A 2, 32a-32b, and A 4, 50a-50b): 

RORI Cat. V 22338. If. Copied in Sam. 1897 = A.D. 
1840. 

RORI (Jaipur) 4316. 5ff. Copied by Vi§nu Bhafta at 
Badoda in Sarn. 1921 = a.d. 1864. 

GJRI 2188/253. Ff. 1-3. 

GOML Madras D.9529. Ff. 95-96. Telugu. 

RORI (Jaipur) 5662 (5). F. 12. 

The Grahamahgalasjaka was published by Hari- 
kr§na in his Mahgalasjaka, Aurahgabada 1885, f. 
3v. 


KALIDASA 

To Kalidasa is also attributed a Jyotisasara- 
sahgrafia. Manuscript; 

Bhubaneswar IV 80 (Jy/68). lOff. Oriya. Incomplete. 
From Turintra, P. S. Balipatana, Puri District. 

*KALIDASA 

Additional information concerning the manu¬ 
script of his Prakasadlpaka (see CESS A 4, 50b); 

Oxford CSS I 515 (*d. 796 (10)). Ff. 1-17. Incom¬ 
plete. 


^KALIDASA (fl. ca. 1242) 

Additional manuscripts of his Jyotirviddbharana 
(see CESS A 2, 32b-34a, and A 4, 50b); 

Kathmandu (1965) 31 (586). 146ff. Copied on Sun¬ 
day 3 suklapak^a of Bhadrapada in Sarn. 1751 = 
12 August 1694. 

New Delhi, H. B. Lall 86. 78ff. Copied by Sahava 
Rama for (?) Baladeva Lala at Mathura on Mon¬ 
day 1 suklapak§a of A§a(^ha in Sarn. 1894 = 3 
July 1837. 

RORI (Alwar) 2921. 121ff. Copied in Sam. 1901 = 
A.D. 1844. 

RORI (Alwar) 2920. 375ff.; and 36ff. Copied in 
Sam. 1911 = A.D. 1854. With the tika of Bhava- 
ratna and an anukramanika. 

BHU B.3297. 6ff. (also listed as 17ff.). Incomplete. 
BHU B.3324. 3ff. Incomplete. 

BHU C.2103. 246ff. With the tika of Bhavaratna. 
BHU C.3412. 36ff. Incomplete. No author men¬ 
tioned. 

BHU C.3449. 3Iff. No author mentioned. 

BHU C.4219. 6ff. Sarada. Incomplete. No author 
mentioned. 

BHU C.4466. 30ff. Sarada. Incomplete. No author 
mentioned. 

Kathmandu (1965) 32 (584). 40ff. Incomplete. 

RORI (Udaipur) 598. 37ff. With the vyakhya of 
Vasudeva. Incomplete. 

RORI (Udaipur) 4168 (2). Ff. 36-47. Incomplete. 
No author mentioned. 

RORI (Udaipur) 6197. 63ff. No author mentioned. 
Vrndavana 2830. 74ff. (ff. 1-57 missing). Incom¬ 
plete. 

The Jyotirviddbharana with the Sukhabodhikd of 
Bhavaratna and his own Hindi anuvada was pub¬ 
lished by Ramacandra Pandeya at Varanasi in 1988. 

KALIDASA (fl. 1632) 

The son of Balabhadra (fl. 1623/1642), Kalidasa 
wrote a Kundaprabandha in 73 verses in a.d. 1632. 
Manuscript; 


BORI 42 of A 1882/83. llff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


35 


*kasAjosya 

Additional information concerning a manuscript 
of his Daivajhasiromani (see CESS A 2, 34b): 

Mysore ORI *P.222/14. Ff. 58-92. Telugu. Incom¬ 
plete (prakaranas 1-5). {Daivajhasikhamani of 
Kacadaivajha = Daivajhasiromani of Kacana- 
josya). 

KASIDIK$ITA 

Author of a fika on the Kundakrtiprakasika of 
Ramacandra {fl. 1450). Manuscript: 

IM Calcutta 5850. See NCC, vol. 4, p. 188. 


^KASlDIK$ITA YAJNIKA {fl. ca. 1625/1675) 

1. Additional manuscripts of his Grahayajhapaddhati 
(see CESS A 2, 35a): 

BORI 589 of 1882/83 = BORI (Dharma) ,400. 35ff. 
Copied by the son of Gopala Joti§a of Virafak^e- 
tra on Thursday 6 kr§napak§a of Asvina in Saka 
1678 = 14 October 1756. 

BISM 41,16. (Grahamakhapaddhati). Ascribed to the 
son of KaUdiksita. 

2. Additional manuscripts of his Laksahomapaddhati 
(see CESS A 4, 50b-51a): 

AS Bengal I 3. 615 (I.D.27). 33ff. 

BHU B.1240. 17ff. 

3. Additional manuscripts of his Prayogaratna (see 
CESS A 4, 51a): 

Benares (1953) 8675. Ff. 1-5. Copied in Sarn. 1827 
= A.D. 1770. Incomplete (varddhapanavidhi). 

AS Bengal I 3. 668 = IM, Calcutta 3059. Ff. 2-62. 

Copied in Sarn. 1828 = a.d. 1771. 

AS Bengal I.E.54. 

AS Bengal I 3. 667 = IM Calcutta 3067. Ff. 2-82. 
Incomplete. 

RORI Cat. XVI 36372. 20ff. Incomplete. 


KASlNATHA 

Author of an Ak^aracakra in 50 verses. Manu¬ 
script: 

WHMRL a 934. Ff. 1 and 3-8. Incomplete (verses 
1-4 and 10-50). 

The colophon begins: iti srikasinathakrti. 


KASlNATHA 

Author of an Ahgasparsaprasna. Manuscript: 
Kathmandu (1964) 2 (4012). 3ff. 

The colophon begins: iti kasinathakrte. 


^KASlNATHA 

Additional manuscripts of his ArghadXpika (see 
CESS A 2, 35a): 

Vrndavana 3432. 15ff. Copied by Sivanarayaiia in 
Sarn. 1909 = a.d. 1852. 

Udaipur RVSS 885. 23ff. Copied by Devasarikara 
Josi in Sarn. 1942 = a.d. 1885. 


* KASlNATHA (fl. before 1556) 

Additional manuscripts of his Prasnapradipa 
(see CESS A 2, 35b-36b; A3, 19b; and A4, 
51b-52a): 

RORI (Udaipur) 6222. 5ff. (f. 1 missing). Copied by 
Damodaradasa of the Rudrapalligaccha in 
Sarn. 1641 = A.D. 1584. Incomplete. 

RORI (Udaipur) 6474. 9ff. Copied by Kesavadasa 
Tripafhin in Sarn. 1653 = a.d. 1596. 

Nagaur 1010. 5ff. Copied on 4 kr§riapak§a of Magha 
in Sarn. 1682 = ca. 5 February 1626. (Brahma- 
pradipa). 

RORI Cat. IV 20716. 9ff. Copied by Srinatha at 
Nagapura in Sarn. 1748 = a.d. 1691. 

RORI (Bikaner) 14656. Ff. 9-11. Copied in Sarn. 
1780 = a.d.1723. 

Oxford CSS I 509 (*d. 784 (4)). Ff. 1-23. Copied on 
Thursday 11 suklapak§a of Vaisakha in Sarn. 
1828, Saka 1693 = 25 April 1771. 


36 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Chittorgarh) 2592. 5ff. Copied in Sam. 1844 
= A.D. 1787. 

RORI (Udaipur) 5362. 20ff. Copied by Salagarama 
JoM in Sarn. 1846 = A.D. 1789. 

Rattan II 14780. 15ff. Copied in Sarn. 1862 = A.D. 

1805. 

RORI (Jaipur) 4076. 25ff. (ff. 1-6 missing). Copied 
by Salagarama Brahmaiia in Sarn. 1863 = A.D. 

1806. Incomplete. 

BHU C.3585. 19ff. Copied in Sarn. 1890 = A.D. 
1833. 

RORI (Alwar) 2827. 15ff. Copied by Isara Brah¬ 
maiia in Sarn. 1909 = A.D. 1852. 

Oxford CSS I 510 (d. 751 (2)). Ff. 1-11. Copied by 
Sivasarikara Lala on Thursday 4 krsnapak§a of 
Karttika in Sarn. 1910 = 17 November 1853. 
RORI (Alwar) 2821. 24ff. Copied in Sarn. 1910 = 
A.D. 1853. 

RORI (Alwar) 5412. 2ff. Copied in Sarn. 1934 = 
A.D. 1877. 

RORI (Alwar) 5468 (10). Ff. 100-106. Copied by 
Krsnalala in Sarn. 1942 = A.D. 1885. 

BHU B.3716. 23ff. (Grahapmdipa). Incomplete. 
BHU C.133. 21ff. 

BHU C.3576. 31ff. Incomplete. 

BHU C.4838. 8ff. Incomplete. 

Jammu 8018. 27ff. 

Panjab JB I 1800 (Patti 191). 6ff. 

RORI Cat. VI 23999. 6ff. 

RORI Cat. XVI 35119. 7ff. 

RORI Cat. XVI 37171. lOff. 

RORI (Alwar) 2820. 16ff. Incomplete. 

RORI (Alwar) 2828. 17ff. 

RORI (Jaipur) 2872. 9ff. (ff. 2-3 missing). Incom¬ 
plete. 

RORI (Jaipur) 2991. 6ff. Incomplete. 

Vrndavana 3406. 9ff. With a Lagnajhana. Incom¬ 
plete. 

WHMRL a 780 = *WHMRL K.2.a. Ff. 2-11 and 
13-21. Incomplete. 

*KASlNATHA (fl. before 1600) 

Additional manuscripts of his Lagnacandrika (see 
CESS A 2, 36b-39a; A 3, 20a; and A 4, 52a-52b; see 
also D. Pingree [A5. 1989c]): 

BHU C.4439. 25ff. Sarada. Copied in Sam. 1423 (?) 
= A.D. 1366. Presumably one should read Sarn. 
1823 = A.D. 1766. 

RORI (Jaipur) 7128 (1). 40ff. Copied in Sarn. 1675 
= A.D. 1618. Incomplete. 

RORI Cat. VIII 28057 (9). Ff. 59-87. Copied in 


Sarn. 1702 = A.D. 1645. 

RORI Cat. IV 19828. 14ff. Copied at Murudac^a in 
Sarn. 1708 = A.D. 1651. 

RORI Cat. IV 19124. 34ff. Copied at Pacahara in 
Sarn. 1715 = A.D. 1658. 

RORI (Bikaner) 14658. 22ff. Copied at Sarasa in 
Sarn. 1731 = A.D. 1674. 

WHMRL j3 558. Ff. 1-21. Copied at Sarasanagara 
on 1 kr§iiapak§a of Asvina in Sarn. 1731 = ca. 5 
October 1674. 

WHMRL (5 638 = *WHMRL 1.62. Ff. 1-25. Copied 
by Surata R§i at Haivatapura on Friday 6 kr§iia- 
pak^a of Vaisakha in Sarn. 1784 = 31 March 
1727. 

RORI (Jaipur) 10978. 36ff. (ff. 1-2 missing). Copied 
in Sarn. 1796 = A.D. 1739. Incomplete. 

Oxford CSS I 266 (*d. 768 (9)). Ff. 1-23. Copied by 
Dhanahjaya on 2 kr§tiapak§a of Asvina in Nep. 
Sarn. 876 = ca. 21 October 1755. 

Udaipur RVSS 117. 21ff. Copied by Sivadatta in 
Sarn. 1835 = A.D. 1778. 

RORI Cat. VIII 26703. 42ff. Copied in Sarn. 1839 = 
A.D. 1782. 

Nagaur 1032. 69ff. Copied on Thursday 2 sukla- 
pak§a of Phalguna in Sarn. 1841 = 10 February 
1785. 

Vrndavana 3433. 23ff. (f. 1 missing). Copied by 
Sitarama in Sarn. 1850 = A.D. 1793. Incomplete. 

Oxford CSS I 267 (*d. 776 (6)). Ff. 1-37. Copied on 
30 kr§napak§a of Pau§a in Sarn. 1873 = ca. 17 
January 1817. 

RORI (Jaipur) 5473. 73ff. (ff. 2-3 missing). Copied 
in Sarn. 1874 = A.D. 1817. Incomplete. 

BHU B.182. 9ff. Copied in Sarn. 1877 = A.D. 1820. 

BHU C.2201. 60ff. Copied in Sarn. 1890 = A.D. 
1833. Incomplete. 

RORI (Jaipur) 2494. 7ff. Copied in Sarn. 1905 = 
A.D. 1848. Incomplete. 

RORI (Jaipur) 3645. 9ff. (f. 3 missing). Copied in 
Sarn. 1908 = A.D. 1851. Incomplete. 

Oxford CSS I 268 (*d. 755). Ff. 1-78. Copied by 
Ramavalaji Suklavaje for Ramaprasada at Raja- 
durga on Wednesday 4 suklapak^a of A§adha in 
Sarn. 1914 = 14 July 1858. 

BHU B.183. 41ff. Copied in Sarn. 1925 = A.D. 1868. 

RORI (Jaipur) 3747. 48ff. (ff. 1-14 missing). Copied 
by Baladeva Sarman, the son of Sivanarayaiia, at 
Toradi in Sarn. 1934 = A.D. 1877. Incomplete. 

ABSP 3229. 33ff. Incomplete (pariccheda 1). 

ABSP 7051. 53ff. 

BHU B.180. 4ff. Incomplete. 

BHU B.181. 29ff. Incomplete. 

BHU C.935. 45ff. Sarada. 

BHU C.5068. 13ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


37 


GJRI 8635/860. Ff. 1-44. 

GJRI 8636/861. Ff. 1-6. Maithili. 

GJRI 8637/862. Ff. 1-49. Maithili. 

GJRI 8638/863. Ff. 1-73. Incomplete. 

GJRI 8639/864. Ff. 2-50. Incomplete. 

GJRI 11125/1179. Ff. 1-30. Incomplete. 

GJRI 11126/1180. 2ff. Incomplete. 

Jaipur (Khasmohor) 5248; 5382; and 5492. Two of 
these equal ^Jaipur (II). 28ff. (Copied in Sam. 
1727 = A.D. 1670); and 4ff. 

New Delhi, H. B. Lall 36. 39ff. Incomplete (ends in 
9, 28d). 

NFS (Sanskrit) 8119. 5ff. (Lagnajataka). 

NFS (Sanskrit) 8408. If. (Lagnajataka). Incomplete. 

NFS (Sanskrit) 9040. Ff. 22-30. Incomplete. 

NFS (Sanskrit) 9632. If. Incomplete (janmatithi). 

Oxford CSS I 269 (*c. 316 (9)). Ff. 1-33. Copied by 
Sva<min> Gahgadasaji at Sivalalanagara (?). 

Oxford CSS I 270 (*f. 94). Ff. 1-10, 12-19, and 
21-86. Sarada. Incomplete. 

FrSB 2942 (Gottingen, Mu I 84). Ff. 14-64. Sarada. 

FrSB 3614 (Berlin or. fol. 2376). 22ff. Copied by 
Caturakusala Gani, the pupil of Sridharakusala 
Gani, at Candaulanagara for Gatigakusala Gani. 

RORI Cat. IV 18558. 18ff. 

RORI Cat. IV 21453 (1). 5ff. No author mentioned. 

RORI (Alwar) 2751. 73ff. 

RORI (Alwar) 5250. 25ff. Incomplete. 

RORI (Bikaner) 14657. 30ff. 

RORI (Chittorgarh) 2883. 21ff. No author men¬ 
tioned. 

RORI (Jaipur) 2408. 16ff. Incomplete. 

RORI (Jaipur) 2475. 96ff. Incomplete. 

RORI (Jaipur) 3590. 2ff. Incomplete (candrapari- 
vartana aryaghatacakra). 

RORI (Jaipur) 6896. 36ff. (f. 9 repeated). Incom¬ 
plete. 

RORI (Jaipur) 7394. 9ff. Incomplete. 

RORI (Jaipur) 9310. 41ff. Incomplete. 

RORI (Jaipur) 10843. 35ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Udaipur) 5596. 21ff. (ff. 1-3 and 12 miss¬ 
ing). Incomplete. 

Udaipur RVSS 159. 17ff. 

Vrndavana 2362. 41ff. Incomplete. 

Vrndavana 2412. 26ff. Incomplete. 

Vrndavana 3159. 22ff. Incomplete. 

Vrndavana 3927. 3ff. Incomplete. 

Vrndavana 4132. 44ff. Incomplete (to end of eka- 
grahadhyaya). 

WHMRL j3 895. Ff. 1-21. Copied by Fandita Ratna- 
sundara. 


of Ramabihari Sukula was published at Lakhanau in 
1976; a revised ed. with the Hindi tika of Candra- 
prakasa Acarya was published at Bareli in 1983; and 
the Lagnacandrika was published with the Hindi 
fika of Bastiramaji at Bambai in 1987. Some cop¬ 
ies of the edition by Vasudeva Gupta bear the date 
1980. 


^KASINATHA (fl. before 1559) 

Additional manuscripts of his Stghrabodha (see 

CESS A 2, 39a-44a; A 3, 20a-20b; and A 4, 

52b-54a): 

Jaipur (Khasmohor) 5361. Copied in Sarn. 1684 = 
A.D. 1627. 

RORI (Bikaner) 14654. 14ff. Copied at Jalora in 
Sarn. 1710 = A.D. 1653. 

RORI (Chittorgarh) 2243. 2ff. Copied by Akherama 
at Lahanagara in Sarn. 1711 = a.d. 1654. Incom¬ 
plete. 

RORI Cat. IV 21056. 16ff. (f. 1 missing). Copied in 
Sam. 1718 = a.d. 1661. 

RORI (Udaipur) 3784 (1). Ff. 2-5. Copied in Sam. 
1718 = A.D. 1661. Incomplete. No author men¬ 
tioned. 

RORI (Udaipur) 4118 (1). Ff. 20-41. Copied by 
Duda Josi in Sarn. 1765 = a.d. 1708. Incom¬ 
plete. 

Delhi Jaina (Dharmapura) 433 (No. 15). 15ff. Cop¬ 
ied in Sarn. 1783 = a.d. 1726. 

RORI (Jaipur) 2778. 48ff. (f. 5 repeated). Copied by 
NMhulala Jyotisi in Sarn. 1788 = a.d. 1731. 

RORI (Jaipur) 2753. 35ff. (f. 5 missing). Copied by 
Jayakisana Vyasa in Sarn. 1789 = a.d. 1732. 
Incomplete. 

RORI (Udaipur) 4129 (2). Ff. 1-37. Copied by Sam- 
bhudasa in Sarn. 1794 = a.d. 1737. 

RORI (Jaipur) 8585. 62ff. (ff. 1-17 missing; f. 46 
repeated). Copied by Kesava at Ramapura in 
Sarn. 1803 = a.d. 1746. Incomplete. 

NFS (Sanskrit) 9047. Ff. 9-27, 29, and 36-37. Cop¬ 
ied by Sitarama for Isvaralala Dasa in Sarn. 
1809, Saka 1674 = a.d. 1752. Incomplete. 

RORI (Chittorgarh) 4179. 27ff. Copied by Fun- 
yaUla Gana at Kalauna in Sarn. 1811 = a.d. 
1754. 

Vrndavana 10996. 39ff. (ff. 1 and 37 missing). Cop¬ 
ied in Sarn. 1819 = A.D. 1762. Incomplete. 

RORI Cat. IX 29896. 46ff. Copied by Caritrodaya at 
Talavada in Sarn. 1825 = a.d. 1768. With a sta- 
baka in Rajasthani. 


The 14th ed. of the Lagnacandrika with the tika 


38 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 3569. 70ff. Copied by Haranatha in 
Sam. 1845 = a.d. 1788. 

RORI (Jaipur) 8883. 71ff. (ff. 1-6 missing). Copied 
by Ganesa Gadana in Sarn. 1846 = a.d. 1789. 
Incomplete. 

Oxford CSS I 405 (*d. 764 (5)). Ff. 1-39. Copied by 
Ganesarama Duve at Kasi on Monday 10 sukla- 
pak§a of Margasir§a in Sarn. 1852 = 21 Decem¬ 
ber 1795. 

RORI Cat. V 23202. 14ff. Copied by Hajarimala at 
Najapura in Sarn. 1852 = a.d. 1795. 

GJRI 8689/914. Ff. 1-22. Maithili. Copied in Saka 
1718 = A.D. 1796. 

Udaipur RVSS 12. 45ff. Copied by Ratnacandra 
Bhafta in Sam. 1864 = a.d. 1807. Incomplete. 
Udaipur RVSS 292. 61ff. Copied in Sarn. 1864 = 
A.D. 1807. 

Panjab JB I 2542 (Zira 500). 45ff. Copied in Sarn. 
1869 = A.D. 1812. 

RORI (Alwar) 5274. 45ff. Copied in Sarn. 1869 = 
A.D. 1812. 

Vrndavana 9628. 76ff. (ff. 1-3 missing). Copied by 
Ciranjiva Lala in Sam. 1869 = a.d. 1812. Incom¬ 
plete. 

NFS (Sanskrit) 9043. 25ff. Copied on 10 kr§napak§a 
of Pau§a in Sam. 1869, Saka 1734 = ca. 26 Janu¬ 
ary 1813. Incomplete. 

Oxford CSS I 406 (*d. 790 (4)). Ff. 1-12, 14, 14b, 
16-18, 18b, and 20-43. Copied on Thursday 8 
kr$napak§a of Vaisakha in Sarn. 1871 = 13 May 

1814. Incomplete. 

BHU C.2988. 36ff. Copied in Sam. 1872 = a.d. 

1815. 

RORI (Alwar) 5427. 20ff. Copied in Sarn. 1875 = 
A.D. 1818. Incomplete (prakaranas 3-4). 

RORI (Bikaner) 17331. 36ff. Copied by RQpacanda 
at Rajagadha in Sam. 1877 = a.d. 1820. 

RORI (Jaipur) 3335. 18ff. Copied at Bisau in Sarn. 
1877 = A.D. 1820. 

RORI (Jaipur) 2899. 67ff. (f. 2 missing). Copied by 
Bhagiratha Brahmana in Sam. 1878 = A.D. 1821. 
Incomplete. 

RORI (Jaipur) 6202 (1). 8ff. Copied in Sam. 1878 = 
A.D. 1821. With a Rajasthani tika. Incomplete 
(vivaha). 

Vrndavana 4970. 41ff. Copied by Venirama Brah¬ 
mana in Sarn. 1878 = a.d. 1821. 

BHU B.362. 69ff.Copied in Sarn. 1879 = a.d. 1822. 

With the tika of Candrabhanu. 

RORI (Jaipur) 6990 (5). 26ff. Copied in Sarn. 1880 
= A.D. 1823. 

RORI (Jaipur) 9594. 23ff. (f. 1 missing). Copied in 
Sarn. 1880 = a.d. 1823. Incomplete (vivaha). 
Oxford CSS I 407 (*d. 767 (1)). Ff. 1, 3-5, 6, 8-11, 


13-18, 20, 25, 27-28, 35-37, 40, and 42-43. Cop¬ 
ied by Lokanatha on Tuesday 1 suklapak§a of 
Pau§a in Sam. 1881 = 21 December 1824. 

Incomplete. 

RORI (Jaipur) 2542. 23ff. (ff. 2-3 and 25 missing; f. 
19 rpeated). Copied by Pratapa Dvija in Sam. 
1882 = A.D. 1825. Incomplete. 

Vrndavana 7513. 24ff. Copied by Jamanadasa Vai§- 
nava in Sarn. 1882 = a.d. 1825. 

RORI (Jaipur) 3601. lOff. Copied by Syamalala at 
Visahu in Sarn. 1885 = a.d. 1828. Incomplete (to 
vivaha). 

RORI (Chittorgarh) 3520. 19ff. Copied by 

Gaurisahkara at Bigoda in Sam. 1887 = a.d. 
1830. 

Nagaur 1063. 53ff. Copied on Sunday 5 suklapaksa 
of Sravana in Sarn. 1890 = 21 July 1833. With a 
Hindi artha. 

RORI (Chittorgarh) 1409. 54ff. Copied by Righaka- 
rana Josi in Sarn. 1890 = A.D. 1833. 

RORI (Chittorgarh) 1418. 12ff. Copied in Sam. 1894 
= A.D. 1837. Incomplete (vivaha). 

PrSB 3624 (Berlin or. fol. 2413). 14ff. Copied by 
Kr§nagopala on Sunday 10 suklapak§a of Bha- 
drapada in Sarn. 1897 = 16 August 1840. Incom¬ 
plete (prakarana 1). Formerly property of Nan- 
dakisora. 

RORI (Alwar) 5426. 38ff. Copied by Ganesalala in 
Sam. 1898 = a.d. 1841. Incomplete (prakaranas 
1 - 2 ). 

RORI (Jaipur) 2669. 38ff. (ff. 6-10 and 38-40 miss¬ 
ing). Copied by Balarama in Sarn. 1900 = a.d. 
1843. Incomplete. 

Vrndavana 11089. 26ff. Copied by Asarama Brah¬ 
mana in Sarn. 1901 = a.d. 1844. Incomplete. 

RORI (Chittorgarh) 329. 63ff. Copied by Dhana 
Tivadi in Sarn. 1903 = a.d. 1846. 

Vrndavana 1414. 30ff. Copied by Manirama Misra 
in Sarn. 1903 = a.d. 1846. 

*WHMRL G.3.f. Ff. 1-24. Copied by Devacanda on 
a Tuesday in the kr§napak§a of Asvina in Sam. 
1907 = 22 or 29 October 1850. 

RORI (Jaipur) 3336. 78ff. (f. 6 missing). Copied in 
Sam. 1908 = a.d. 1851. Incomplete. 

GJRI 8687/912. Ff. 1-22. Maithili. Copied in Saka 
1774 = A.D. 1852. 

Nagaur 1060. 7ff. Copied on 7 kr§napak§a of Sra¬ 
vana in Sam. 1909 = ca. 7 August 1852. 

Vrndavana 10525. 31ff. (f. 2 missing). Copied by 
Ramala<la> in Sarn. 1910 = A.D. 1853. Incom¬ 
plete. 

BHU C.3017. 32ff. Copied in Sam. 1911 = A.D. 
1854. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


39 


RORI (Bikaner) 15903. 14ff. Copied by Sriya Vyasa 
at Bikanera in Sarn. 1911 = a.d. 1854. 

WHMRL i3 209 = *WHMRL G.lOb.b. Ff. 1-50. 
Copied by Lak^mana Caube on Monday 9 kr§na- 
pak§a of A§a(^ha in Sam. 1911 = 17 July 1854. 

RORI (Udaipur) 4087. 5iff. (ff. 2-13, 30, and 36 
missing). Copied by Devarama, the son of Kr§na, 
at Udayapura in Sam. 1915 = a.d. 1858. Incom¬ 
plete. 

RORI (Udaipur) 6479. 59ff. Copied by Hiralala 
Ganda at Didapura in Sarn. 1915 = a.d. 1858. 

Nagaur 1057. 91ff. Copied on 5 suklapak§a of Vai- 
sakha in Sarn. 1917 = ca. 26 April 1860. 

RORI (Jaipur) 9810. 20ff. Copied in Sarn. 1917 = 
A.D. 1860. Incomplete (prakaratia 4). 

RORI Cat XVI 36451 (3). Ff. 34-66. Copied at 
Hara§ala in Sarn. 1920 = a.d. 1863. With a 
Rajasthani tippana. 

RORI (Chittorgarh) 3385. llff. Copied by Manaka- 
canda in Sarn. 1920 = a.d. 1863. 

RORI (Jaipur) 3581. 54ff. Copied by Narayaria 

Brahmatia at Dharidamahanasara in Sarn. 1921 = 
A.D. 1864. 

Vrndavana 9821. Ff. 4-5, 10-11, 19-20, 30, 32, 38, 

43, and 50. Copied in Sarn. 1921 = a.d. 1864. 

Incomplete. 

RORI (Jaipur) 2598. 56ff. Copied by Nandalala 

Ramanarayaria in Sarn. 1930 = a.d. 1873. 

RORI (Udaipur) 6526. 22ff. Copied by Garigavisana 
Gauda in Sarn. 1933 = a.d. 1876. Incomplete 
(vivaha). 

RORI (Chittorgarh) 571. 58ff. (f. 1 missing). Copied 
in Sarn. 1938 = A.D. 1881. Incomplete. 

Vrndavana 2389. 61ff. Copied in Sarn. 1942 = a.d. 
1885. Incomplete (prakararia 4). 

BHU C.8344. 16ff. Copied in Sarn. 1953 = a.d. 
1896. Incomplete. 

BHU C.1643. 16ff. Copied in Sarn. 1995 = a.d. 
1938. 

AS Bengal 7083 (G.7911). 8ff. With the tlka of 
Balakr^ria. Incomplete. 

BHU B.161. 42ff. 

BHU B.4245. 45ff. 

BHU B.4446. 3ff. Incomplete. 

BHU C.615. 51ff. Incomplete. 

BHU C.632. 84ff. Incomplete. 

BHU C.689. 15ff. Sarada. Incomplete. 

BHU C.2612. 81ff. Sarada. With a fika. 

BHU C.2777. 42ff. With a tika. Incomplete. 

BHU C.2859. 8ff. Incomplete. 

BHU C.2860. 13ff. Incomplete. 

BHU C.2893. 33ff. Incomplete. 

BHU C.2935. 12ff. Incomplete. 

BHU C.3102. 8ff. With a tika. Incomplete. 


BHU C.3103. 52ff. With the tika of Amiracandra. 
Incomplete. 

BHU C.3107. 24ff. Incomplete. 

BHU C.3141. 17ff. Incomplete. 

BHU C.3296. 5ff. Incomplete. 

BHU C.3540. 17ff. Incomplete. 

BHU C.3551. 18ff. Incomplete. 

BHU C.3552. 45ff. Incomplete. 

BHU C.3958. 16ff. Sarada. With a tika. Incomplete. 
GJRI 8663/888. Ff. 1-6. Incomplete. 

GJRI 8685/910. Ff. 1-4. Maithili. 

GJRI 8686/911. Ff. 1-45. 

GJRI 8688/913. Ff. 1-32 and 34. Incomplete. 

GJRI 8690/915. Ff. 1-16. Maithili. 

GJRI 8691/916. Ff. 1-43. 

GJRI 8692/917. Ff. 1-77. 

GJRI 8693/918. Ff. 1-16. Maithili. Incomplete. 

GJRI 8694/919. Ff. 1-11. Maithili. Incomplete (vi¬ 
vaha). 

GJRI 8695/920. Ff. 1-12 and 16-17. Maithili. 
Incomplete. 

GJRI 8696/921. Ff. 1-44. Maithili. Incomplete. 

GJRI 8697/922. Ff. 1-8. Incomplete. 

GJRI 9222/1004. Ff. 1-2. Incomplete. 

GJRI 11157/1211. 19ff. Maithili. Incomplete. 

GJRI 11158/1212. 4ff. Maithili. Incomplete. 

GJRI 11164/1218. Ff. 1-31. Incomplete. 

GJRI 11165/1219. Ff. 5-12. Maithili. Incomplete. 
GJRI 11166/1220. Ff. 1-8. Maithili. Incomplete. 
Jaipur (Khasmohor) 1087; 2202 (3); 5080; 5084; 

5418; 5493; 6844; and 7666. 

Mysore ORI A.698. Ff. 1-63. Incomplete. 

Mysore ORI *B.585. Ff. 1-43. Incomplete. 

Nagaur 1058. 18ff. 

Nagaur 1059. 30ff. 

Nagaur 1061. 6ff. 

Nagaur 1062. 15ff. 

NFS (Sanskrit) 8191. If. Incomplete. No author 
mentioned. 

NFS (Sanskrit) 8302. If. Incomplete. 

NFS (Sanskrit) 8389. If. Incomplete. 

NFS (Sanskrit) 8435. 4ff. Incomplete. 

NFS (Sanskrit) 8782. 7ff. Incomplete. 

NFS (Sanskrit) 9040. Ff. 2-6 and 12-18. Incomplete. 
Oxford CSS I 408 (f. 99). Ff. 9-18, 18b-32, and 
<33>. Sarada. Copied by Faridita Damodara 
Dvijanma. Incomplete. 

Fanjab JB I 2540 (Nakodar 144). 2ff. 

Fanjab JB I 2541 (Nakodar 405). 21ff. 

Fattan II 5647 (1). Ff. 1-20. 

FrSB 2955 (Gottingen, Sanscr. Sham 29). Ff. 

18-21v. Sarada. 

RORI Cat. IV 19794. 6ff. 

RORI Cat. IV 21891. 5ff. (Sisubodha). 


40 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. VIII 26725 (1). 47ff. With a Hindi tika. 
RORI Cat. VIII 26811. 7ff. Incomplete. . 

RORI (Alwar) 2773. 98ff. With the tika of Candra- 
bhanu. 

RORI (Alwar) 5177. 22ff. (ff. 1-2 missing). Incom¬ 
plete. 

RORI (Alwar) 5306. Ff. 32-64. Incomplete. 

RORI (Alwar) 5476. 5Iff. Incomplete. 

RORI (Alwar) 6258. Ff. 5-12. Incomplete (vivaha). 
RORI (Bikaner) 14651. 27ff. Incomplete. 

RORI (Bikaner) 14652. 25ff. 

RORI (Bikaner) 14653. 58ff. 

RORI (Bikaner) 14659. 17ff. 

RORI (Bikaner) 14665. 61ff. Copied by Haradeva at 
Rayasana. 

RORI (Bikaner) 15882. 5ff. Copied by Kirtivilasa. 
RORI (Chittorgarh) 123. 3ff. Incomplete (vivaha). 
RORI (Chittorgarh) 1442. 45ff. 

RORI (Chittorgarh) 1449. 35ff. 

RORI (Chittorgarh) 2965. 37ff. (ff. 1-10 missing). 
Incomplete. 

RORI (Chittorgarh) 3336. Ff. 16-35. Incomplete. 
RORI (Chittorgarh) 4296. 8ff. Incomplete. 

RORI (Chittorgarh) 4348. 24ff. (ff. 1-8 missing). 
Incomplete. 

RORI (Jaipur) 2236. 42ff. 

RORI (Jaipur) 2674. 47ff. (f. 10 missing). Incom¬ 
plete (to argha). 

RORI (Jaipur) 3813. 31ff. Incomplete. 

RORI (Jaipur) 4102. 44ff. Incomplete. 

RORI (Jaipur) 4342. 13ff. Incomplete (to vivaha). 
RORI (Jaipur) 4959. 13ff. Incomplete (vivaha). 

RORI (Jaipur) 5114. 40ff. (f. 17 repeated). 

RORI (Jaipur) 5908. 12ff. Incomplete. 

RORI (Jaipur) 6479. 8ff. Incomplete. 

RORI (Jaipur) 6762. 20ff. Incomplete. 

RORI (Jaipur) 8888. 68ff. Incomplete. 

RORI (Jaipur) 8904. 17ff. (f. 1 missing). Incomplete. 
RORI (Jaipur) 8993. 25ff. Incomplete (vivaha). 

RORI (Jaipur) 9337. 61ff. Incomplete. 

RORI (Jaipur) 10097. 84ff. (ff. 1-24 missing). 
Incomplete. 

RORI (Jaipur) 10137. 31ff. (ff. 10, 21-24, and 28 
missing). Incomplete. 

RORI (Jaipur) 10640. 7ff. Incomplete (vivaha). 

RORI (Jaipur) 10894. 23ff. Incomplete. 

RORI (Jaipur) 11254. 2ff. Incomplete. 

RORI (Udaipur) 5360. 43ff. (ff. 1-2 missing). 
Incomplete. 

RORI (Udaipur) 5421. 16ff. (ff. 1-2 missing). With 
a Rajasthani tippana. Incomplete. 

RORI (Udaipur) 5908. lOff. (f. 5 repeated). Incom¬ 
plete. 

RORI (Udaipur) 6096. 35ff. Incomplete. 


RORI (Udaipur) 6104. 18ff. (ff. 1-3 missing). 
Incomplete. 

RORI (Udaipur) 6198. 66ff. (ff. 16, 30-31, and 
43-55 missing). With the fika of Candrabhanu. 
Incomplete (vivaha). 

RORI (Udaipur) 6219. 32ff. Incomplete. 

RORI (Udaipur) 6230. 17ff. (f. 12 repeated). 

RORI (Udaipur) 6492. 20ff. (f. 9 missing; f. 20 
repeated). Incomplete (prakaranas 1-2). 

RORI (Udaipur) 6522. 7ff. Incomplete. 

RORI (Udaipur) 6527. llff. With a Rajasthani 
artha. Incomplete. 

Udaipur RVSS 1282. 18ff. Incomplete. 

Udaipur RVSS 1294. 13ff. Incomplete. 

Udaipur RVSS 2125. 7ff. Incomplete. 

Udaipur RVSS 2138. Ff. 3-7. Incomplete. 

Udaipur RVSS 2235. 6ff. Incomplete. 

Udaipur RVSS 2266. 5ff. Incomplete. 

Visvabharati (Adyar) 746 (a). 26ff. Malayalam. 

Vrndavana 2232. 12ff. Incomplete (muhurta). 

Vrndavana 2316. 16ff. 

Vrndavana 2803. 7ff. 

Vrndavana 3617. 28ff. Incomplete. 

Vrndavana 4116. 25ff. 

Vrndavana 4836. 3ff. Incomplete. 

Vrndavana 5239. 24ff. Incomplete. 

Vrndavana 5247. 9ff. Incomplete. 

Vrndavana 5257. 29ff. Incomplete. 

Vrndavana 5262. 22ff. Incomplete. 

Vrndavana 6593. 26ff. 

Vrndavana 7409. lOff. Incomplete. 

Vrndavana 7638. 20ff. (ff. 1-12 missing). Incom¬ 
plete. 

Vrndavana 7970. Ff. 4-6, 20-29, 31-39, and 42; and 
If. Incomplete. 

Vrndavana 8605. 8ff. Incomplete (vivaha). 

Vrndavana 8616. 7ff. Incomplete. 

Vrndavana 9721-A. 57ff. Incomplete. 

Vrndavana 9808. Ff. 5, 8, 23, 31, 35, and 41. Incom¬ 
plete. No author mentioned. 

Vrndavana 9820. 2Iff. (ff. 1-13 missing). Incom¬ 
plete. 

Vrndavana 10006. 2Iff. Incomplete. 

Vrndavana 10994. Ff. 19 and 21-28. Copied by 
Sadasukha Misra. Incomplete. 

Vrndavana (Hindi) 9674. 23ff. With a Hindi tika. 
Incomplete. 

Vrndavana (Hindi) 9896. 29ff. With a Hindi tika. 
Incomplete. 

*WHMRL E.15.d. Ff. 1, 3-25, 27, and 34. Incom¬ 
plete (I 1-8; 1 25-III 8; III 40-58; and IV 70). 

WHMRL a 58. Ff. 1-48, 48b, and 48c. Incomplete 
(ends with IV 74b). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


41 


WHMRL a 790 = *WHMRL K.6.cl. Ff. 4-10, 
12-14, 20 (= 15), 16-17, 23-25 (text continuous 
between ff. 17 and 23), 27-32, 34-46, 50-51, and 
53-55. Incomplete (I 38-149; I 155-11 74; II 
80-133; II 142-III 15; III 51-76; and IV 1-38). 

The 2nd ed. of the Slghrabodha with the Hindi 
tika of Candraprakasa Acarya was published at 
Bareli in 1982. The Slghrabodha was also edited 
with his own Hindi vyakhya, Sugama, by Rama- 
janma Misra as Kr^naddsa SS 69, Varanasi 1985; 
and with an anonymous Hindi fika at Mumbayi in 
Sam. 2042, Saka 1907 = a.d. 1985. 

*KASINATHA 

Additional manuscript of his S^ittrirnsatika (see 
CESS A 2, 39a): 

RORI (Jaipur) 10797. 6ff. Copied by Isaradasa in 
Sam. 1783 = a.d. 1726. 


*KASINATHA 

Additional manuscript of his Horacakra (see 
CESS A 2, 44a, and A 4, 54b): 

BHU C.2118. 9ff. Incomplete. 


^KASINATHA TARKALANKARA 

Author also (see CESS A 2, 44a) of a tika on the 
Prayascittatattva of Raghunandana (fl. 1520/1570). 
Manuscripts: 

GJRI 5386/417. Ff. 1-24. Maithili. Incomplete. 
Sastri, Not. 1900. 238. 19ff. Bengali. Property of 
Pandita Sasibha§ana Smrtiratna of Nadiyagrama, 
P. O. Loosing, Pharidapura District. 

The first verse is: 

pranamya parvatisanau srikasinathasarmana / 
prayascittasya tattvanam bodhini kriyate tv iyam // 

Kasinatha also wrote a vivarana on Raghu- 
nandana’s Malamdsatattva. Manuscripts: 

GJRI 5412/443. Ff. 1-105. Maithili. 

GJRI 5413/444. Ff. 1-10. Maithili. Incomplete. 


^KASlNATHA UPADHYAYA (d. 1805) 

Additional manuscripts of his Dharmasindhusdra 

(see CESS A 3, 20b-21a, and A 4, 54b-56a): 

RORI Cat. XVI 35945-35948. 19ff.; 57ff.; 125ff.; 
and 180ff. Copied by Gaudapada (or Gau(^a 
Bhatta), the son of Narayana Bhatta, in Sarn. 
1883 = A.D. 1826. Incomplete (paricchedas 1-3). 

RORI Cat. VII 26556. 72ff. Copied by Giradharin in 
Sam. 1905 = a.d. 1848. Incomplete (pariccheda 
2 ). 

RORI (Alwar) 3915-3918 = *Alwar 1363. 37ff.; 
95ff.; 192ff.; and 140ff. Copied in Sam. 1908 = 
A.D. 1851. 

Mysore ORl P.7574/3. Ff. 189-289. Nandinagari. 
Copied on Saturday 7 suklapak§a of Bhadrapada 
in Saka 1776 (the date is irregular). Incomplete 
(to pariccheda 3). 

RORI Cat. XVI 36736. 414ff. Copied by Govinda: 
pariccheda 2 in Sam. 1915 = a.d. 1858 and pari¬ 
ccheda 4 in Sarn. 1922 = A.D. 1865. 

Mysore ORI C.2523/3. Ff. 1-6; 1-22; 1-58; 1-123; 
and 1-180. Copied in Saka 1782 = a.d. 1860. 
Incomplete (paricchedas 1-3). No author men¬ 
tioned. 

NPS (Sanskrit) 8888. 207ff. Copied on Monday 5 
kr§napak§a of Sravana in Saka 1782 = 6 August 
1860. Incomplete. 

Mysore ORI C.3856/2. Ff. 1-22; 1-58; 1-12; and 
1-81. Copied on 5 suklapak§a of Karttika in Saka 
1783 = ca. 7 November 1861. Incomplete (pari¬ 
cchedas 1-3). No author mentioned. 

Benares (1956) 12354. Ff. 1-21 and 21b-32. Copied 
in Sam. 1943 = a.d. 1886. Incomplete (asau- 
canirnaya). No author mentioned. 

AS Bengal III.E.31. Incomplete (pariccheda 1). 

Jaipur (Khasmohor) 1697. 

Mysore ORI C.3856/1. Ff. 1-8. (anukramanika). 

Mysore ORI P.5898/2. Ff. 1-9; and 1-179. Nandina¬ 
gari. (Dharmasindhu). Incomplete (to agnyadha- 
naprayascitta). No author mentioned. 

NPS (Sanskrit) 8887. 8Iff. Incomplete (paricchedas 
1 - 2 ). 

RORI Cat. VII 26557. 47ff. Incomplete (pariccheda 
3; incomplete). 

VSM (Upadhye) 12156. 407ff. Copied by Hari 
Govinda Navathye. 

VSM (Upadhye) 12207. 68ff. Copied by Govinda 
Hari Navathye. Incomplete (paricchedas 1-2). 

The edition of the Dharmasindhusdra published 

at Bombay in 1907 was reprinted as SGDOS 14, 


42 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Delhi 1986. See for this author also U. R. Bhise [A5. 
1977/78]. 


*KASIRAMA VACASPATI BHATTACARYA (fl. ca. 
1650/1700) 

Additional manuscripts of his Tithitattvatika 
(see CESS A 2, 45a, and A 4, 56a): 

AS Bengal I.D.3. Bengali. 

Varendra 372. Ff. 1-12. Bengali. Incomplete. 

Additional manuscripts of his Malamasatattva- 
{ika (see CESS A 2, 45a-45b): 

*Calcutta Sanskrit College (Smrti) 105. 90ff. Ben¬ 
gali. Copied in Saka 1756 = a.d. 1834. 

AS Bengal I.D.3. Bengali. 

Manuscripts of his Udvahatattvatlka (see CESS 
A 4, 56a-56b): 

Benares (1956) 14212. Ff. 1-14. Bengali. 

Calcutta University 108. Ff. 1-15. Bengali. 

Mitra, Not. 1144. 15ff. Bengali. Property of Pra- 
sannakumara Vidyaratna of Navadvipa. 

Mitra, Not. 2117. 95ff. Bengali. Property of Pandita 
Madhusudana Nyayaratna of Majida, Ranaghafa. 

Manuscripts of his SuddhitattvaCika (see CESS 
A 4, 56b): 

lO 1415 (637c). 107ff. Bengali. Copied in Saka 1728 
= A.D. 1806. From H. T. Colebrooke. 

Calcutta Sanskrit College (Smrti) 377. 130ff. Ben¬ 
gali. Copied in Saka 1749 = a.d. 1827. 

AS Bengal I.D.3. Bengali. 

Calcutta Sanskrit College (Smrti) 376. 138ff. Ben¬ 
gali. 

Dacca 2006 E. See NCC, vol. 4, p. 140. 

Manuscripts of his Srdddhatattvafikd (see CESS 
A 4,56b): 

lO 1436 (817). 134ff. Bengali. Copied in Saka 1728 
= A.D. 1806. From H. T. Colebrooke. 

Oxford 705 (Wilson 35b). Ff. 143-288. Bengali. 
Copied on 4 Magha of Saka 1734 = ca. 4 Febru¬ 
ary 1813. 

Calcutta Sanskrit College (Smrti) 452. 133ff. Ben¬ 
gali. Copied on Thursday 22 VI in Saka 1747 = 
6 October 1825. 

Calcutta University 102. Ff. 1-118. Bengali. Copied 


in Saka 1749 = a.d. 1827. 

AS Bengal I.D.3. Bengali. 

Sastri, Not. 1904. 226. 39ff. Bengali. Property of 
Pandita Guruprasanna Vidyaratna of Amarapura, 
Radhanagara, Medinipura District. 

The first verse is: 

natva guros caranapadmarajamsi murddhna 
srikantakantacaranarn ca nidhaya citte / 
srikasiramasukrti krtinam hitaya 
susraddhatattvavivrtirn vitanoti yatnM // 

Kasirama also wrote a fippani on Raghu- 
nandana’s Ekddasitattva. Manuscript: 

Mitra, Not. 1145. 47ff. Bengali. Property of Pra- 
sannakumara Vidyaratna of Navadvipa. 

And he wrote a fika on the same author’s Jan- 
md^amitattva. Manuscript: 

lO 1421 (707 A). 103ff. Bengali. Second of three 
works. From H. T. Colebrooke. 

And he wrote a tippani on the same author’s 
Ddyatattva. Manuscripts: 

Calcutta Sanskrit College (Smrti) 151. 26ff. Bengali. 
Calcutta Sanskrit College (Smrti) 152. 50ff. Bengali. 
lO 1412 (386b). 34ff.; and If. Bengali. With an anu- 
kramanika. From H. T. Colebrooke. 

Mitra, Not. 1143. 14ff. Bengali. Property of Pra- 
sannakumara Vidyaratna of Navadvipa. 

And on the Durgotsavatattva. Manuscript: 

lO 1421 (707 A). 103ff. Bengali. Last of three 
works. From H. T. Colebrooke. 

And on the Prdyascittatattva. Manuscript: 

lO 1418 (633b). 78ff. Bengali. From H. T. Cole¬ 
brooke. 


^KASIRAMA PATHAKA (fl. 1899/1909) 

His tika on adhyayas I-II of Jaimini’s Upadesa- 
sutra (see CESS A 2, 45b; A 3, 21b; and A 4, 56b) 
was reprinted at Bambai in 1987. Kasirama finished 
a Hindi tika on a Gargajataka on Thursday 5 
kr§napak§a of A§adha in Sarn. 1966, Saka 1831 = 8 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


43 


July 1909; this was published at Kalyana-Mumbai in 
1987, His Hindi tika on the Bhuvanadlpaka of 
Padmaprabha Suri was also published at Kalyana- 
Mumbai in 1987. 

^KIRTIKARA 

Additional information concerning a manuscript 
of his Jyotihsarasdgara (see CESS A 2, 46a): 

RORI (Alwar) 2931 = *Alwar 1778. 90ff. Copied by 
Madhava in Sam. 1910 = a.d. 1853. 

KIRTIMALLA (fl. 1804) 

Author of a stabaka in Rajasthani on the ^atpah- 
cdsikd of Prthuyasas {fl. ca. 575). Manuscript: 

RORI Cat. IV 20250. 12ff. Copied by Kirtimalla in 
Sam. 1861 = a.d. 1804. 

KUCANACARYA 

Author of a Grahacakra following the Surya- 
siddhdnta. Manuscripts: 

Bhubaneswar IV 31 (Jy/2b). 12ff. Oriya. Incomplete. 

From Sakhigopal, Puri District, 

Bhubaneswar IV 32 (Jy/3c). 44ff. Oriya. With the 
Oriya translation of Maguni Pathin. From Puri. 
Bhubaneswar IV 33 (Jy/20c). 15ff. Oriya. Incom¬ 
plete. From Parlakhemindi, Ganjam District. 
Bhubaneswar IV 34 (no shelf-mark given). 12ff. 

Oriya. Incomplete. From Ranapur, Puri District. 
Bhubaneswar IV 35 (<Jy/>31b). 8ff. Oriya. Incom¬ 
plete (to adhyaya 5). No author mentioned. From 
Baripada, Mayurbhanja District. 

KUNJAVANA PAJJANAYAKA 

Author of a Sisubodhaganita. Manuscript: 
Bhubaneswar 2.G/92. 


^KUMARA SURI 

Additional manuscripts of his Jyoti^asdravail 
(see CESS A 2, 46b): 


Mysore ORI *P.4704/a. Ff. 1-96. Telugu. Copied by 
Bhujahgaraya on Thursday 4 suklapak§a of Bha- 
drapada in a Krodhisamvatsara. 

GOME Madras D. 19483, 20ff. Telugu. With an 
Andhratika. 

The colophon begins: iti srimatkumarasuri- 
viracitayam, 

KULAMANI MISRA SARM AN (fl. 1982) 

Author of a tika, Tejanyd, on the Kdladlpa of 
Divyasirnha Mahapatra (fl. ca. 1640/1680), published 
at Puri in 1982. 


KULAMANDANA SURI 

Author of a fika on the Lokanalikd of Dharma- 
gho$a (d. 1300?). Manuscripts: 

EDI (KS) 517 (10433). 2ff. Copied in Sam. 1492 = 
A.D. 1435. (mula ascribed to Kulamandana, ava- 
curi to Jhanasagara). 

Pattan II 11009. 5ff. 

Pattan II 11010. 2ff. 

Pattan II 11011. If. 


KUSALARANGA 

Author of a K^etrasamasa\ this may be the 
Laghuk^etrasamasa of Ratnasekhara Suri (fl. 
1370/1390), on which also a Megharaja wrote a sta¬ 
baka. Manuscript: 

RORI Cat. VI 23938. 40ff. Copied by Candradatta at 
Satruhjayatirtha in Sarn. 1892 = a.d. 1835. With 
the stabaka of Megharaja. 

*AL-KUSHJI (AL-QUSHJI), ^ALA AL-DIN ""aLI 
IBM MUHAMMAD (d. 15 December 1474) 

Additional manuscript of the Sanskrit translation, 
Hayatagrantha, of his Risdlat dar hay’at (see CESS A 
4, 57a-57b): 

Calcutta Sanskrit College 184. 63ff. Copied in Sarn. 
1863 = A.D. 1806. 


44 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*KRPARAMA 

The son of Yamesvara, Krparama, also known as 
Devakinandana (not identical with the Deva- 
kinandana who wrote a Krpapaddhati in 1814 
[CESS A 3, 118a] or the Kriyapaddhati in 1815 
[CESS A 4, 113a]), wrote a Krpasindhu (see CESS A 
4, 57b). Additional manuscript: 

RORI Cat. VI 24387. 37ff. Copied by Anandacanda 
R§i at Seragadha in Sarn. 1838 = a.d. 1781. 
Incomplete (prasnatantra). 

KRPARAMA 

Author of a Hindi version of the Laghujdtaka of 
Varahamihira (/?. ca. 550). Manuscript: 

Nagaur 1040. Off. 


* KRPARAMA (/?. 1715) 

Additional manuscript of his Samayabodha (see 
CESS A 3, 22a): 

Poleman 5961 (Harvard 2249). Ff. 1-11 and <12>. 
Copied on Tuesday 13 suklapak§a of Phalguna in 
Sam. 1875 = 9 March 1819. Ascribed to Krapa- 
larama. 


^KRPARAMA {ft. 1735) 

Additional manuscripts of his Jyotisasara (see 
CESS A 2, 47b-48a, and A 3, 22a): 

Pattan II 13271. 24ff. Copied in Sam. 1813 = a.d. 
1756. 

Nagaur 987. 20ff. Copied on 14 kr§napak§a of Mar- 
gasir§a in Sam. 1885 = ca. 3 January 1829. 

*KRPARAMA MISRA {fl. 1792) 

1. Additional manuscripts of his Balabodhint (see 
CESS A 2, 48b; A 3, 22a; and A 4, 57b-58a): 

RORI (Alwar) 2596 = *Alwar 1869. 171ff. Copied 
in Sam. 1912 = a.d. 1855. 

GJRI 11183/44. Ff. 18-82. Maithili. Incomplete. 
Oxford CSS I 120 (*d. 777(1)). Ff. 1-17, 17b-24, 
and 45. Incomplete (1-36 and 106-108). 


Varendra 481. Ff. 1-46. 

Varendra 710. Ff. 1-93. 

2. Additional manuscripts of his Ltldvadtlka (see 
CESS A 2, 49a): 

GJRI 9210/38. Ff. 1-130. Maithili. Copied in Saka 
1782 = A.D. 1860. 

AS Bengal III.F.llO (A). 

RORI Cat. IV 20759. 43ff. Incomplete. 

^KRPALU LOKAMANI (fl. 1652) 

The son of Uddhava, the son of Dayalu, the son 
of Cudamani, a Brahmana residing in Devagrama, 
Krpalu, a pupil of Manirama, wrote his Muhuna- 
ratndvali in Saka 1574 = a.d. 1652 (not 1672 as 
reported in CESS A 2, 49a). Additional information 
concerning a manuscript: 

WHMRL a 812 = * WHMRL M.12.j. Ff. 1-27. 
Copied on Saturday 12 suklapak§a of Jye§tha in 
Sam. 1849 = 2 June 1792. 

Verses 58-59 of the misraprakarana are: 

devagramavare ’vasad dvijavaras cudamanis tatsuto 
namnah sarthakaro dayalur iti yas tatsunur apy 
uddhavah / 

khyatas tasya suto hi lokamanir ity akhyah krpaluh 
sa vai 

janakyas caranaprasadata imarn ratnavalim cakarot 

//58// 

maniramarn gurum natva sake ’bdhyadritithiprame / 
sodhyatarn pathyatarn tv etat ksamyatarn mama 
sahasam //59// 

The colophon begins: ity uddhavasutakrpalu- 
viracitayarn. 

^KRPASANKARA (fl. 1767) 

Krpasahkara’s father, Chajurama, was the son of 
Devakr§na Dvivedin of the Bhargava gotra and the 
Sahasraudicya jhati; Krpasahkara finished his Jyo- 
ti^kedara at Kota in Malavadesa on the eastern bank 
of the Carmanvati on Wednesday 6 suklapak§a of 
Magha in Sarn. 1823, Saka 1688 = 4 February 1767 
during the reign of the Maharava Gumanasirnha. 
There is something incorrect, then, in the report of 
the apparently earliest manuscript, BORI 913 of 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


45 


1886/92, on which the date given in CESS A 2, 
49b-50a, was based; perhaps one should read in that 
manuscript’s date-formula Saka 1773 = a.d. 1851 
rather than Sarn. 1773 = a.d. 1716, and ascribe its 
fika to a Cirahjiva BhaUa other than the one who 
wrote in 1647 (CESS A 3, 51a-51b). Additional 
manuscripts of the Jyoti^kedara: 

BHU C.643. 23ff. Copied in Sam. 1876 = a.d. 1819. 
With a tika. Incomplete. 

Jaipur (Khasmohor) 5501. (sarnhitavali) = *Jaipur 
(II). 6ff. 

New Delhi, H. B. Lall 11. 48ff. No author men¬ 
tioned. 

RORI Cat. XVI 36849. 28ff. (Jyoti^akeddrapuspo- 
ccaya\ said to have been composed in Saka 1835 
= A.D. 1913!). 

RORI (Alwar) 2930 = Alwar 1789. 52ff. (prasna). 

The pancaiigaganita, which is pallava 2 of the 
ganitavalli, was edited with his own Hindi tika by 
Sivaprakasa Dvivedin, Mathura Sarn. 1998 = a.d. 
1941. 

Verses 78-81 of prasnavalli 2 are: 

sake ’§tavasvahgasasimite ca 
tridvyastacandre nrpavikramabde / 
saumyayane ’rke kila maghamase 
suklacchade saumyadine ca §asthyam //78// 
srimanmaharavagumanasirnha- 
rajye tatha malavake ca dese / 
carmanvatipurvatatasthite ca 
kotabhidhane nagare visale 111911 
sahasraudicyajatiyo dvivedity avatahkakah / 
bhargavo devakr§no ’bhuc chajuramas ca tatsutah 
//80// 

tatsununa krto granthah krpasaiikarasarmana / 
balanarn sukhabodhaya sve§tadevarpanarn subham 

//81// 


KRPASANKARA AVASTHI {fl. 1979) 

A resident of Haradoi, Krpasahkara wrote a 
Tisard netra: j'yotisa, which was published at Hara¬ 
doi in 1979. 


KRPASINDHU NAY AKA 

Author of one or several works on mathematics. 
Manuscripts: 


Bhubaneswar 2.G/85. (Ganita). 

Bhubaneswar 2.G/50 = Bhubaneswar IV ganita 49 
(G/50). 84ff. (Mdganasindhukallola\ in collabora¬ 
tion with Dharanidhara). Incomplete. From 
Khurdha, Puri District. 

Bhubaneswar 2.G/6 = Bhubaneswar IV ganita 63 
(G/6). 195ff. Oriya. Copied by Bhagavana 

Mahanti on Thursday 12 kr§napak§a of A§adha 
in ahka 54 of Virakesarideva = 29 June 1780. 
(Sutrasdra; in collaboration with others). From 
Puri. 

Bhubaneswar 2.G/90. (Sutrasdra). 


krsna 

Author of a Kdlanirnaya. Manuscript: 

Bhubaneswar IV 16 (Jy/43b). 24ff. Oriya. Incom¬ 
plete. From Ranapur, Puri District. 

The colophon begins: iti srikr^nadaivajhaviracite. 


^'KRSNA 

For the author of the Kr^riavinodasdrani (see 
CESS A 2, 50a, and A 4, 58a), see now Kr^narama 
ifl. ca. 1730). 


^krsna 

His Krsniya (see CESS A 2, 50a-51a, and A 4, 
58a) was also edited by Puliyur P. S. Puru^ottaman 
Nambudiri with his own Malayalam tika, Daivajha- 
vallabha, at Trivandrum in 1961, and with Vi^nu’s 
Caturasundarl by V. G. Namboodiri as TSS 243, Tri¬ 
vandrum 1976, utilizing 23 manuscripts and the 
1961 edition. This Kr^na may be identical with 
Kr§na Sastrin, the author of a Hordsdstra or Jdtaka- 
krsniya. Additional manuscripts of the Krsniya: 

Kerala — (16061 F). Grantha. Copied in ME 965 = 
A.D. 1790. Formerly property of the Manalikka- 
ra Matom. See TSS ed., p. xi. 

Kerala — (17092 B). Malayalam. Copied in ME 
1051 = A.D. 1876. Formerly property of the 
Ezhunjoli Matom, Cheriyanatu. See TSS ed., pp. 
x-xi. 

*Kerala 4191 (C.1635 B). 65ff. Incomplete (ends 
with 2, 11). 


46 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*Kerala 4187 (399). 450 granthas. Incomplete (ends 
with 31, 1). Formerly property of the Nareri 
Mana or of the Kutallur Mana. 

*Kerala 4188 (C.1450 C). 450 granthas. Copied by 
Kr§na on Wednesday 3 kr§napak§a of Asvina in 
a Saumyasarnvatsara. 

*Kerala 4189 (4163). 2000 granthas. Incomplete 
(ends with 31, 1). Formerly property of Sahkaran 
Sahkaran Nambudiri of the TamarakkaUu Illam. 

*Kerala 4192 (527 A). 1700 granthas. Incomplete 
(begins with 1, 34). Formerly property of the 
Kutallur Mana. 

*Kerala 4193 (10757). 1800 granthas. Incomplete (1, 
10-14, 18). Formerly property of Narayanan 
NambQdirippad of the Kahjirappilly Illam, Katuk- 
kur, Thirumarati Pakuthi, Muvattupuzha. 

Kerala — (15464 A). Incomplete (ends with 3, 2). 
See TSS ed., p. xii. 

Kerala — (15484). Malayalam. Copied by Narayana 
Malika. See TSS ed., p. xi. 

Kerala — (15502 A). Incomplete (5, 1-31, 1). See 
TSS ed., p. xii. 

Kerala — (16781). Formerly property of the KiH- 

manur Palace. See TSS ed., p. x. 

Kerala — (17541). Malayalam. See TSS ed., p. xii. 

Kerala — (18451 E). Malayalam. Copied by Kr§na 
Dvija on Sunday 2 suklapak^a of Magha in a 
Saumyasarnvatsara. Formerly property of M. V. 
Saiikara Sarman of the Matigalappilly Illam, 
Aranmula. See TSS ed., pp. ix-x. 

Kerala — (18469 A). Malayalam. Incomplete (ends 
with 2, 11). Formerly property of M. V. Saiikara 
Sarman of the Maiigalappilly Illam, Aranmula. 
See TSS ed., p. xii. 

Kerala — (22464 B). Malayalam. Formerly property 
of Marumakan Thampuran, Puthan Kovilakam, 
Kotungallur. See TSS ed., p. x. 

Kerala — (L.1106 B). Malayalam. Formerly prop¬ 
erty of Jyotsyan Isvara Warrier of Tekke Variam, 
Irihjalakkuda. See TSS ed., p. vi. 

PrSB 2941 (Berlin or. 6323). Ff. 107v-108v. Gran- 
tha. Incomplete (adhyaya 6). 

Sucindram, Vattappilly Matam. Malayalam. Incom¬ 
plete (ends with 27, 20). See TSS ed., p. vii. 


*KRSNA 

Additional manuscript of his Tajikatilaka (see 
CESS A 2, 51a): 

RORI Cat. Ill 14627. 18ff. Copied by Gadadhara, 
the son of Nabhaji, a vaisya residing in Ahima- 
dabada, for his older brother, Sribaliraja Mant- 


rin, at Bhrgukaccha on a Monday in the sukla- 
pak§a of Pau§a in Sarn. 1601 = 15 or 22 
December 1544. 

Additional manuscript of his Trimsadyogavali 
(see CESS A 2, 51a, and A 3, 22a): 

Mysore (1905) 967. Ff. 33-39. Grantha. (Yogdvall 
of Kr§na Misra). 

KR^NA 

Author of a DarsMikalanirnaya. Manuscript: 
Benares (1956) 13566. Ff. 1-29. 

^KRS^A 

Additional manuscript of his Nirnayamala (see 
CESS A 4, 58b): 

Mysore ORI C.1028. Ff. 1-43. Copied by Rama. 

^KR^NA or KRSNANANDA 

Additional manuscript of his fika, Prabha, on 
Srinivasa’s Suddhidlpika (see CESS A 2, 51b, and 
A 3, 22a): 

AS Bengal I.A.64. Bengali. 

krsna 

Author of a Vyavaharapradlpa. Manuscript: 

BHU C.2202. 6ff. 

KAUSIKEYA KR^NA 

Author of a tika, Pradipa, on Hiranyakesin’s 
Sulbasutra. Manuscript: 

AS Bengal I 2. 710 = IM Calcutta 2150. Ff. 1-22. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


47 


KR^NA JADE (JADYA) 

The son of Bhaskara Jade, Kr§na wrote a fika, 
Padminl, on the Kunddrka of Saiikara Bhatfa. 
Manuscripts: 

IM Calcutta 5816. See NCC, vol. 4, p. 189. 

Oxford CSS d. 637 (10). Ff. 1-12, 12b-15, and 
17-23. Incomplete (last f. missing). 

The first two verses are: 

srimadabhimanini devataprasadat siddhir astu // 
natva parasivabhinnarn gururn ramesvarabhidham // 
ganaparn tripurambarn ca bhikdevam apararn 
gurum // 

karoti jadyakr^nakhyah kundarkapriyapadminim // 


KR$NA DlK^ITA SURI 

Author of a Prayogacandrikd. Manuscripts: 

RORI (Udaipur) 3540. 179ff. Incomplete. 

RORI (Udaipur) 3854. 32ff. Incomplete (navagraha- 
makhaprayoga). 


KR^NA PADHIARl 

Author of a Ganita. Manuscript: 
Bhubaneswar 2.G/57. 


*KRSNA BHATTA 

Additional information concerning manuscripts 
of his Kdlacandrikd (see CESS A 2, 52a; A 3, 22b; 
and A 4, 58b): 

*BORI 94 of 1884/86 = BORI (Dharma) 246. 34ff. 
*BORI 342 of 1891/95 = BORI (Dharma) 247. 24ff. 
Incomplete. 

KR^NA MANGARAJA 

Collaborator in an Oriya translation of Bhaska- 
ra’s Lildvatt. Manuscript: 

Bhubaneswar IV ganita 52 (G/5). 123ff. Oriya. From 
Puri. 


KR^NA MISRA 

Author of a Nak^atraciiddmaiji. Bhubaneswar IV, 
p. XLIII, suggests that he is identical with Kr§na- 
misra (fl. ca 1750/1800). Manuscript: 

Bhubaneswar IV 90 (Jy/83). 21ff. Oriya. From Chi- 
kiti, Ganjam District. 

The colophon begins: iti srikr$namisrakrtau. 
KR^NA VAISYA 

Author of a Nalasdgara. Manuscript: 

Bhubaneswar 2.G/32 = Bhubaneswar IV ganita 38 
(G/32). 135ff. Oriya. Copied by Devidasa. With 
the Nalasdgara of Balabhadra. From Puri. 


KRSNA YAJVAN 

Author of a Karmaprakdsa. Manuscript: 

Mysore ORI P.4994. Ff. 1-198. Kannada. Incom¬ 
plete (ends with du^karmaniratatyaga). 

KR^NA SASTRIN 

Author of a Hordsdstra = Jdtakakrsnlya. He 
may be identical with Kr§na, the author of the 
Krsniya. Manuscripts: 

Mysore (1905) 753. 70pp. 

Mysore ORI B.961. Ff. 1-43. Telugu. 

Mysore ORI P.3162/2. Ff. 9-73. Grantha. 

Mysore ORI P.4433. Ff. 5-66. Telugu. Incomplete. 
Mysore ORI P.7400/2. If. Grantha. Incomplete. 


*KR$NA BHATTA (fl. ca. 1400/1450) 

Additional information concerning manuscripts 
of his Karmatattvapradlpikd (see CESS A 4, 
58b-59a): 

*BORI 220 of 1879/80 = BORI (Dharma) 225. 63ff. 
Copied on Sunday 14 suklapaksa of Caitra in 
Sam. 1728 = 31 March 1672. 

*BORI 97 of 1871/72 = BORI (Dharma) 224. 118ff. 
(ff. 9-10 and 117-124 missing; f. 109 blank). 


48 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*KR$NA (fl. ca. 1475?) 

The BORI manuscript of his Samhitasara (see 
CESS A 2, 52b) is 876 (not 687) of 1884/87. 


^KR^NA CAKRAVARTIN {fl. ca. 1550) 

1. Additional manuscripts of his Jyoti^kanika (see 

CESS A 2, 52b, and A 4, 59a): 

*Varendra 821. Ff. 1-30. Bengali. Copied by Jaya- 
kr§na Sarman in Saka 1697 = A.D. 1775. Incom¬ 
plete (paricchedas 1-3). 

*Varendra 814. Ff. 1-11. Bengali. Incomplete. 

2. Additional manuscripts of his Jyotihsiitra (see 

CESS A 2, 53a, and A 4, 59b): 

GJRI 8421/646. Ff. 1-18. Maithili. Copied in Saka 
1726 = A.D. 1804. 

GJRI 8422/647. Ff. 1-23; and If. Maithili. 

GJRI 8423/648. Ff. 1-4. Maithili. Incomplete. 

Varendra 220. Ff. 1-19. Bengali. Copied by Lak§- 
mana Sarman. 

Varendra 711. Ff. 1-16. Bengali. 

Vrndavana 2180. 24ff. Bengali. 


KR^NA {fl. 1584) 

The younger brother of Mohana and the son of 
isvara, the younger brother of Harivarnsa and the 
son of Siromani Caturveda, Kr§na, the pupil of 
Divakara, wrote a fika on the Suryasiddhanta in 
which he uses examples dated Wednesday 30 kr§na- 
pak§a of A^adha in Sam. 1639, Saka 1504 = 18 July 
1582 (solar eclipse), Tuesday 30 kr§napak§a of Vai- 
sakha in <Saka 1506 > = 31 March 1584, Sunday 6 
suklapak^a of Vaisakha in Saka 1506 = 5 April 
1584, and Saturday 14 suklapak§a of Karttika in 
Sarn. 1641, Saka 1506 = 7 November 1584 (lunar 
eclipse). He made his computations for Kasi. Manu¬ 
scripts: 

RORI Cat. XVI 37269. 68ff. Copied in Sarn. 1797 = 
A.D. 1740. 

Benares (1963) 35779. 68ff. Copied in Sarn. 1819 = 
A.D. 1762. Incomplete (ends with patadhikara). 
Paris BN 957 (Sans. Bengali 189) V = Guerin 32. 

Bengali. Copied in A.D. 1840. Incomplete. 

BORI 602 of 1895/1902. Ff. 1-33 and 35-53. Incom¬ 
plete (ends in the tika on 7, 8-12). 


Verses 1-4 are: 

pranamya jagadadhararn niradhararn ca nirgunam / 
sagunarn kr§nam akr§narn kr§no vyakhyati 
suryoktim //I// 

yah papatha caturvedarn caturvedah siromanih / 
tasya putrau samakhyatau harivarnsesvarabhidhau 

HIH 

tatra sri isvarakhyah prabhavati satam agrani 
labdhavidyo 

bhupanarp pritipatro nirupadhigunair jyoti§aih 
sastragunyaih / 

tatputro mohanakhyah prabhavati sabhadarpano 
nyayavetta 

jeta praudhoktikanarn tadanuja aham kr^nasamjno 
dvitiyah //3// 

srimaddivakaraguror mukhapahkajasrir 
labdha subodhanikarais tu maya krteyam / 
sricolalallanarasirnhadivakaranarn 
granthan vilokya vitata matir asmadiya //4// 

^KRSNA {fl. ca. 1600/1625) 

1. Additional manuscripts of his Bljdhkura (see 
CESS A 2, 53b-55a, and A 4, 59b; see also P. K. 
Majumdar [A5. 1981b]): 

RORI (Udaipur) 3447. 113ff. Copied by Udayarama 
Brahmana in Sam. 1838 = A.D. 1781. Ascribed to 
Sankara Bhatta. 

Oxford CSS I 113 (*d. 802 (4)). Ff. 1-48, 108-112, 
and 112b-138. Copied on Sunday 11 kr§napak§a 
of Magha in Sarn. 1847 = 1 January 1791. 
Incomplete (1-48 and 139-end). 

Jodhpur 850. 122ff. Copied in Sam. 1889 = a.d. 
1832. 

RORI (Alwar) 2595. 201ff. Copied in Sam. 1912 = 
A.D. 1855. 

RORI (Alwar) 2600. 129ff. Copied in Sarn. 1912 = 
A.D. 1855. 

AS Bengal I.B.3. Bengali. 

Mysore ORI *A.300. Ff. 1-114. Kannac^a. 

Mysore ORI *P.141. Ff. 1-99. Telugu. 

Mysore ORI *P.2334/1. Ff. 1-65. Kannada. Incom¬ 
plete (to kuttaka). 

Mysore ORI *P.4431/2. Ff. 1-83. Nandinagari. 
Oxford CSS I 118 (*d. 787 (2)). Ff. 1-37. Incom¬ 
plete (10-134). 

Paris BN Sans. 1780e. Part of a manuscript of 226ff. 
Grantha. 

RORI Cat. IV 20627. 308ff. (ff. 1-8 missing). 
Incomplete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


49 


RORI Cat. IX 28608. 124ff. (ff. 49, 50, and 73 
repeated). Incomplete. 

RORI (Alwar) 2602. 60ff. Incomplete. 

2. Additional manuscripts of his Jatakapaddhaty- 
udaharana (see CESS A 2, 55a-55b, and A 4, 
59b-60aj; 

Jaipur (Khasmohor) 5442. Copied in Sarn. 1789 = 
A.D. 1732. 

Pattan II 14002. 69ff. Copied in Sarn. 1802 = a.d. 
1745. 

RORI Cat. VI 24132. 57ff. Copied by Gaiiapati- 
vijaya, the pupil of Devendravijaya Gaiii, the 
pupil of Amrtavijaya Gaiii of the Tapagaccha, at 
Caturbhasika on Sunday 1 kr§napak§a of Magha 
in Sarn. 1839, Saka 1704 = 19 January 1783. 
RORI Cat. IV 20247. 18ff. Copied by KastQracanda 
at Pali in Sarn. 1873 = a.d. 1816. Incomplete 
(khanikhanajanmalagnodaharatiakrama and catur- 
virnsati balani). 

RORI (Alwar) 2670 = *Alwar 1763. 219ff. Copied 
in Sarn. 1912 = A.D. 1855. 

BHU C.2208. 42ff. Incomplete. 

Jaipur (Khasmohor) 5048. 

Kathmandu (1964) 143 (6541). 13ff. Incomplete. 
Kathmandu (1964) 144 (6545) 19ff. Incomplete. 
Mysore ORI P.5072/2. Ff. 1-100. Telugu. 

Mysore ORI P.5894/2b. Ff. 1-43. Nandinagari. 
Mysore ORI P.7579/1. Ff. 1-55. Nandinagari. 

Mysore ORI P.7771/2. Ff. 99-142. Nandinagari. 

Incomplete (adhyayas 4-8). 

PrSB 2934 (Gottingen, Sanscr. Sham 43). 22ff. 

Incomplete (adhyayas 1-5). 

RORI Cat. IV 19917. 42ff. (ff. 1-5 missing). Incom¬ 
plete. 

RORI Cat. IV 22001. 53ff. (f. 1 missing). 

RORI (Chittorgarh) 4369. 33ff. (ff. 1 and 28-30 
missing). Incomplete. 

3. Kr§iia also wrote the Chddikanirnaya (see CESS 
A 2, 51a, and A 4, 58a). The first verse is: 

guror vi^iiunamnah padambhojayugmarn 
pranamyantarayatadhivrddhikari / 
nisanathaghasresayos chadakasya 
grahe nirtiayarn vaktum iccharn karomi //!// 

The last verse is: 

daivajnavaryagariasantatisevyaparsva- 
ballalasarnjnaganakatmajakr§na evam / 
sa cchadakakhilavicaraniruktibhis tarn 
sarnvadam enam akarod grahariadvayasya //88// 


The colophon begins: iti srisakalagaiiakasarva- 
bhaumaballalagariakatmajakr^riadaivajhaviracitas. 

^KR^NA {fl. 1653) 

Additional manuscript of his Karanakaustubha 
(see CESS A 2, 55b-56a, and A 4, 60a): 

VSM (Upadhye) 12764. 42ff. Copied by Kamalakara 
Jambhekar in Saka 1729 = a.d. 1807. With the 
udaharaiia of Vaidyanatha. 

^KR$NA BHAIYABHATTA (fl. ca. 1660) 

Additional manuscripts of his Sujdnadharmaratna 
(see CESS A 4, 60a-60b): 

AS Bengal III.D.47. (samaya). 

Benares (1956) 13998. Ff. 1-171. (sraddha). 

KR^NA SASTRIN (fl. ca. 1850/1860) 

Assistant to Rajivalocana Ojha in writing the 
Dharmacandrodaya for Ramasirnha II, Maharaja of 
Jayapura. 

KR^NA (fl. 1872) 

Author of a sue I to the Jayasimhakalpadruma of 
Ratnakara (fl. 1713). which he finished on Friday 
ama of Asvina in Saka 1793 = 1 November 1872. 
Manuscript: 

Jaipur (Dharma) 614. 20ff. Copied by Ganesa in 
Sarn. 1928 = a.d. 1872. 

The last verse is: 

tryahkar§indumite sake i§e ’mayarn bhrgau krta / 
kr§nena suci kalpadror ganesena vyalekhi sa // 

KR$NAGOVINDA 

Author of a Dharmasindhusdrdhnika\ its relation¬ 
ship to the Dharmasindhusdra of Kasinatha Upadh 
yaya (d. 1805) is not clear. Manuscript: 


50 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. IV 20809. 34ff. (ff. 14-20 missing). Cop¬ 
ied in Sam. 1922 = a.d. 1865. 


KR^NACANDRA 

Author of a Jatakamodacandrika. Manuscripts: 

Oxford CSS I 303 (d.. 924 (10)) A I. Ff. 1-2. Ben¬ 
gali. Incomplete. 

Oxford CSS I 304 (d.. 924 (10)) B I. Ff. 1-10. Ben¬ 
gali. Incomplete (adhyaya 13). 

The first verse is: 

ya sr§tisthitinasini trijagatarn yarn cintayan va 
muda- 

cintyam dhiramunindravaryanivaho nirvanamuktim 
yayau / 

tarn samnamya sumuktidananipunarn sajjatakanam 
imam 

amodadimacandrikam vitanute srikr^nacandro 
dvijah // 


KR^NACANDRA 

Author of a Vratavivekabhdskarodaya. Manu¬ 
scripts: 

Benares (1956) 13955. Ff. 1-9. 

PL, Buhler III E 330. lOff. Property of Balakrsna 
Josi of Ahamadabada. 


KR$NACARANA 

Author of a part of a Ganita in Oriya. Manu¬ 
script: 

Bhubaneswar IV ganita 14 (G/12). 183ff. Oriya. 
Copied in Sal. San 1289, ahka 21 of Divyasirnha- 
deva = A.D. 1881. From Puri. 


*KR$NADATTA JHA {fl. 1904) 

The date of this author’s fika, Subodhinl, on 
Prajapatidasa’s Pahcasvardnirnaya (see CESS A 3, 
23a) is not Saka 1726, but Saka 1826 = a.d. 1904; 
in his comment on 1, 62 he gives an udaharana for 
Sarn. 1936, Saka 1801 = a.d. 1879, when there 
occurred kasyacij janma—perhaps his own. The 
Subodhinl was published with the mula at Kasi in 


Sarn. 1961, Saka 1826 = a.d. 1904. At the end are 
these four verses concerning Kr§nadatta: 

sribhainatho ’jani vidvari§thas 
tajjye§thaputro vavue pafi^thah / 
nenabhidhanah kila tatkani^fhas 
tatpr§thajato nijadharmani§thah //!// 
kailusamakhyo ’sya ca pr^thajanma 
mukundamurtis tu mukundanama / 
jye§thMmajadyo viditaikanama 
sonesamakhyah sukrtaikadhama II2II 
tasyanujah sriyutanandalalah 
svavikramenakhilalokalalah / 
tatpr§thajah praptasutantrajalah 
sriladinathad varajah susilah //3// 
sfikr§nadatto ’krta vai visuddharn 
subodhinim satsvarasastrajatam / 
rasasvinagendusake ’bjajate 
pau§e ’tithav isapure ’valak§e //4// 

KR^NADASA 

Author of a part of a Ganita in Oriya. Manu¬ 
script: 

Bhubaneswar IV ganita 29 (G/55). 149ff. Oriya. 

Incomplete. From Turintra, P. S. Balianta, Puri 

District. 


krsnadasa 

Author of a Mdghamdhatmya in Oriya in 36 adh- 
yayas. Manuscripts: 

PrSB 2511 (Tubingen, Ma I 760). 152ff. Oriya. Cop¬ 
ied on Tuesday 1 kr§napak§a of A§adha in ahka 
41 of Ramacandradeva = 25 June 1850. 
lO (Oriya) 1924. 

PrSB 2510 (Tubingen, Ma I 655). 178ff. Oriya. 
*KRSbiADASA BHATA 

Additional information concerning the manu¬ 
script of his Prasnottarajhdnabhdskara (see CESS A 
4, 61a): 

Oxford CSS I 94 (*e. 143 (6) C). Ff. <6> and 
7-16. Incomplete (ganitatantra 1, 15-3, 32). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


51 


*VIHARI KR^NADASA (fl. ca. 1575) 

Additional manuscripts of his Paraslprakasa 
(see CESS A 2, 57a-57b, and A 4, 61b): 

AS Bengal 4622 (G.496) = *Mitra, Not. 1321. 12ff. 
(f. 12 missing). Copied by Bhagavana Misra on 
Friday 8 suklapak^a of Sravana in Sam. 1666 = 
27 July 1609. 

Jaipur (Khasmohor) 334. Copied by Bhikhari Tri- 
pajhin on 2 kr§napak§a of Karttika in Sam. 1705 
= ca. 23 October 1648. 

RORI Cat. IX 28478. 12ff. Copied in Sam. 1716 = 
A.D. 1659. 

AS Bengal 4622 A (G.8287). 24ff. Copied at 
Lak§minagara on 3 suklapak§a of Margasir^a in 
Sam. 1792 = ca. 6 November 1735. 

Baroda 3971. 17ff. Copied in Sarn. 1939 = a.d. 
1882. 

RORI Cat. IX 28486. 19ff. Copied in Sam. 1957 = 
A.D. 1900. 

Jaipur (Khasmohor) 7274; and 7318. 

PUL II 1581. 12ff. (Paraslsahgraha). Incomplete (to 
vaisyavarga). 

KR^NADEVA 

Author of a Maunjlpatala in 148 verses, which 
is a cento of verses derived from various sources. 
The authors mentioned are: Atri, Kasyapa, Garga, 
Narada, Parasara, Badarayana, Brhaspati, Bhara- 
dvaja, Bhrgu, Manu, Mahesvara, Mandavya, Yavana, 
Lalla, Vasistha, Vi§nugupta, Vaidyanatha, Vyasa, 
Sariigadhara, Saunaka, Sripati, and Satya. Kr§nade- 
va’s Maunjlpa(ala was edited by Kr§nasahkara Ke- 
savarama Raikva in his Maunjlpafala, Surata Saka 
1858, Sam. 1993 = a.d. 1936, pp. 1-20. 

^KR^NABHAJTA ARDE (fl. ca. 1750/1825) 

Additional manuscripts of his Nimayasindhu{ika 
(see CESS A 4, 62b-63a): 

AS Bengal I.D.6. 

Oppert II 8045. (Nirnayasindhudipika). Ascribed to 
Kr§nasrami. Property of Raghubhaffa in Bhat- 
tugosvamivattara, Tanjore District. 

RORI Cat. XVI 36704. 129ff. Ascribed to Kr§na 
Sarman. 


KR^NAMANI TRIPATHIN (fl. 1975) 

Author of a Hindi translation of the Yugapurana 
from the earliest Gargasatnhita, published as CSG 
16, Varanasi 1975. 


^KR^NAMITRA 

Additional manuscript of his Kalamananda (see 
CESS A 2, 58b; A 3, 23a-23b; and A 4, 63a): 

GJRI 9969/669. Ff. 1-15. Copied in Sam. 1912 = 
A.D. 1855. 


KR^NAMISRA 
See Krsna. 


^KR^NAMISRA 

Additional manuscripts of his Jyotisaphala- 
ratnamald (see CESS A 2, 58b-59a): 

Mysore (1905) 967. 33pp. Grantha. 

Mysore ORI P.3738/1. Ff. 1-30. Telugu. 

Mysore ORI P.6906. 18ff. Telugu. Incomplete (adh- 
yayas 24-27). No author mentioned. 

Mysore ORI P.7442/1. Ff. 5-39. Telugu. Incomplete. 
No author mentioned. 


*KR$NAMISRA 

Additional manuscript of his Muhuna- 
kanfhabharana (see CESS A 2, 59a): 

Mysore (1905) 967. Pp. 40-50. Grantha. 


^KR^NARATHA 

Additional manuscript of his Grahacakravivarana, 
a tika on the Grahacakra of Kucanacarya (see CESS 
A 2, 59b, and A 4, 63a): 

Bhubaneswar IV 139 (Jy/26c). 24ff. Oriya. With the 
Suryendugrahana of Gadadhara Pattanayaka. 
From Ranapur, Puri District. 


52 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The colophon begins: iti srikr§narathaviracite 
samskrtadesabha§ayoh. 

KR^NARAJA 

A king reigning in Mahara§tra on the banks of 
the Godavari, Kr^naraja wrote a Varnasrama- 
dharmadlpa. Manuscripts: 

Bikaner 1050. 405ff. 

PUL II App. 597. llff. Incomplete (kundamandapa- 
kaumudi). 

Near the beginning are the verses: 

sahasrasir§ah puru§ah pura virat 
svayajnato yarn prakaticakara ha / 
so ’yarn caturvedavidam adhisvaro 
grantharn vidhatte kila krsnabhupatih // 
manohari godatatasannidhane 
maharastradesodbhavah kr§narajah / 
mahipalacudamanir grantharajo 
dvijendropakarartham etarn vidhatte // 

*KR$NARAJA WODEYAR (fl. 1799/1868) 

2. Additional manuscripts of his Grahanadarpana 
(see CESS A 2, 59b): 

Mysore ORI B. 1121/6. Ff. 1-94. Copied on Monday 
1 suklapak§a of Caitra in Saka 1765 = 11 April 
1842. 

Mysore ORI A.477/4. Ff. 198-304. Kannada. 

4. Additional manuscripts of his Safikhyaratnakosa 
(see CESS A 2, 59b): 

Mysore ORI *A.477/5. Ff. 305-308. Kannada. 

(Y uga vatsarasahkhyanirnaya ). 

Mysore ORI B.l 121/1. Ff. 1-9. 

Mysore ORI B.l 121/2 and 3. Ff. 9-154. With his 
own vyakhya. 

Mysore ORI B.l 121/4. Ff. 155-167. (anukramani). 
Mysore ORI B.l 121/5. F. 168. (slokanukramani). 
Mysore ORI B.l 121/8. Ff. 96-98 (sic!). (Saka- 
nirnaya). 

The last verse of the Yugavatsarasafikhydnirnaya 
is: 

sricamandakrpapurnah kr^narajendrasekharah / 
kathayamasa suyugasakabhupalavatsaran // 


7. A manuscript of his Graharatnamalikd (see CESS 
A 2, 60a): 

Mysore ORI A.837/3. Ff. 1-36. Kannada. 

The first verse is: 

alokya hemadrimayukhayamala- 
sritattvanidhyadinibandhanany api / 
sahgrhya kr§nak§itipalamaulina 
viracyate ’sau graharatnamalika // 

12. He also wrote a Varddiphala. Manuscript: 

Mysore ORI A.477/8. Ff. 314-316. Kannada. 

^KR^NARAMA (fl. ca. 1730) 

Examination of one manuscript of his Krsnavi- 
nodasarinl (see CESS A 2, 50a, and A 4, 58a) 
reveals that his name is Kr§narama rather than 
Kr§na, and that the epochs of his tithi, nak§atra, and 
yoga tables are respectively Saka 1652, 1629, and 
1649 = A.D. 1730, 1707, and 1727. Additional infor¬ 
mation concerning a manuscript: 

^Bombay U 340. 19ff. Copied by Narayana, the son 
of Sakharama Daivajha, a resident of Junnara, on 
Tuesday 13 kr§napak§a of Margasir§a in Saka 
1765 = 19 December 1843. 


KR^NANANDA 
See Krsna. 

KRSNANANDA SASTRIN 

Compiler of a Gandantasanti in Sarnskrta, 
published under the title Gandanta naksatra santi at 
Jalandhara in 1987. 


^KR^NANANDA SARASVATI 

Additional manuscripts of his JaiminisutraGika 
(see CESS A 2, 61b-62a; A 3, 23b; and A 4, 
63a-63b): 

RORI Cat. XVI 36087. 11 Off. Copied at Jayapura in 
Sam. 1820 = a.d. 1763. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


53 


RORI (Alwar) 2718 = *Alwar 1773. 231ff. Copied 
in Sam. 1912 = a.d. 1855. 

Kathmandu (1965) 23 (2826). 123ff. Incomplete 
(ends with 3, 2). 

Kathmandu (1965) 24 (7162). 16ff. Incomplete. 

Kathmandu (1965) 27 (2833). 42ff. Incomplete. 

Mysore ORI *B.594/2. Ff. 1-46. Kannada. Incom¬ 
plete. 

Mysore ORI *B.595. Ff. 1-35. Kannada. Incomplete. 

PrSB 3580 (Berlin or. fol. 2707). 53ff. Incomplete 
(1, 3, 1-2, 4, 28). 

RORI Cat. XVI 36644. 62ff. Incomplete. 

RORI (Jaipur) 9235. 7ff. Incomplete. 

RORI (Jaipur) 10868. 90ff. (ff. 1-30 missing). 
Incomplete (adhyayas 1-3). 


KANDAVA KR^NARYA 

A devaviccakravartin, Krsnarya wrote, under 
Kr§narat, king of Karnafa, a vyakhya, Uddhara, on 
the Khe(atantra of Nandisuri (fl. ca. 1475). Manu¬ 
script: 

Mysore ORI A.692/2. Ff. 1-29. Kannada. Incomplete 
(to the end of the madhyamadhikara). 

Near the beginning are the verses: 

ciram jivatu karnatabhupalah kr§narat sudhih / 
yasyaitadrsasadgrantharaksane pritir uttama // 
vidvatkandavakrsnaryadevaviccakravartinah / 
sarvatantrasvatantrasya pasyantu guninah krtim // 

KRSNARYA 

Additional manuscripts of his Grahacandrika (see 
CESS A 2, 62a): 

Mysore (1905) 875. 7pp. Telugu. Ascribed to Kr§na. 
Mysore ORI C.4673/3. Ff. 1-8. Telugu. Incomplete 
(adhyayas 1-7). 

Mysore ORI *P.1883/1. Ff. 1-7. Telugu. 

The second verse is: 

padmanayakapadmanabhijanitam padmasanarn 
sripatim 

gaurisarn gananayakarn dinamanirn natva gururn 
bharatim / 

vaksyami grahacandrikakhyaganitarn siddhanta- 
samyarn sphutarn 

srimatkr^nayasovido ’ham amalarn jyotirvidam 


pritaye // 


KR^NASRAMI 

See Krsnabhatta Arde (fl. ca. 1750/1825). 

^KEDARADATTA JOSI (fl. 1961/1988) 

The son of Haridatta of the Gargagotra, a resi¬ 
dent of Junayala in the Almoda mandala of Kurma- 
cala, Kedaradatta also (see CESS A 2, 62a-62b; A 3, 
23b; and A 4, 63b) wrote a Hindi vyakhya, Harine- 
travallabhd, on the Tajikanilakan{hi of Nilakantha 
(fl. 1569/1587), published at Dilli-Varanasi-Patana 
in 1979; a Hindi vyakhya on the Grahalaghava of 
Ganesa (b. 1507), published at Dilli-Varanasi- 
Pafana in 1983; and a Hindi vyakhya, Vijaya, on 
the Laghuparasari and the Madhyaparasan 
ascribed to Parasara, published at Dilli-Varana- 
si-Pafana-Madrasa in 1984. A revised edition of his 
Hindi tika, Pitambara, on the Muhunacintamani 
of Rama (fl. 1600) was published at Varanasi in 
1979 and reprinted at Dilli in 1983 and in 1988. 
And his Hindi vyakhya on the golMhyaya of Bhas- 
kara’s Siddhdntasiromani was published at Dill! in 
1988. 


KEDARANATHA MISRA 

Author of a Vasisthi Havanapaddhati published 
with his own Hindi tika, 7th ed., Ilahabada 1987. It 
includes a navagrahanarn sarnsthapanarn pujanam ca 
(pp. 49-59), a navagrahadihoma (pp. 100-102), and 
a grahanam balidana (pp. 109-110). 


*KEDARABHATTA 

Additional manuscript of his Ratnadtpa (see 
CESS A 2, 62b): 

RORI Cat. IV 19677. 6ff. Copied in Sam. 1923 = 
A.D. 1866. 


^'KERALACARYA 

Additional manuscripts of his Divyacuddmani, 
which is identical with the Aksaracintdmani and with 
the Mdtrdcintdmani (see CESS A 2, 62b-63a, and A 
4, 63b): 


54 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bhubaneswar IV 82 (Jy/113a). llff. Oriya. Copied in 
ahka year 35 (ca. a.d. 1775) of Virakesarideva I 
of the Bhoi dynasty (ruled 1736-1793), No 
author mentioned. From Bhubaneswar. 
Bhubaneswar IV 1 (Jy/32b). 5ff. Oriya. Copied by 
Devasarman Baina. No author mentioned. From 
the Baripada Museum, Mayurbhanja District. 
Harvard Indie 2370. F. 1. Incomplete. 

*KEVALARAMA PANCAN AN A (fl. 1728/1762) 

It is now clear that this author, who lived in Ben¬ 
gal, is different from his contemporary, Kevalarama 
of Jayapura; Kevalarama Paheanana wrote the Gani- 
taraja (see CESS A 2, 63a, and A 4, 63b), the Gra- 
hacarita (see CESS A 2, 63a-63b), and the Graha- 
cara (see CESS A 2, 63b, and A 3, 23b). 

1. Additional manuscript of his Ganitardja: 

AS Bengal I.B.IO. Bengali. 

3. Additional manuscripts of his Grahacdra: 

AS Bengal I.B.l. Bengali. With the tika of Rama- 
kiiikara. 

Varendra 274. Ff. 1-9. Bengali. 

^KEVALARAMA JYOTI^ARAYA (fl. ca. 1730/1770) 

This author, who must be distinguished from his 
contemporary Bengali namesake, wrote the Tithi- 
sdranl (see CESS A 2, 63b), the Drkpak^asdranl 
(see CESS A 2, 63b, and A 3, 23b), the Bhdgavata- 
jyauti^ayor bhugolavirodhaparihdra (see CESS A 2, 
63b), the Rekhapradlpa (see CESS A 2, 63b, and A 

4, 63b), a Brahmapaksanirdsa, and a Jlvdchdydsdri- 
nl. 

2. Additional manuscript of his Drkpak^asdranl: 

BORI 537 of 1895/1902. Ff. 1-16. Formerly prop¬ 
erty of Haradeva Mahatma in Sana. 1914 = a.d. 
1857, and of Ramesvara Damodara Josi. 

The colophon begins: iti sriphiraiigiyasaranyarn 
dikpak^abhidhayarp jyoti§arayakevalaramakrtarn. 

2. Additional manuscript of his Bhdgavataj'yauti^ayor 
bhugolavirodhaparihdra: 


5. Manuscript of his Brahmapak^anirdsa: 

RORI Cat. IX 28628. 6ff. Copied by Ganesa, the son 
of Govinda. 

The colophon is: samapto ’y^>T jyoti§arayakevala- 
ramoktabrahmapak§anirasa. 

6. Manuscript of his Jlvdchdydsdrinl, which gives 
the logarithms of sines and tangents for every min¬ 
ute of arc: 

RORI Cat. VI 23958. 9Iff. Copied in Sam. 1887 = 
A.D. 1830. 


KESAVA 

The son of Gopala Diksita of the Yajhavalkyago- 
tra, Kesava wrote a Kun4asik^d. Manuscripts: 

AS Bengal 1117 (G.6032). 7ff. Copied on Monday 2 
kr§napak§a of Asvina in Sarn. 1859 = 11 Octo¬ 
ber 1802. 

Wai 3000. 8ff. Copied in Saka 1734 = a.d. 1812. 
(Kupdadlpa). 

RORI (Alwar) 3756 = Alwar 1301. lOff. Copied in 
Sam. 1911 = A.D. 1854. (Kundamandapavidhi). 
Baroda 4165. llff. (Kundaman4apavidhi). 

Kerala 3811 (4821). 500 granthas. 

Wai 3001. lOff. 

The last verse is: 

sriyajnavalkyamunivamsavatarnsabhuto 
gopaladik§ita < ka > vi < h > srutitattvavetta / 
tasyatmajena ganitarnavaparagena 
srikesavena racita kila kundasik^a // 

KESAVA 

Author of a Grahaprakarana, which is perhaps 
the Grahakautuka of Kesava (fl. 1496/1507). Manu¬ 
scripts: 

BHU C.3378. 2ff. Incomplete. 

Mysore ORI P.5984/4. Ff. 1-2. Nandinagari. Incom¬ 
plete. 


New Delhi, H. B. Lall 10. 9ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


55 


^KESAVA 

Additional manuscript of his Grahalaghavasar- 
ani (see CESS A 2, 64a): 

BHU B.3809. 36ff. (GrahasMnl). 


*KESAVA 

Additional manuscripts of his Vyavaharasara (see 
CESS A 2, 64a-64b; A 3, 23b-24a; and A 4, 63b): 

Wien UB 57 (I 14380). Ff. 1-8. Copied in Sam. 
1737 = A.D. 1680. Bought by A. Fiihrer in 
1884/85. 

Oxford CSS I 458 (*d. 800 (8)). Ff. 1-18. Incom¬ 
plete (ends in 9, 53). 


*KESAVA BHATTA 

Additional manuscripts of his Prasnacintamani 
(see CESS A 2, 65a-65b): 

Mysore ORI *P.161. Ff. 18-34. Kannada. Incom¬ 
plete. 

Mysore ORI P.8004/1. Ff. 1-21. Nandinagari. With 
a tika. 


^KESAVA SOMAYAJIN BHARADVAJA 

Additional manuscripts of his Naksatres (iprayoga 
(see CESS A 2, 65b; A 3, 24a; and A 4, 64a): 

AS Bengal I 3. 578 = IM Calcutta 2426. Ff. 2-14 
and 1-25. Copied in Sarn. 1653 = A.D. 1596. 
Incomplete. 

RORI (Alwar) 553 = Alwar 101. 24ff. Copied in 
Sarn. 1911 = A.D. 1854. 


KESAVA (fl. ca. 1050/1075) 

The son of Somesvara, the son of Ananta, the 
son of Kesava, the son of Vahasa, Kesava belonged 
to a family of Atharvavedin Brahmanas who had 
dwelt on the bank of the Gahga, but in his father’s 
time, evidently with the patronage of the Paramara 
Bhojaraja (fl. ca. 1005/1055), had moved to the lat¬ 
ter’s foundation or capital, Bhojapura, in Malava. 
Kesava wrote a fika, Kausikapaddhati, on the Kau- 


sikasutra; of this adhyaya 13 is devoted to adbhutani. 
Manuscripts of the Kausikapaddhati: 

Berlin 1495 (or. fol. 621c). 35ff. Copied on Sunday 
13 suklapak§a of Margasir§a in Sarn. 1674 = 30 
November 1617. Formerly property of Bhava- 
deva Nagaji. 

BORI 640 of 1899/1915. Ff. 3-333. Copied on 10 
suklapak§a of A^adha in Sam. 1693 = ca. 2 July 
1636. Incomplete (begins on p. 2, 18 of the 
Poona ed.). 

Baroda 7599. 245ff. Copied by Bhrasyatyaji, the son 
of Somaji, the son of Udhava, the son of Devaji, 
the son of Madachuda, the son of Kahana, the 
son of Gahgadhara, the son of Ganapa<ti> 
Pacoli, a Nagara Brahmana of the Abhyantara- 
jnati, at Pattana on Friday 1 suklapak§a of Phal- 
guna in Sarn. 1736 = 20 February 1680. 

Gwalior, Gore family. 210ff. Copied in Sam. 1885 = 
A.D. 1828. Acquired at Kasi by Ganesabhataji 
Dada Gore, an Atharvavedin, on Thursday 5 suk- 
lapak§a of Asvina in Sarn. 1875 (read 1885) = 
13 November 1828. 

Varanasi, V. R. Ratate. 149ff. Copied on Tuesday 2 
suklapak§a of Magha in Sarn. 1893 = 7 February 
1837. 

Berlin 1496 (or. fol. 896). 26ff. 

BORI 14 of 1884/86. Ff. 1-101 and 103-175. Incom¬ 
plete (ends on p. 450, 17 of the Poona ed.). 

VSM 4186. 96ff. Incomplete (ends on p. 467; 7 of 
the Poona ed.). From the Gore family of Sangli. 

The Kausikapaddhati was edited by V. P. Limaye, 

R. N. Dandekar, C. G. Kashikar, V. V. Bhide, and S. 

S. Bahulkar, Pune 1982. Toward the end, on pp. 
482-483, are the verses: 

vahasat kesavotpannah kesavad ananta ucyate / 
anantat somesvaro jatah somesvarat kesavas tatha // 
gaiigatire vasantas ca balatve munivrttayah / 
ahamkaravinirmuktah sarve te dharmapanditah / 
apratigrahakah sarve japahomaparayanah // 
srimadbhojapure vidvan asit somesvaro dvijah / 
tatputrakesavenai^a krta kausikapaddhatih // 

KESAVA (fl. before 1350) 

Authority on yatra cited by Vi§nusarman (fl. ca. 
1370) on Vidyamddhaviya 12, 1 (vol. 3, p. 52); cf. 
the Kesavlya cited also on 12, 1 (vol. 3, p. 51). 


56 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*KESAVA (fi. 1496/1507) 

1. Additional manuscripts of his Grahakautuka (see 
CESS A 2, 66a-66b, and A 3, 24a; see also the 
Grahaprakarana of Kesava): 

*BORI 700 of 1883/84. 48ff. Copied by Vamana on 
15 Asvina in Saka 1500 = ca. 15 October 1578. 
With his own fika. 

RORI (Alwar) 2662 = *Alwar 1745. 18ff. Copied in 
Sarn. 1909 = a.d. 1852. 

AS Bengal III.A.68. 

Note that Gondal 30, mentioned in CESS A 2, 
66a, is not a manuscript of the Grahakautuka. 

la. Manuscripts of his Grahakautuka ilka, which is 
referred to by his son Ganesa (see CESS A 2, 66a): 

BORI 700 of 1883/84. 48ff. Copied by Vamana on 
15 Asvina in Saka 1500 = ca. 15 October 1578. 
Kathmandu (1964) 73 (2631). 33ff. Copied on Fri¬ 
day 11 suklapak§a of Phalguna in Sarn. 1714, 
Saka 1579 = 5 March 1658. 

The first verse is: 

brahmesacyutavighnarajadinakrnmukhyagrahan 

kesavo 

natva svarn grahakautukarn tu gaiiitagryarn vyakaroti 
sphutam / 

yasmad atra krtih parair na hi krtapurva yato 
durgamety 

ajhanarn pratibhati ced avagatalpa syac ca satkari- 
ni // 

The colophon begins: iti srikesavajyotirvidracita- 
grahakautukatikayam. 

2. Additional manuscripts of his Jatakapaddhati (see 
CESS A 2, 66b-70b; A 3, 24a; and A 4, 64a-65a): 

PrSB 3641 (Berlin or. fol. 2708). 80ff. Copied in 
Saka 1540 = a.d. 1618. With the tika of Visva- 
natha. 

RORI Cat. XVI 35609. 18ff. Copied by Prema Sar- 
man in Sarn. 1711 = A.D. 1654. With a flka. No 
author mentioned. 

BHU C.4. 47ff. Sarada. Copied in Saka 1610 = a.d. 
1688. 

RORI (Udaipur) 5230. 6ff. Copied by Vidyavinoda 
in Sarn. 1747 = a.d. 1690. 

RORI (Bikaner) 15894. 3ff. Copied by Caritraharnsa 


in Sarn. 1754 = a.d. 1697. 

RORI Cat. IV 19032. 60ff. (ff. 1-2 missing). Copied 
in Sarn. 1757 = a.d. 1700. With the tika of Vis- 
vanatha. 

Kathmandu (1964) 45 (6536). 72ff. Copied on Tues¬ 
day 6 suklapaksa of Jye§tha in Sarn. 1767 = 23 
May 1710. With the fika of Dharmesvara. 

PrSB 3637 (Berlin or. oct. 807). llff. Copied by 
Manasarama on Tuesday 2 suklapaksa of Pau§a 
in Sarn. 1791 = 31 December 1734. 

Kathmandu (1965) 1 (6552). 7ff. Copied by Guruna- 
tha on Wednesday 4 krsnapaksa of Sravaiia in 
Sarn. 1794, Saka 1659 = 3 August 1737. 

RORI (Jaipur) 8436. 6ff. (f. 1 missing). Copied by 
Gaiiapati Ravala in Sarn. 1798 = a.d. 1741. 
Incomplete. 

WHMRL N.117.B. Ff. 3-42. Copied on 7 kr^na- 
pak§a of Caitra in Sarn. 1809 = ca. 26 March 
1752. With the tika of Visvanatha. Incomplete 
(begins with verse 2). 

Oxford CSS I 254 (*d. 780 (4)). Ff. 1-19, 20/21, and 
22-38. Copied on Monday 5 kr§iiapaksa of Vai- 
sakha in Sarn. 1827 = 14 May 1770. With the 
tika of Visvanatha. 

RORI Cat. VI 24121. 23ff. Copied by Dipasagara in 
Sarn. 1828 = a.d. 1771. With his own tika, 

RORI (Chittorgarh) 2951. 6ff. Copied in Sarn. 1828 
= A.D. 1771. 

RORI (Jaipur) 5506. 82ff. Copied in Sarn. 1830 = 
A.D. 1773. With the tika of Narayaiia. 

RORI (Bikaner) 17104. 59ff. Copied by Sivacandra 
at Krsnagadha in Sarn. 1833 = a.d. 1776. With 
the tika of Visvanatha. 

Pattan II 13143. 50ff. Copied in Sarn. 1835 = a.d. 
1778. With the tika of VisvanMha. 

PrSB 3640 (Berlin or. fol. 1651). 75ff. Copied by 
Nathurama, a Gauda Brahmaiia, for Harasevaka 
on Wednesday 2 suklapaksa of Caitra in Sarn. 
1844 = 21 March 1787. With the tika of Visva¬ 
natha. 

RORI Cat. IV 18980. 19ff. Copied by Nityananda 
Nagara in Sarn. 1845 = a.d. 1788. With his own 
tika. 

RORI (Jaipur) 11035. 7ff. Copied by Somesvara 
Ojha in Sarn. 1847 = a.d. 1790. 

Oxford CSS I 255 (*d. 775 (6)). Ff. 1-5. Copied by 
Thakuradatta on Tuesday 8 suklapaksa of Kart- 
tika in Sarn. 1849 = 23 October 1792. 

RORI Cat. VI 24433. 54ff. Copied by Jnananidhana 
at Jayapura in Sarn. 1853 = a.d. 1796. With the 
tika of Dharmesvara. 

RORI (Udaipur) 5463 (A). 12ff. Copied by Mala- 
sisara in Sarn. 1855 = a.d. 1798. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


57 


New Delhi, N. M. 63/892. 42ff. Copied in Saka 1721 
= A.D. 1799. 

NFS (Sanskrit) 9204. 2ff. Copied on Friday 11 
kr§napak§a of Vaisakha in Sarn. 1857, Saka 1722 
= 16 May 1800. Incomplete. 

RORI Cat. XVI 34957. 8ff. Copied in Sam. 1860 = 
A.D. 1803. 

New Delhi, H. B. Lall 96. llff. Copied by Haradeva 
on Saturday 6 suklapak§a of Caitra in Sarn. 1862 
= 6 April 1805. 

RORI (Jaipur) 6907. 12ff. Copied by Rama Purohita 
at Jodhapura in Sarn. 1863 = a.d. 1806. 

Kathmandu (1965) 2 (6551). 6ff. Copied by Gajen- 
dradhvaja on Tuesday 9 suklapak§a of Mar- 
gas ir§a in Saka 1729 = 8 December 1807. 
Incomplete. 

RORI (Jaipur) 5080. 9ff. Copied in Sarn. 1878 = 
A.D. 1821. 

PrSB 3638 (Berlin or. fol. 2259). 6ff. Copied by 
Sevarama on Tuesday 13 suklapak^a of Caitra in 
Saka 1748 = 18 April 1826. 

RORI Cat. VII 25228. 47ff. Copied by Kanirama 
Josi, the son of Mohanarama and a resident of 
Sahganera, at Savai Jaipura in Sarn. 1886 = a.d. 
1829. With the flka of Visvanatha. 

RORI Cat. XVI 36780. 93ff. Copied by NanQrama in 
Sam. 1888 = a.d. 1831. With the tika of Dhar- 
mesvara. 

BHU C.3480. 7ff. Copied in Sam. 1893 = a.d. 1836. 
Incomplete. 

RORI (Alwar) 2663. 5Iff. Copied in Sarn. 1900 = 
A.D. 1843. With his own tika. 

RORI (Chittorgarh) 2651. 7ff. Copied by Guru Moti 
in Sarn. 1900 = A.D. 1843. 

RORI Cat. XVI 35854 (3). Ff. 3-6. Copied in Sarn. 
1901 = A.D. 1844. Incomplete. 

RORI Cat. IX 28688. 29ff. Copied in Sarn. 1905 = 
A.D. 1848. With his own tika. 

RORI Cat. XVI 35641. 78ff. Copied in Sarn. 1908 = 
A.D. 1851. With a bhasya. 

Kathmandu (1965) 3 (6550). 7ff. Copied on Thurs¬ 
day 7 kr§tiapak§a of Margasir^a in Sarn. 1909 = 
16 December 1852. 

VSM (Upadhye) 12753. 6ff. Copied by Vyapti- 
sarman in Saka 1776 = a.d. 1854. 

RORI (Jaipur) 9140. 5ff. Copied by Isaralala Ratiga 
at Jodhapura in Sarn. 1913 = a.d. 1856. 

RORI Cat. IV 19036. 68ff. Copied by Kanhaiyalala, 
the son of Narayaiia Josi, in Sarn. 1928 = a.d. 
1871. With the tika of Harinarayaiia. 

Oxford CSS I 256 (*c. 404) D. Ff. 1-8. BengMi. Ff. 
4-8. Copied by Naravala (?) Sricintalala on 5 
kr§napak§a of Magha in Saka 1793, Sane 1281 = 
ca. 28 February 1872. 


RORI Cat. IV 21458. 4ff. Copied by Cunnilala 
Vyasa, the son of Madhoraya, in Sarn. 1931 = 
A.D. 1874. 

New Delhi, N. M. 63/879. 49ff. Copied in Sarn. 1934 
= A.D. 1877. 

RORI (Chittorgarh) 2751. 9ff. Copied by Ramanatha 
Tivac^i at Jodhapura in Sarn. 1935 = a.d. 1878. 

RORI Cat. IV 20841. 6ff. Copied by Harakr§iia 
Brahmaiia in Sarn. 1936 = a.d. 1879. 

RORI Cat. VII 25523. 6ff. Copied by Rajacandra in 
Sarn. 1946 = A.D. 1889. 

RORI (Chittorgarh) 2109. 16ff. Copied in Sarn. 1952 
= A.D. 1895. With a stabaka. 

RORI (Udaipur) 6484. 62ff. (f. 29 missing; ff. 27 
and 53 repeated). Copied by Labdhasagara, the 
pupil of Phatesagara, at Boravada in Sarn. 1955 
= A.D. 1898. Incomplete. 

AS Bengal I.A.57. Bengali. 

BHU C.321. 5ff. Sarada. With an udahararia. 

BHU C.369. 26ff. Sarada. With the tika of Visvana¬ 
tha. Incomplete. 

BHU C.849. lOff. 

BHU C.1177. 12ff. Sarada. With a tippatii. 

BHU C.1465. lOff. Incomplete. 

BHU C.1469. 18ff. 

BHU C.2998. lOff. 

BHU C.3172. 6ff. 

BHU C.3392. If. Incomplete. 

BHU C.4484. 12ff. With a tika. 

GJRI 8342/567. Ff. 1-9. Maithili. 

GJRI 8343/568. Ff. 8-14. Maithili. Incomplete. 

GJRI 8344/569. Ff. 1-5. Maithili. 

GJRI 10983/1037. Ff. 2-8. Maithili. Incomplete. 

GJRI 10984/1038. Ff. 3-5. Maithili. Incomplete. 

GJRI 11003/1057. Ff. 1-10. Maithili. Incomplete. 

GJRI 11005/1059. Ff. 1-9. Maithili. Incomplete 
(ends with antardasadhyaya). 

Jaipur (Khasmohor) 5202; 5209; 5308; 5316; 5414; 
5416 (with his own tika); and 5425 (with the 
tika of Visvanatha). 

Kathmandu (1964) 148 (6552). 6ff. 

Mysore (1905) 559. 34pp. Telugu. 

Mysore ORI B.774/1. Ff. 1-72. Kannada. Incomplete 
(to grahadasa). 

Mysore ORI C.3926/1. Ff. 1-14. Incomplete (to 
ayurjhana). 

Mysore ORI C.4292/14. If. Incomplete (bhavadh- 
yaya). 

Mysore ORI P.6352/1. Ff. 1-77. Telugu. Copied on 
Wednesday 1 suklapak^a of Vaisakha in a Vi- 
lambisarnvatsara. 

Mysore ORI P.6847/4. Ff. 235-237. Telugu. 

Mysore ORI P.6847/10. Ff. 257-259. Telugu. 

Mysore ORI P. 10271/15. Ff. 79-84. Nandinagari. 


58 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.10271/17. Ff. 86-97. Nandinagari. 
Copied by Vengappaya on Wednesday 10 sukla- 
pak§a of Jye§tha in a Jayasamvatsara. Incomplete 
(adhyayas 10-12). 

Oxford CSS I 257 (*c. 315 (7)). Ff. 1-5. With a 
tika. 

Oxford CSS I 258 (*d. 782 (8)). Ff. 1-25, 25b-39, 
39b-40, and 40b-52. With the fika of Visvana- 
tha. Incomplete. 

Oxford CSS I 259 (*d. 788). Ff. 2-150. With the 
lika of Divakara. Incomplete (ends with verse 
19). 

Oxford CSS I 260 (*d. 789 (1)). Ff. 1-64. With the 
tika of Visvanatha. Incomplete. 

PrSB 3639 (Berlin or. fol. 2182). 45ff. Copied by 
Giridhara Sarman for Radhajivana Sarman of the 
Parasarakula. With the tika of Visvanatha. 

RORI Cat. IV 20853. 6ff. 

RORI Cat. VI 24138. 38ff. With a tika. 

RORI Cat. VIII 26700. 59ff. With the tika of Visva¬ 
natha. 

RORI (Alwar) 2664. 68ff. With the tika of Visva¬ 
natha. 

RORI (Alwar) 2665. 127ff. With the tika of Diva¬ 
kara. 

RORI (Alwar) 2666. 6ff. 

RORI (Alwar) 6193. 15ff. 

RORI (Bikaner) 14735. llff. With the tika of Vi^ 
vanatha. Incomplete. 

RORI (Bikaner) 17373. 5ff. Incomplete. 

RORI (Chittorgarh) 2135. 8ff. Incomplete. 

RORI (Chittorgarh) 2266.3ff. 

RORI (Chittorgarh) 2326. 5ff. Incomplete. 

RORI (Chittorgarh) 2614. 9ff. 

RORI (Chittorgarh) 4597. 5ff. Incomplete. 

RORI (Jaipur) 2599. 12ff. (f. 8 repeated). With the 
tika of Visvanatha. Incomplete. 

RORI (Jaipur) 2630. 34ff. (f. 12 missing). With the 
tika of Visvanatha. Incomplete. 

RORI (Jaipur) 2793. 53ff. (ff. 1-12 missing). With 
the tika of Visvanatha. Incomplete. 

RORI (Jaipur) 3273. 9ff. Incomplete. 

RORI (Jaipur) 3328. 12ff. 

RORI (Jaipur) 4457. 9ff. 

RORI (Jaipur) 8315. 16ff. (ff. 11-12 missing). 
Incomplete. 

RORI (Jaipur) 10059. 8ff. Incomplete. 

RORI (Jaipur) 11463. 44ff. With the tika of Visva¬ 
natha. Incomplete. 

RORI (Udaipur) 5207. Ff. 1-45. Incomplete. 

RORI (Udaipur) 6450. 7ff. Incomplete (ends with 
dasantardasa). 

RORI (Udaipur) 6455. 48ff. With a tika. Incom¬ 
plete. 


Varendra 291 I. Ff. 1-74. Bengali. 

Vrndavana 1646. 5ff. Incomplete. 

Vrndavana 2351. 12ff. 

Vrndavana 3276. 13ff. With the tika of Visvanatha. 

Incomplete. 

Vrndavana 6605. 27ff. 

VSM (Upadhye) 12760. 6ff. 

WHMRL a 809. Ff. 1-16. With the tika of Visva¬ 
natha. Incomplete (ends in verse 11). 

WHMRL a 1273. Ff. 1-4. 

The Jatakapaddhati was edited with his own 
anvaya, vyakhya, udaharana, and Hindi tika by 
Candrama Pandeya as Vardnaseya SG 3, Varanasi 
Sarn. 2039 = a.d. 1982; and with the Praudhamano- 
ramd of Divakara and his own Sarnskrta and Hindi 
tikas by Ramajanma Misra as Harajivanaddsa SG 
32, Varanasi 1985. 

3. Additional manuscripts of his JatakapaddhatiGikd 
(see CESS A 2, 70b-71a, and A 4, 65a): 

Oxford CSS I 261 (*d. 776 (5)). Ff. < 15-18 > and 
19-30. Copied by Cintamani on Wednesday 3 
suklapaksa of Sravana in Sarn. 1733 = 2 August 
1676. Incomplete (begins with verse 18). 

BHU B.3321. 28ff. Copied in Sam. 1798 = a.d. 
1741. Incomplete. 

RORI Cat. VI 24121. 23ff. Copied by Dipasagara in 
Sam. 1828 = a.d. 1771. 

RORI Cat. IV 18980. 19ff. Copied by Nityananda 
Nagara in Sarn. 1845 = a.d. 1788. 

RORI Cat. IV 18803. 24ff. Copied by Narayana 
Sevaka in Sarn. 1890 = a.d. 1833. 

RORI (Alwar) 2663. 51ff. Copied in Sarn. 1900 = 
A.D. 1843. 

BHU C.3036. 50ff. 

BHU C.4447. 25ff. Sarada. Incomplete. 

Jaipur (Khasmohor) 5416. 

4. Additional manuscripts of his Tdjikapaddhati (see 
CESS A 2, 71a-72a, and A 4, 65a-65b): 

Oxford CSS I 346 (*d. 791 (8)). Ff. 1-2. Copied by 
Kamalakara on Friday 5 Madhu in Saka 1616 = 
8 March 1695. 

BHU C.3320. 9ff. Copied in Saka 1689 = a.d. 1767. 
BHU C.1666. 7ff. Copied in Sam. 1896 = a.d. 1839. 
VSM (Upadhye) 12744. 2ff. Copied by Nilakantha 
in Saka 1776 = a.d. 1854. 

NFS (Sanskrit) 8942. 18ff. Copied in Sarn. 1942 = 
A.D. 1885. 

ABSP 6564. 4ff. 

BHU B.171. lOff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


59 


BHU C.1562. 27ff. With the fika of Visvanatha. 
Incomplete. 

Kathmandu (1964) 48 (7429). 4ff. Incomplete. 

Kathmandu (1964) 49 (7398). 6ff. 

Mysore (1905) 546. Pp. 67-86. Telugu. 

Mysore ORI C.3926/2. Ff. 1-14. Incomplete (to 
ayurjnana). 

Oxford CSS I 347 (*d. 771 (9)). Ff. 1-4. 

Oxford CSS I 348 (*d. 772 (1) II). F. 6. Incomplete 
(verses 17-19). 

Oxford CSS I 349 (*d. 773 (9)). Ff. 1-4. 

Oxford (Vyasa) 172. Ff. 1-3. 

RORI (Jaipur) 5476. 4ff. 

RORI (Udaipur) 6413. 4ff. With a Sarnskrta tip- 
pana. 

WHMRL a 128. 16ff. Sarada. With the fika of Vi^ 
vanatha. 

5. Additional manuscripts of his Muhunatattva (see 

CESS A 2, 72a-73b; A 3, 24a; and A 4, 65b-66a): 

RORI (Alwar) 2910. 25ff. Copied by Munna Bhatta 
at Indraprastha in Sarn. 1786 = a.d. 1729. 

VSM (Upadhye) 12814. 185ff. Copied in Saka 1687 
= A.D. 1765. With the tika of Ganesa. 

RORI (Udaipur) 5016. Ff. 1-28. Copied by Amba- 
datta Jyotirvid at Savai Jayanagara in Sarn. 1828 
= A.D. 1771. Incomplete. 

RORI Cat. IX 28288. 28ff. Copied by Abherama, the 
son of Tuljarama Josi, at Vatapuri in Iladurga 
District in Sarn. 1835 = a.d. 1778. With the tika 
of Ganesa. 

Oxford CSS I 401 (*d. 802 (8)). Ff. 1-18. Copied on 
5 kr§napak§a of Caitra in Sarn. 1851 = ca. 18 
April 1794. 

Oxford CSS I 402 (*d. 771 (6)). Ff. 1-5; and 1-9. 
Copied in Sarn. 1863, Saka 1728 = a.d. 1806. 
Incomplete (begins in verse 36). 

AS Bengal I 3. 85 (I.D.23 (4)). 14ff. Copied in Sarn. 
1865, Saka 1731 = a.d. 1808/9. 

PrSB 2946 (Gottingen, Sanscr. Sham 47). 23ff. Cop¬ 
ied on Tuesday 6 kr§napak§a of Jye§tha in Sam. 
1871 = 24 May 1814. 

VSM (Upadhye) 12815. 22ff. Copied by Sivarama 
Pitre in Saka 1736 = a.d. 1814. 

RORI (Alwar) 2909. 22ff. Copied in Sam. 1907 = 
A.D. 1850. 

RORI (Alwar) 2911. 155ff. Copied in Sarn. 1912 = 
A.D. 1855. With the tika of Ganesa. 

NPS (Sanskrit) 8822. 19ff. Copied by Govinda 
Raghunatha at Banarasa on 9 April 1856, which 
was 5 suklapak^a of Caitra in Sam. 1913, Saka 
1778. 

GJRI 9704/1014. Ff. 1-19. Incomplete. 


Oxford CSS I 403 (*c. 315 (9)). Ff. 1-24. Incom¬ 
plete (ends in verse 160). 

Oxford CSS I 404 (*d. 756). Ff. 1-162. With the 
tika of Ganesa. 

RORI Cat. VI 24148. 21ff. 

RORI Cat. IX 29585. lOff. With a tippana. 

RORI (Udaipur) 5011. Ff. 3-12. Incomplete. 

VSM (Upadhye) 12816. 12ff. Incomplete (to vivaha). 
VSM (Upadhye) 12817. 5ff. Incomplete. 


*KESAVA KAVINDRA {fl. ca. 1550?) 

Additional manuscripts of his Dvaitaparisi^ (a 
(see CESS A 4, 66a-67a): 

GJRI 4946/576. Ff. 1-151. Maithili. Copied in Saka 
1648 = A.D. 1726. 

^Oxford 650 (Wilson 218). 133ff. Bengali. Copied 
by Pitambara Sarman on Tuesday 12 suklapak§a 
of Sravana in Saka 1735 = 10 August 1813. 
Benares (1956) 13341. Ff. 1-12. Incomplete. 

GJRI 5341/372. Ff. 1-47. Incomplete. 


^KESAVA (fl. 1583) 

Additional manuscripts of his Jyoti^amapimala 
(see CESS A2, 74a-74b, and A 4, 67a): 

RORI (Alwar) 2925 = Alwar 1783. 83ff. Copied in 
Sarn. 1808 = a.d. 1751. 

RORI Cat. IV 18801. 56ff. Copied by Narayana Josi 
at Totika in Sarn. 1894 = a.d. 1837. 

RORI Cat. IV 19872. 24ff. (f. 9 missing). Copied by 
Juharamalla at Gudhagrama in Sarn. 1916 = a.d. 
1859. 


KESAVA (fl. 1664) 

Author of an Upakaranakalanirnaya at Dill! on 
Thursday Anantavratadina in Sam. 1721 = A.D. 
1664. Manuscript: 

Jaipur (Dharma) 136. 5ff. Copied by the author at 
Dilli on the day of its composition. 

The first and last verses are: 

upakarmotsargavidhau pratisakham nayarn sruteh / 
vivicya kesavo brQte pustyai si§te§takarmanam // 
srimadvisve§akrpaya dr§tasutrena bhurisah / 
nirnitah kesavenayam upakarananirnayah // 


60 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


After the colophon is the verse: 

karacchayamite var§e ’nantavratadine gurau / 1721 
dillyam akari calekhi kesavenadbhuto nayah // 

KESAVA ifl. 1699) 

The son of Dosa of the Kautsagotra and the 
Audicyajhati, a resident of Lahgulapura, Kesava 
wrote an Anandakarana in two adhikaras: candra- 
parvan and suryaparvan. The epoch of the 
accompanying tables is Saka 1621 = A.D. 1699. 
Manuscript: 

Oxford (Vyasa) 28. Ff. 2 and 9. Copied on Thursday 
30 kr§napak§a of Vaisakha in Sarn. 1772 = 10 
May 1716. Incomplete (1,14-2,5; and some 
tables). Formerly property of Mulaji Sivasaiikara 
Vyasa. 

Verse 2, 5 is: 

asit sajjanadhamni laiigulapure kautsasya gotre 
dvijah 

srautasmartavicarasaracaturaudicyo hi dosahvayah / 
jyotirvittilakah sujanyava iti khyatah k^itau svair 
gunais 

tatsunuh karanakhya anandarn cakre kavih kesavah 

//5// 


*KESAVADASA (fi. ca. 1750) 

Additional manuscripts of his Ahalyakamadhenu 
(see CESS A 4, 67a): 

Benares (1956) 12842. Ff. 1-86; 4-139; 1-29; 1-29; 
13-28 and 30-73; 1-27; and 1-75. Copied in 
Sam. 1828 = a.d. 1771. Incomplete. No author 
mentioned. 

Benares (1956) 12432. Ff. 1-33, 35-47, and 49-58. 
Incomplete (aramavasayotsargavatsa; incom¬ 
plete). No author mentioned. 

RORI Cat. VI 25025. 26ff. Incomplete (Dharma- 
nirnayasahgraha = Ahalydkamadhenuvatsa). No 
author mentioned. 

*KESAVAPRASADA DVIVEDIN (fi. 1840/1873) 

This author’s Jyoti^asara in Hindi (see CESS A 
3, 25a, and A 4, 67b) is evidently his Hindi fika on 
the Jyoti^asdra ascribed to Sukadeva. This was edited 


by Radhakr§na Misra at Murnbai in Saka 1818, 
Sarn. 1953 = a.d. 1896; reprinted at Kalyana-Bam- 
bai in Sarn. 2013, Saka 1878 = a.d. 1956. He also 
appears to be the author of a tika, Bhasdrthabodhi- 
ni, in Hindi on the Kdntikamdsamahdtmya from 
the Padmapurana, published at Mumbai in 1985. 

KESAVABHATTA (fi. 1937) 

The son of PrasMa, the third son of Sadrama 
Daivajna, and a teacher at a Pathasala in Rainavari 
bhaga, Srinagara, Kesavabhatfa wrote a Kasmiri- 
kajyoti^asangraha, published at Srinagara in 1937. 
Verses 1-2 at the end are: 

asic chivarcaptamatih prasiddhah 
sadramadaivajha iti dvijendrah / 
tasyaptavidya hy abhavan sma sunavas 
te§arn prasadakhyayutas trtiyah // 
tasyatmajo hayanajatakanta- 
muhurtasastrad upayogi saram / 
nirmathya kasmirikadharmiprityai 
sarnjagrahe kesavabhattanama // 

*KESAVARKA 

His Maunjlpatala (see CESS A 2, 75a, and A 4, 
67b) was also published in K. K. Raikva’s Mauh- 
jtpafala, Surata Saka 1858, Sam. 1993 = a.d. 1936, 
pp. 21-23. 

*KESAVARKA (fi. thirteenth or fourteenth century) 

1. Additional manuscripts of his Vivahavrnddvana 
(see CESS A 2, 75a-77a; A 3, 25a; and A 4, 67b): 

RORI Cat. VII 25478. 20ff. (ff. 4-7 missing). Copied 
in Sam. 1623 = a.d. 1566. Incomplete. 

RORI Cat. XVI 34420. 13ff. Copied by Haradasa, 
the son of Giridhara, in Sam. 1662 = a.d. 1605. 
Oxford (Vyasa) 103. Ff. 2-16 and 18-24. Copied by 
Vasudeva, the son of Sripatimegha Vyasa of the 
Kaundinyagotra and the Madhyandinasakha of 
the Yajurveda, at Bhuja on Saturday 14 sukla- 
pak§a of Magha in Sarn. 1710 = 21 January 
1654. Incomplete (1, 6-11, 11; and 12, 8-end). 
BHU C.3455. 20ff. Copied in Sam. 1741 = A.D. 
1684. Incomplete. 

RORI (Jaipur) 9405. 16ff. Copied by Sankara 
BhaUa, the son of Sukadeva, in Sarn. 1813 = 
A.D. 1756. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


61 


Oxford CSS I 482 (*d. 772 (14)). Ff. 1-17. Copied 
by Gokulanatha in Sarn. 1820 = a.d. 1763. 

Incomplete (omits lagnasuddhi). 

RORI (Udaipur) 6217. 29ff. (ff. 1, 4, and 10-13 

missing). Copied in Sam. 1833 = a.d. 1776. 

Incomplete. 

PrSB 3626 (Berlin or. oct. 502). 17ff. Copied by 
Narayana Agniman, who resided on the bank of 
the Yamuna, in Saka 1700 = a.d. 1778. 

RORI (Jaipur) 5175. 15ff. Copied by Gahgadhara 
Dik§ita at Brahmavartak§etra in Sarn. 1890 = 
A.D. 1833. (Vivahavrndavanatlka of Kesava). 

RORI (Alwar) 2943. 22ff. Copied by Bhagavana 
Vipra in Sarn. 1905 = a.d. 1848. 

BHU C.4645. 25ff. Sarada. No author mentioned. 

New Delhi, H. B. Lall 59. 96ff. With the tika of 
Ganesa. Incomplete (ends with 16, 4). 

Oxford CSS I 483 (*d. 750 (7)). Ff. 1-9. Incomplete 
(ends in 8, 8). 

Oxford CSS I 484 (*d. 778 (4)). Ff. 1-22. Incom¬ 
plete (omits svavarnsavarnana and lagnasuddhi). 

Oxford CSS I 485 (*d. 807 (4)). Ff. 1-49. Copied 
from a manuscript copied by Jagannatha Krti on 
Sunday 6 kr§napak§a of Caitra in Sarn. (?) 1654 
= 27 February 1597 (?). With a vivarana. For¬ 
merly property of Vaijanatha Bha< tta>. 

Oxford (Vyasa) 105. F. 1. Incomplete (ends in 1, 5). 

Poona, Mandlik. Jyotisha 4. 33ff. (Strljdtaka by a 
grandson of Janardana). Incomplete. 

RORI Cat. II 6972. 3ff. No author mentioned. 

RORI Cat. IV 20352. 15ff. With a tippana. Incom¬ 
plete. 

RORI Cat. IV 20845. 17ff. Incomplete. 

RORI Cat. V 22284. 15ff. 

RORI Cat. V 23526. 35ff. 

RORI Cat. VII 25170. 72ff. (ff. 5 and 56 missing; f. 
61 repeated). With the tika of Ganesa. Incom¬ 
plete. 

RORI Cat. XVI 34456. 255ff. (ff. 249-254 missing). 
With the tika of Ganesa. Incomplete. 

RORI Cat. XVI 36577. 63ff. Copied by Saiikara 
Bhatta, the son of Sukadeva. With the tika of 
Ganesa. 

RORI (Alwar) 2941. 153ff. With the tika of 

Ganesa. 

RORI (Alwar) 2942. 118ff. With the tika of 

Ganesa. 

RORI (Jaipur) 11809. 13ff. With the tika of 

Ganesa. Incomplete. 

RORI (Udaipur) 5141. Ff. 1 and 3-25. Incomplete. 

RORI (Udaipur) 5404. 28ff. 

VSM (Upadhye) 11248. 19ff. Incomplete. 


2. Additional information concerning the Alwar 
manuscripts of his Karanakan(htrava (see CESS A 
2, 77a): 

RORI (Alwar) 2652. 20ff. Copied by Mahesa in 
Sarn. 1551 = a.d. 1494. 

RORI (Alwar) 2651. 39ff. Copied in Sam. 1862 = 
A.D. 1805. 

Verse 1 is: 

kamalajakamalesavyomakesarkavani- 
gajavadanagurunam aiighriyugmarn pranamya / 
ganakakavikulenduh kesavah satprakararn 
srjati karanam etad brahmasiddhantatulyam // 

At the end, 10, 29-30 equal Vivahavrndavana 16, 
1-2, and 10, 31-32 are: 

jayadityas tasmad ajani ganakasrenitilakah 
kaniyan asyasin matiruciravih kesavakavih / 
tatah kr§no jhani jaladhijalajahghalatapati- 
tatottarnsarnvenus trinayanamamirajanagaram // 
srikesavena kavina ganitarnavantar- 
vibhrantasisyakaruna tarunarjavena / 
cakre ’hjaliskaradanasya vikalpaktimbhi- 
kanthiravarn racayata karanarn krtibhyah // 

KAILASACANDRA DAVE (fl. 1983) 

A lecturer at Banaras Hindu University, Kailasa- 
candra compiled a Grahasantiprayoga published as 
Gokuladasa SG 69, VaranasI-DilH 1983. 

KAILASANATHA UPADHYAYA (fl. 1965/1971) 

The pupil of Vacanaprasada Tripathin and a resi¬ 
dent of Kasi, Kailasanatha wrote in Hindi a Nava- 
graha vara vrata vidhi (Varanasi Sarn. 2022 = A.D. 
1965); a Prasnavall sataka (Varanasi 1966); an 
Ascaryajanaka prasnavall (Varanasi 1971); and a 
Ramalasara prasnavall. (Varanasi [N.D.]). 

KONACARYA 

An authority on dvaraphalani in vastuvidya cited 
by Vasudeva (fl. 1653) in Vastupradlpa 1, 80-84. 


62 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


KODANDARAMA D'IKSITA 

Author of a Telugufika on a Muhurtadipika. 
Manuscripts: 

Mysore ORI C.2990. Ff. 1-21. 

Mysore ORI C.3450/2b. 22ff. Nandinagari. 

Mysore ORI C.3835/b. Ff. 1-26. 

Mysore ORI C.4115/2. Ff. 1-26. 

Mysore ORI P.9626/4. Ff. 1-28. Telugu. 

KODANDARAMAR YA 

Author of a Suryasataka. Manuscript: 

GOME Madras R.3326 (a). Ff. 1-1 Iv. Telugu. Cop¬ 
ied in 1920/21 from a manuscript belonging to K. 
Kodandaramayyagaru of Bobbili. 

The last verse is: 

kodandaramaryakrtastutim ye 
pathanti srnvanti ca bhaktiyuktah / 
te$am sriyarn putrakalatrasaukhyarn 
svargarn ca mok^am dinanatha dehi // 

KAUSALAKISORA TRIPAJHIN DHULAKA (fl. 
1976) 

Born at Hanumatagahja in a Brahmana family of 
the Sandilyagotra, Kausalakisora, a resident of Pai- 
tiha, Jila Ilahabada, Uttara Pradesa, wrote in Hindi 
a Bharatiya kundalldarpana arthdt kundaliprakdsa, 
published at Ilahabada in Sana. 2033 = a.d. 1976. 

*K$EMANKARA MISRA 

Additional manuscript of his Nirnayasdra (see 
CESS A 3, 25b, and A 4, 68a): 

RORI (Alwar) 6101. 102ff. Copied by Rudramalla at 
Kamavana in Sarn. 1895 = A.D. 1838. 

*K$EMANKARA MISRA (fl. 1632) 

Additional information concerning a manuscript 
of his Subodhikd (see CESS A 2, 79a, and A 4, 68b): 

Oxford CSS I 53 (*d. 751 (4)). Ff. 1-10. Copied by 
K§emahkara Misra on Friday 10 kr§napak§a of 


Magha in Sarn. 1688 = 25 January 1633. 


K$EMARATNA GAN I 

Author of a Gujarati or Rajasthani tika, Bdldva- 
bodha, on the K^etrasamdsa of Ratnasekhara (fl. 
1371/1390). Manuscripts: 

Pattan II 14102. lOff. Copied in Sarn. 1838 = a.d. 
1781. 

RORI (Chittorgarh) 3795. 137ff. (ff. 2-7 missing). 
Incomplete. Ascribed to K§ema Gani. 


KSEMARAMA 

Author of a Navagrahahomapaddhati. Manu¬ 
script: 

RORI (Alwar) 3794. 39ff. Copied in Sarn. 1910 = 
A.D. 1853. 


*KSEMARAMA 

Additional manuscript of his Muhurtasahcaya (see 
CESS A 2, 79a): 

RORI (Alwar) 6200. 2Iff. Incomplete. Ascribed to 
K§emaraja. 


^KSEMARAMA (fl. 1720) 

Additional manuscripts of his Rdmanibandha (see 
CESS A 2, 79a-79b; A 3, 25b; and A 4, 68b): 

RORI (Alwar) 3631. 67ff. Copied by Radhavihari- 
dasa at Bharatapura in Sarn. 1841 = a.d. 1784. 
RORI Cat. VI 24819. 54ff. Copied by Ramaprasada 
at Alavara on Sunday 14 suklapk§a of Bhadra- 
pada in Sarn. 1905 = 2 September 1849. 

RORI (Alwar) 3630. 88ff. Copied by Madhava Brah- 
mana in Sarn. 1909 = a.d. 1852. 

At the end is the verse: 

nandadryadrindubhir var§aih kr§najanma§tamidine 
jato ramanibandho ’y^T dharmasastravicaratah / 
mata sripadmini yasya pita sribhavamandanas 
tena srik§emaramena nibandho ’yarn prakasitah // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


63 


The colophon begins; iti sridvipahcasadgranthi- 
dik§itababa tadatmajah srilokamanis tadatmajah 
sribhavamanc^anas tatputrah srik§emaramakrto. 

KHAGESVARA MISRA (fl. 1986) 

A lecturer at the Srisadasivakendriyasarnskrta- 
vidyapitha at Puri, Khagesvara wrote a tippani, 
Vijayasri, on the Kalacandrika of Dharmu Pathin, 
published at Puri in 1986. 

^KHANDERAYA 

Additional manuscripts of his Parasurdmapra- 
kdsa (see CESS A 4, 69a): 

Benares (1956) 13939. Ff. 1-292. Copied in Sarn. 

1697 = A.D. 1640. No author mentioned. 

Poona, Mandlik. Smrti and Dharma 115. 209ff. Cop¬ 
ied in Saka 1795 = a.d. 1873. 

Varendra 477. Ff. 1-75, 77-78, and 80-103. Bengali. 
Incomplete (acara and sraddha). 

^KHANA 

An unconvincing attempt to fix the date of 
Khana (see CESS A 2, 79b, and A 4, 69a) to about 
A.D. 900 was made by P. C. Sengupta [A5. 1955]. 
Additional manuscript: 

Varendra 271. Ff. 1-11 (after a Jyotihsdra). Bengali. 


mABBABA KHANAKHANA (1556/1627) 

Additional manuscripts of his Kfietakautuka (see 
CESS A 2, 79b-80a; A 3, 26a; and A 4’, 69a-69b): 

RORI (Alwar) 5468 (3). Ff. 8-9. Incomplete. (Akhe- 
(akautuka). No author mentioned. 

WHMRL K.3.j.tt. If. Incomplete (rajayoga 1-14). 

The Khefakautuka was also edited in J. B. Chau- 
dhuri [A2. 1954] pp. 26-52; there is an English 
translation on pp. 126-164. It was also published 
with the Hindi tika, Hemapu^pikd, of Syamadeva 
Jha as Gokuladdsa SG 61, Varanasi 1983. 


KHEJARAMA 

Author of a Vivdhapa(ala. Manuscript; 

RORI Cat. XVI 36451 (4). Ff. 66-80. Copied at 
Hara§ala in Sarn. 1920 = a.d. 1863. 


GANGACARYA 

Author of a Jhdnapradlpa. Manuscripts: 

BHU C.2891. 28ff. Incomplete. 

IM Calcutta 963. {Prasnaphala). See NCC, vol. 5, p. 
193. 


^'GANGADASA DVIVEDIN (or TRIVEDIN) 

Additional manuscripts of his Tithiprakdsa = 
Tithinirtiaya (see CESS A 2, 80b; A 3, 26a; and A 4, 
69b): 

RORI (Alwar) 3598. 6ff. Copied in Sarn. 1912 = 
A.D. 1855. 

RORI (Alwar) 3599. 5ff. Copied in Sam. 1912 = 
A.D. 1855. 

The 36th and last verse is: 

gahgadasadvivedena racitah sisusampade / 
nibandhasaram adaya so ’yam astu satam mude // 

GANGADHARA 

Author of a Ganita (the AmrtasdgarV.). Manu¬ 
script: 

Bhubaneswar 2.G/69. 


GANGADHARA 

Author of a Jyoti^aprakdsa. Manuscript: 

RORI (Alwar) 6245. 39ff. (f. 1 missing). Copied by 
Gujaramala. Incomplete. 


64 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GANGADHARA 

Author of a Tithimanohara. Manuscript: 

Oxford (Vyasa) 139. Ff. 1-6. Copied by Ramacandra 
Madhavaji Vyasa on Thursday 13 suklapak§a of 
Sravana I in Sarn. 1920, Saka 1785 = 30 July 
1863. (sarini; incomplete). 

The colophon begins: iti srigaiigadharena vira- 
cite. 

GANGADHARA CAKRAVARTIN 

Author of a tika, Bhavarthadipika, on the Srdd- 
dhataitva of Raghunandana {fl. 1520/1570). Manu¬ 
scripts: 

AS Bengal II.A.46. Bengali. 

lO 1437 (1237). 45ff. Bengali. From H. T. Cole- 
brooke. 

The last verse is: 

srilagahgadharenai§a rudrajham anupalanat // 
vyakhya krta katharn kirn cit kiyat kim uta 
kaimutam // 


^GANGADHARA {fl. 1420) 

Additional manuscripts of his Amrtasdgarl (see 
CESS A 2, 81a-82a; A 3, 26b; and A 4, 69b): 

*BORI 145 of 1871/72. 48ff. Copied on 9 kr§na- 
pak§a of Asvina in Sarn. 1742 = ca. 11 October 
1685. 

RORI (Chittorgarh) 4424. Ff. 39-40 and 42-46. 
Copied by Balacandra Svamin at Gavallara in 
Sam. 1847 = a.d. 1790. Incomplete. 

AS Bengal I.B.4. Bengali. 

*BORI 413 of 1884/86. lOOff. Copied by Ramasah- 
kara Lihgadakara, a resident of Surata. 

Jaipur (Khasmohor) 1326. 

Nagaur 1042. 97ff. 

Oxford CSS I 107 (*d. 798). Ff. 2-5, 7, 14, 19-54, 
57-63, and 66. Incomplete. 

RORI Cat. XVI 34892. 22ff. Incomplete. 

RORI Cat. XVI 35448. 9ff. Incomplete. 

RORI Cat. XVI 37143. 139ff. 

Vrndavana 462. 34ff. 

Note that *AS Bengal G. 10206 C contains not 


the Amrtasagari, but the Ganitamrta of Gahgadhara 
(fl. 1628/1653). 

^'GANGADHARA fl. 1586) 

Additional manuscripts of his Manorama on 
Ganesa’s Grahaldghava (see CESS A 2, 82a-82b): 

RORI Cat. IX 28289. 42ff. Copied by Abhairama 
Josi in Sarn. 1863 = a.d. 1806. 

Kathmandu (1964) 108 (2882). 37ff. 

He also wrote a tika, Manorama, on the Kunda- 
mandapadarpana of his father, Narayana fl. 
1571/1578). Manuscripts: 

AS Bombay 418. 16ff. Copied in Saka 1788 = a.d. 

1866. From Bhau Daji. 

BISM vi 40/32. See NCC, vol. 4, p. 181. 

The last two verses are: 

kundadarpanakartus ca narayanasya dhimatah / 
gahgadharakhyaputrena svalpamatya krta nu ya // 
kundadarpanatika sa svalpa manoramabhidha / 
ahgikarya budhaih prityai santo§tavyam madukti- 
tah // 

The colophon begins: iti srimadanantacaturmasya- 
yajiputranarayanagnicitsutagahgadharakrta. 

GANGADHARA fl. 1624) 

The son of Nrsirnha of the Bharadvajagotra and 
the Balakhillyanvaya, Gahgadhara completed the 
Utsavanirnayamahjarl in 14 adhyayas on Wednesday 
9 Caitra in Saka 1545 = 17 March 1624 at Pattana 
in Gujarat. Manuscript: 

Baroda 2375. 21ff. Copied by Lak§midhara, the son 
of isvara, a resident of Gaudala, on Wednesday 2 
suklapak§a of Asvina in Sam. 1866, Saka 1731 = 
11 October 1809. 

The Utsavanirnayamanjarl was edited from the 
unique manuscript in M. L. Wadekar [A5. 1987/88]. 
The final verses, 14, 24-25, are: 

bharadvajasagotrajo dvijavaro yo balakhillyanvaye 
vidyavrddhiyuto nrsirphatanayo gahgadharakhyah 
sudhih // 

teneyam racita hares ca krpaya sacchastra- 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


65 


sambodhini 

hy utsavanirnayamanjari tu trisatair vrttais tu 
rudradhikaih // 

sr i matkasyapanirmitasurasaritt i rasthasatpattane 
samsthah san nrpasalivahanasake pancabdhi- 
ghasronmite // 

caitre vai navamitithau budhadine pQrnikrta sa tu 
vai 

bhuyan maiigalakarini sukhakari haryanghripadme 
’rpita // 

^GANGADHARA (fl. 1627/1653) 

1. Additional manuscripts of his Prasnabhairava (see 
CESS A 2, 82b-83a, and A 4, 70a): 

RORI Cat. IX 29240. 29ff. Copied by K^emanara- 
yana at Jodhapura in Sarn. 1884 = a.d. 1827. No 
author mentioned. 

RORI (Jaipur) 10403. 6ff. Incomplete. 

3. Additional manuscript of his Grahasarinl (see 
CESS A 2, 83a-83b, and A 4, 70a): 

WRI 4745. Ff. 1-12. Incomplete (sarini). No 
author mentioned. 

4. Additional manuscript of his Muhurtalankara (see 
CESS A 2, 83b-84a): 

RORI Cat. XVI 36569. 84ff. Copied by Sankara, the 
son of Sukhadeva, a resident of Nantanapura, in 
Sam. 1839 = a.d. 1782. 

5. Additional information concerning a manuscript 
of his Tajikaratna (see CESS A 2, 84a-84b, and A 4, 
70a): 

*Poona, Mandlik. Jyotisha 26. 74ff. Copied in Sarn. 
1712 = A.D. 1655. 

7. Gahgadhara also wrote a Maunjibhii^aria in 72 
verses, which was published by K. K. Raikva in his 
Mauhjipaiala, Surata Saka 1858, Sarn. 1993 = A.D. 
1936, pp. 24-32. Verse 72 is: 

jyotirviddvijacakramukhyaganakah sribhairavo 
bhusuras 

tajjatena divakarat sumatina gahgadharenacirat / 
baddhe nutanajirnapadyanicayair mauhurtasarnjhe 
vare 

’laiikarena yute samaptim agaman maunjyadi- 
sadbhu§anam // 


8. Gahgadhara also wrote a Ganitamrta in 77 verses 
in Saka 1555 = a.d. 1633; it is based on the Ganesa- 
pak§a. Manuscripts: 

AS Bengal 6843 (G. 10206 C). 4ff. Incomplete. 
GOME Madras D. 17403. 58ff. With many tables. 

Verses 2 and 75-77 are: 

srimadbhairavadaivajnasunugahgadharah sudhih / 
paficahgagrahasiddhyartharn tanoti ganitamrtam HIH 
sarvasastrarnavamunir daivat kr§nakhya ity abhut / 
tatah sribhairavas tasya prathitas tanayo ’granih 

//75// 

gahgadharena tajjena saraniganitarn krtam / 
hitartharn ganakaryanam puratvam agamat tatah 

111611 

trisarendumite sake sampurnam ganitamrtam / 
dr^tvaitat panditas te§arn yantu yantv asi§o hi mam 

mill 


GANGADHARA PAJHAKA (fl. ca. 1675/1700) 

The son of Ramacandra Pathaka (who was the 
pupil of Harisahkara Diksita), the brother of Nara- 
yana Yajnika, and the grandfather of Devabhadra 
Pathaka (fl. 1755), Gahgadhara wrote a bha§ya on 
Katyayana’s Sulbasutra, which was completed by his 
son, Ramakrsna. The family, which belonged to the 
Nagarajhati, resided in Kasi. Manuscripts of the Sul- 
basutrabhasya: 

RORI (Alwar) 387 = Alwar 151 = Alwar (1884) 
Yajurveda 77. 90ff. Copied on Saturday 7 A§adha 
in Sarn. 1911 = 21 July 1855. 

RORI Cat. XVI 36559. 60ff. Copied by Sridhara at 
Varaiiasi in Sarn. 1983 = a.d. 1926. 

AS Bengal 973 (G. 5949) = AS Bengal I 2. 479. 
76ff. 

Benares (1953) 4098. Ff. 1-69. 

Benares (1953) 4299. Ff. 1-74. 

Mithila IV 28. 54ff. Property of Paridita Bacca Jha 
of Nabani, Tamuria, Darbhanga. 

PUL I App. 51. 65ff. 

Verses 1-2 at the beginning are: 

jayaty eko jagatyarn sriharisahkaradik§itah / 
trayisaravivektrsriramacandraguror guruh // 
ramacandragururn natva gargakarkadiyajhikan / 
srikatyayanasulbasya kurve bha§yam idarn sphu- 
fam // 


66 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The last 3 verses are: 

ramacandratanujena srigahgadharasarmabhih / 
pitrcaranaih sutre ’smin katiye sulbasarnjhake //!// 
vivrtarn yat tatah si^larn tad iha vivrtarn maya / 
gahgadharatanujena ramakr^nena dhimata HIH 
nagarajhatisarnjnena kasipuranivasina / 
yajhikas tena tu§yantu priyatarn yajnabhug vibhuh 
//3// 


*GANGADHARA (fl. 1685) 

Verses 2-3 at the beginning of his Bhasvatl (ika 
(see CESS A 2, 85a) give his father’s name cor¬ 
ruptly—Vidhicandra?—and state that his father lived 
at Sanmanaka in Kuruk^etra, and that the Bhasvau- 
ilka was completed on Sunday 5 suklapak§a of Bha- 
drapada in Saka 1607 = 23 August 1685. 

pascad yat kuruk§etratah puravararn sanmana- 
kakhyam subham 

tasminn eva grhe t bhavatu yo vidhicandrajyotir- 
vit t/ 

tatsunus tu tadaiighriyugmabhajanal labdhava- 
bodhamsakah 

siddhante§u parisramo dvijavaro gahgadharakhyah 
sudhih HIH 

sake cadrikhatarkabhuparimite mase tatha bhadrake 
sukle banatithau mrgahkadivase se§e ’dhitulye dine / 
kurve buddhitaraiigatah pitrpadadvandvatmabhaktau 
rato 

bhasvatya hy udahrtim ca vivrtirn vyaktam satarn 
pritaye //3// 

Additional information concerning manuscripts 
of the Bhasvafi flkd: 

RORI (Alwar) 2657 = *Alwar 1883. 95ff. Copied in 
Sam. 1912 = a.d. 1855. 

Oxford CSS I 29 (*c. 317). Ff. <2-4> and 5-22. 
Incomplete (begins in 2, 3). 

GANGADHARANANDA 

Author of a Kunddnkusa published in the Kun- 
dagranthavimsati, Bombay Saka 1809 = A.D. 1887 
(lO 13.H.15) as item 12; and with the Mandapakun- 
dasiddhi of Vitthala Dik$ita at Bombay in Sarn. 
1973 = A.D. 1916 (lO 28.K.33). 


^GANGARAMA 

Additional manuscripts of his Yuddhajayotsava 
(see CESS A 2, 86a-86b; A 3, 26b; and A 4, 70b): 

RORI (Alwar) 3016 = * Alwar 1917. 29ff. Copied in 
Sarn. 1862 = a.d. 1805. 

RORI (Udaipur) 3500. 13ff. Copied in Sarn. 1875 = 
A.D. 1818. 

NFS (Sanskrit) 8078. 23ff. 

Vrndavana 8607. 29ff. 


^GANGARAMA JADE {fl. 1715/1770) 

Additional manuscript of his Tithinirnayasdra- 
sahgrahaslokavivrti (see CESS A 4, 71a): 

RORI (Alwar) 3616. 72ff. Copied in Sarn. 1900 = 
A.D. 1843. 


^GANGARAMA DVIVEDA (/?. 1718) 

Additional manuscripts of his Ratnadyota (see 
CESS A 2, 86b-87a; A 3, 27a; and A 4, 71a-71b): 

GJRI 8622/847. Ff. 3-13. Copied in Sam. 1916 = 
A.D. 1859. Incomplete. 

NFS (Sanskrit) 8941. Ff. 1-27. Copied on Sunday 4 
suklapak§a of Fau§a in Sam. 1941 = 21 Decem¬ 
ber 1884. No author mentioned. 

BHU C.1747. 3ff. 

Oxford CSS I 456 (*d. 785 (6)). Ff. 1-35. Incom¬ 
plete. 

Oxford CSS I 457 (*d. 807 (1)). Ff. 1-15. 

The Ratnadyota was edited with the Hind! tika, 
Ratnaprakdsikd, of Sarayuprasada Fandeya at Vara¬ 
nasi [N.D.] (the tika was completed in 1927). 

Gahgarama also wrote a Ydgakdlaviveka = 
Haviryajhakdlanirnaya. Manuscripts: 

Baroda 10475. 57ff. 

Kerala - (1779). 

FUL I Srauta 525. 58ff. 


GANGARAMA PAUNDARIKA (b. 10 January 1696) 

Ferhaps the author of the Ni^ekddhydyavivrti, a 
tika on prakasa 5 of Samarasimha’s Tdjikatantra- 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


67 


Sara, in which is given as an udaharana the nativity 
of Gahgarama Paundarika at Madhupuri on Friday 
2 kr§napak§a of Pau§a in Sarn. 1752, Saka 1617 = 
10 January 1696, and which mentions a battle fought 
in Sarn. 1782 = A.D. 1725. Manuscripts: 

Bombay U 426. Ff. 1-9. Acquired from Bharatpur 
through Bhajan Lai of Amritsar. 

Bombay U Desai 1370 II. Ff. 2v-7. Copied by 
Raghunatha BhaUa at Kasi. 


GANGAVl$NU 

Author of a Sarani {= Manuscript: 

IM Calcutta 1058. See NCC, vol. 5, p. 217. 


GANGASOMA 

Author of a Kamadhenusaranl. Manuscript: 

Kathmandu (1964) 36 (7408). 22ff. Copied at Mala- 
vak§etra on Monday 7 kr§napak§a of Pau§a in 
Sarn. 1820, Saka 1684 (the date is irregular). 
(Gaiigasoma). 

GAJANANDA {fl. 1853) 

Author of a Vivdhabhu^ana at Jayapura in Sarn. 
1910 = A.D. 1853; cf. the Vivahavidhi compiled by 
Gajananarava Bhaskara, recorded in NCC, vol. 5, p. 
231. Manuscript of the Vivdhabhusaria: 

RORI Cat. XVI 36674. llff. Copied in Sam. 1923 = 
A.D. 1866. 


*GANAPATI 

Additional manuscript of his Ganapatisara (see 
CESS A 2, 87b): 

RORI (Alwar) 6194. lOff. Copied by Lak§mana 
Pandita in Sam. 1913 = A.D. 1856. 


*GANAPATl 

Additional information concerning the manu¬ 
script of his Pahcapak^ibrahmavicara (see CESS A 
4, 71b): 


RORI (Udaipur) 578. 8ff. Copied at Kailasasikhara. 


*GAI)IAPATI 

Additional manuscripts of his Ratnadlpa (see 
CESS A 2, 88a-89a; A 3, 27a; and A 4, 71b): 

Udaipur RVSS 88. 13ff. Copied in Sarn. 1799 = a.d. 
1742. Incomplete (bhavadhyaya). No author men¬ 
tioned. 

Mysore ORI *C.885. Ff. 1-11. Copied on Friday 14 
suklapak§a of Sravana in Sam. 1861 = 9 August 
1805. 

BHU C.647. 8ff. Copied in Sam. 1900 = a.d. 1843. 
BHU B.4302. 14ff. Copied in Sam. 1939 = a.d. 
1882. Incomplete. 

Udaipur RVSS 856. 17ff. Copied by Indraji in Sarn. 

1940 = A.D. 1883. Ascribed to Ganesa. 

Udaipur RVSS 860. 30ff. (f. 13 missing). Copied by 
Ramacandra BhaUa in Sarn. 1941 = a.d. 1884. 
Incomplete. Ascribed to Ganesa. 

AS Bengal III.G.48. 

RORI Cat. V 22657. 6ff. 

RORI Cat. VIII 28057 (15). Ff. 112-117. 

RORI Cat. VIII 28057 (19). Ff. 132-134. 

RORI Cat. XVI 35974. 12ff. 

RORI (Alwar) 2741. 18ff. Incomplete. 

RORI (Alwar) 2742. 24ff. Incomplete. 

RORI (Udaipur) 544. 13ff. 


GANAPATI (fl. 1529) 

See Ganesa (fl. 1529). 


^GANAPATl RAVALA (fl. 1686) 

Additional manuscripts of his Muhiirtaganapati 
(see CESS A 2, 89b-92a; A 3, 27a-27b; and A 4, 
71b-72a); the Parvanirnaya is dealt with separately: 

Oxford CSS I 453 (*d. 794 (2)). Ff. 1-58 and 61-78. 
Copied on 4 suklapak§a of Vaisakha in Saka 
1654 = ca. 16 April 1732. Incomplete (18, 
69-19, 2 missing). 

RORI (Udaipur) 507. 126ff. Copied in Sarn. 1812 = 
a.d.1755. 

RORI Cat. VII 25230. 119ff. (f. 32 missing). Copied 
by Hariprasada Sarman in Sarn. 1837 = a.d. 
1780. Incomplete. 

BHU B.803. 89ff. Copied in Sam. 1848 = a.d. 1791. 


68 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 3330. 82ff. Copied by Govindarama 
at Dravyapura in Sarn. 1857 = a.d. 1800. 

Vrndavana 7157. llff. Copied by Dharamadasa 
Misra at Gajipura in Sarn. 1899 = a.d. 1842. No 
author mentioned. 

RORI (Jaipur) 2394. 63ff. Copied by Bhairavananda 
Brahmana at Toiika in Sam. 1907 = a.d. 1850. 

Vrndavana 3420. 18ff. Copied by Sivanarayana in 
Sarn. 1910 = a.d. 1853. Incomplete (vivaha). No 
author mentioned. 

Vrndavana 9830. Ff. 1-42; and 1-3, 5, 9-59, and 
61-89. Copied by Jugalakisora Misra in Sam. 
1924 = A.D. 1867. Incomplete. 

RORI Cat. IV 19123. 114ff. (ff. 48-49 and 68 
repeated). Copied by Narayana Josi at Tonka in 
Sam. 1936 = a.d. 1879. 

BHU C.3160. 52ff. Incomplete. 

Jammu 77-Ga. No ff. given. 

Mysore ORI C.2630. Ff. 1-11. {Muhurtasangraha). 

Mysore ORI C.4683/33. Ff. 10-13. Incomplete (pra- 
karanas 3-4). 

Mysore ORI P.7847. Ff. 1-23. Nandinagari and 
Kannada. Incomplete. 

Mysore ORI P.9789. Ff. 34-131. Nandinagari. 
Incomplete (prakaranas 2-22). 

NPS (Sanskrit) 8808. 4ff. Incomplete. 

Oxford CSS I 454 (*d. 749). Ff. 23-164, 168-179, 
181-184, 185/186, 187-208, 210-226, and 

228-246. Copied by Govindarama Jyotir- 
vidananda at Kasi. Incomplete. 

Oxford CSS I 455 (*d. 760 (2)). Ff. 1-105. 

RORI Cat. XVI 35312. 57ff. 

RORI (Alwar) 2901. 156ff. 

RORI (Alwar) 2902. 151ff. 

RORI (Jaipur) 3429. 104ff. (ff. 30, 32-33, 38, 40-48, 
63-74, and 77-91 missing). Incomplete. 

RORI (Udaipur) 3383. 18ff. Incomplete. 

RORI (Udaipur) 6496. 149ff. (ff. 121-122 missing; f. 
130 repeated). Incomplete. 

RORI (Udaipur) 6502. 14ff. Incomplete (sahkranti). 

Vrndavana 998. 13ff. Bengali. No author men¬ 
tioned. 

Additional manuscripts of his Parvanirnaya, com¬ 
posed in Sam. 1742 = a.d. 1686, the year of the 

composition of the Muhurtaganapati with which it 

has been listed in previous volumes of CESS: 

BHU B.634. 17ff. Copied in Sam. 1746 = a.d. 1689. 

Benares (1953) 4328. Ff. 1-21. Copied in Sarn. 1777 
= A.D. 1720. 

AS Bengal I 3. 267 = IM Calcutta 2377. Ff. 1-8. 


Copied in Saka 1761 = a.d. 1839. 

RORI (Alwar) 416. 40ff.; and 4ff. Copied in Sarn. 
1910 = A.D. 1853. 

DC 2735. Ff. 4-82. {TithiniriT,aya (?) of Ravala). 
Kavindracarya 534. See NCC, vol. 11, p. 242. 

Additional manuscripts of his Santiganapati = 
Grahasantipaddhati (see CESS A 4, 72a): 

RORI (Udaipur) 6417. 18ff. Copied by Murtarama 
Vyasa, the son of Ambikesvara, in Sarn. 1804 = 
A.D. 1747. Incomplete. 

PrSB 3117 (Berlin or. oct. 828). 16ff. Copied for 
Udayalala on Monday 6 kr§napak§a of Vaisakha 
in Sam. 1837 = 14 May 1781. 

RORI (Udaipur) 4910. Ff. 1-44. Copied in Sam. 
1843 = A.D. 1786. 

RORI (Jaipur) 2877. 97ff. (f. 33 missing). Copied in 
Sam. 1870 = a.d. 1813. Incomplete. 

RORI (Udaipur) 4905. Ff. 1-4 and 13-41. Copied by 
Jagannatha Suratanya in Sarn. 1879 = a.d. 1822. 
Incomplete. 

RORI (Udaipur) 6195. 64ff. Copied in Sam. 1889 = 
A.D. 1832. 

RORI (Udaipur) 6233. 25ff. Copied by Ramanara- 
yana Misra in Sarn. 1904 = a.d. 1847. 

BORI 97 of 1892/95 = BORI (Dharma) 408. 84ff. 
Copied by Ambalala on 6 kr§napak§a of Sravana 
in Sarn. 1928 = ca. 6 August 1871. 

Florence (Add.) 814. Ff. 1-16. 

Rajputana, p. 4. At Indore. 

RORI (Chittorgarh) 302. 27ff. (ff. 1-11 missing). 
Incomplete. 

RORI (Jaipur) 4277. 29ff. (ff. 9-10 and 17-19 miss¬ 
ing). Incomplete. 

RORI (Udaipur) 6410. lOff. Incomplete. 


GANAPAYYA (/?. 1893) 

Author of a Vastusarasahgraha in Telugu. Manu¬ 
scripts: 

Mysore ORI P.1892. Ff. 1-65. Telugu. 

Mysore ORI P.7115. Ff. 1-43. Telugu. 

He also wrote a Srikr^navdstu in Telugu on 21 
September 1893. Manuscript: 

Mysore ORI P.7366. Ff. 1-82. Telugu. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


69 


GANESA 

Author of a KMamlmamsaprakarana. Manu¬ 
script: 

BHU C.5344. 23ff. Incomplete. 

^GANESA 

His K^etraganita (see CESS A 2, 92b-93a) is a 
prose commentary on verses 39-47 of the Mandapa- 
kundasiddhi composed by Vitthala Dik^ita in 1619. 
It was edited from the unique manuscript by T. 
Hayashi [A5. 1986a]. 

GANESA 

The son of Rama, Ganesa wrote a Muhurtaratna 
Manuscript: 

VSM (Upadhye) 12808. 20ff. 

GANESA DAIVAJNA 

Author of a Camatkdracintamani. Manuscript: 

Jodhpur 795. 8ff. Copied by Muktivijaya at Samdadi 
in Sarn. 1788 = a.d. 1731. With a Rajasthani 
tika. Incomplete (strijataka). 

This may be identical with the Strijataka of 
Ganesa (see CESS A 2, 93b). 

GANESA DAIVAJNA 

Author of a Jyotisasahgraha. Manuscript: 

GJRI 8397/622. Ff. 1-12. Maithili. Incomplete. 

GANESA SOMAYAJIN 

Author of a Ganesakarika on sulba. Manuscripts: 

Berlin 1455 (or. fol. 878). 16ff. Copied by 

Baladik§ita Godabola on Friday 6 suklapak§a of 
Asvina in Saka 1694 = 2 October 1772. (Caya- 
nakdrikdf}). 

Wai 2683. 16ff. Copied in Saka 1704 = a.d. 1782. 


{Cayanakdrikd according to Hiranyakesin). 

Adyar Cat. 33 E 2. 8pp. Grantha. 

Adyar Cat. 33 M 1. 13pp. Grantha. 

Baroda 6383 (c). Ff. 28-31. Grantha. Incomplete. 
Kerala - (5755 D). See NCC, vol. 5, p. 269. 

The last verse is: 

hiranyakesisutre ’gneh 
parasyenasya yuktitah // 
somayajiganesena 
racitas tasya karikah // 

^GANESA (b. 1507) 

1. Additional manuscripts of his Grahalaghava (see 
CESS A 2, 94a-100a; A 3, 27b-28a; and A 4, 
72a-74a): 

Jaipur (Khasmohor) 4955. Copied in Sarn. 1653 = 
A.D. 1596. 

Oxford CSS I 36 (*d. 750 (5)). Ff. 1-17. Copied on 
4 krsnapak§a of Asadha in Sarn. 1673 = ca. 23 
June 1616. Incomplete (ends in 15, 12). 

RORI Cat. VI 24294. 71ff. Copied in Sam. 1713 = 
A.D. 1656. With the fika of Visvanatha. 

RORI (Bikaner) 14666. 47ff. Copied by Samayani- 
dhana at Sarasa in Sarn. 1732 = a.d. 1675. With 
the tika of Visvanatha. 

RORI Cat. XVI 36772. 179ff. (f. 1 missing); and 3ff. 
with an anukramanika. Copied in Sam. 1751 = 
A.D. 1694. With the tika of Mallari. Incomplete. 
RORI (Chittorgarh) 2344. 22ff. (ff. 1-2 missing). 

Copied in Sarn. 1758 = a.d. 1701. Incomplete. 
RORI (Chittorgarh) 576. llff. Copied by 
Lak§micandra Muni at Kusumapura in Sarn. 
1763 = A.D. 1706. 

RORI (Udaipur) 3610 (1). Ff. 9-102. Copied in 
Sarn. 1768 = a.d. 1711. With the tika of Visva¬ 
natha. 

RORI (Udaipur) 6443. 28ff. Copied by Manojnasa- 
gara at Indraprastha in Sarn. 1780 = a.d. 1723. 
With a tippana. Incomplete (adhikara 5). 

RORI (Jaipur) 5497 (2). 27ff. (ff. 1-12 missing). 

Copied in Sarn. 1790 = a.d. 1733. Incomplete. 
Oxford CSS I 37 (*d. 768 (1)). Ff. 1-17. Copied on 
Friday 10 suklapak§a of Vaisakha in Sarn. 1793 
= 9 April 1736. 

Oxford CSS I 38 (*d. 746 (1)). Ff. 1-22. Copied by 
Sukhanandana on Saturday 14 suklapak§a of 
Madhava in Sarn. 1795 = 22 April 1738. Incom¬ 
plete (adhyayas 1-15). 


70 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oxford CSS I 39 (c. 315 (2)). Ff. 1-16. Copied by 
Jagannatha Misra on Saturday 1 suklapak§a of 
Pau§a in Sarn. 1801, Saka 1666 = 22 December 
1744. With the fika of Visvanatha. 

RORI Cat. Ill 12896. 7ff. Copied by Bhanavijaya at 
Cobari in Sarn. 1821 = a.d. 1764. Incomplete 
(spa^fagrahavidhi). 

RORI Cat. VI 23967. 18ff. Copied in Sam. 1824 = 
A.D. 1767. 

RORI (Bikaner) 15874. 15ff. Copied by Yuktidhira 
at Vikramapura in Sarn. 1829 = A.D. 1772. 

RORI (Bikaner) 17382. lOff. Copied by Vrddhi- 
canda in Sarn. 1829 = a.d. 1772. With a Raja¬ 
sthani stabaka. Incomplete (ends in adhyaya 3). 

RORI (Chittorgarh) 4659. 9ff. Copied by Gumanavi- 
jaya Muni in Sarn. 1830 = a.d.1773. With a sta¬ 
baka on ff. 1-2. 

Mysore ORI C.4070/1. 52ff. Copied by Rama, the 
son of Lak§abhatta, a resident of Mudholagrama, 
on Friday 1 suklapak^a of Bhadrapada in Saka 
1698 = 13 September 1776. 

BHU C.2234. 19ff. Copied in Sam. 1838 = a.d. 
1781. Incomplete. 

RORI Cat. IV 19116. 56ff. (ff. 2-3 missing). Copied 
by Sivanatha, the son of Ramaji Misra, at Toiika 
in Sarn. 1844 = A.D. 1787. With the fika of Vis- 
vanMha. 

RORI (Jaipur) 2603. 116ff. (ff. 1, 98-111, and 115 
missing). Copied by Udayarama Gauda in Sam. 
1845 = A.D. 1788. With the tika of Mallari. 
Incomplete. 

RORI (Chittorgarh) 1434. 12ff. Copied in Sarn. 1846 
= A.D. 1789. Incomplete (suryaspa^fakarana- 
sarani). 

Oxford CSS I 40 (*d. 791 (1)). Ff. 1-26. Copied by 
Manasarama Gaduve at Kasi on Sunday 1 sukla- 
pak§a of Karttika in Sam. 1847, Saka 1712 = 7 
November 1790. 

RORI (Bikaner) 17376. llff. Copied in Sarn. 1850 
= A.D. 1793. Incomplete. 

RORI (Chittorgarh) 2571. 7ff. Copied by Gaiiga- 
vi§nu at Vi^adharapura in Sam. 1852 = a.d. 
1795. 

RORI (Jaipur) 3614. 25ff. (f. 1 missing). Copied by 
Gulabaraya Pandya in Sarn. 1852 = a.d. 1795. 
Incomplete. 

Kathmandu (1964) 94 (2868). 45ff. Copied on a 
Sunday in the kr§napak§a of Bhadrapada in Saka 
1718 = 18 or 25 September or 1 October 1796. 

RORI (Chittorgarh) 578. 14ff. Copied by Vadana- 
canda in Sarn. 1854 = a.d. 1797. With a stabaka. 

RORI Cat. Ill 13918. 12ff. Copied by Ramavijaya, 
the pupil of RQpaviJaya, in Sam. 1857 = a.d. 
1800. With an Old Rajasthani stabaka. Incom¬ 


plete (to adhyaya 3). 

RORI Cat. IX 28289. 42ff. Copied by Abhairama 
Josi in Sarn. 1863 = A.D. 1806. With the fika of 
Gahgadhara. 

Kathmandu (1964) 93 (2873). 24ff. Copied by Cires- 
vara on a Saturday in the kr§napak§a of Pau§a in 
Sarn. 1869, Saka 1734 = 17 or 30 January 1813. 

RORI Cat. IV 18800. 18ff. (ff. 6-9 missing). Copied 
by Narayana at Tonka in Sam. 1883 = a.d. 1826. 

RORI Cat. XVI 34991. 9ff. Copied in Sam. 1886 = 
A.D. 1829. Ascribed to Kesava. 

RORI (Jaipur) 10984. 28ff. (f. 15 missing). Copied 
by Mayura BhaUa in Sam. 1890 = a.d. 1833. 
Incomplete. 

Oxford CSS I 41 (d.. 774 (6)). Ff. 1-26. Copied on 
Tuesday amavasi of the kr§napak§a of Pau§a in 
Sarn. 1891 = 13 January 1835. 

RORI Cat. XVI 34296. 16ff. (f. 12 missing). Copied 
in Sarn. 1895 = A.D. 1838. With a stabaka. 

RORI (Chittorgarh) 1427. 6ff. Copied by Guru Moti 
at Govindagadha in Sam. 1895 = a.d. 1838. 
Incomplete (chayadhikara). 

RORI (Jaipur) 2266. 15fU Copied by Campalala 
Josi in Sarn. 1895 = a.d. 1838. 

Oxford CSS I 42 (d. 748). Ff. 1-61, 32 (= 62), and 
63-128. Copied on 30 kr§napak§a of Bhadrapada 
in Sarn. 1896, Saka 1761 = ca. 7 October 1839. 
With the tika of Visvanatha. 

VSM (Upadhye) 12765. 2ff. Copied in Saka 1765 = 
A.D. 1843. Incomplete (suryagrahana). With a 
kalarnsaganita. 

RORI Cat. IV 19126. 129ff. Copied by Sivanarayana 
at Kasi in Sarn. 1904 = a.d. 1847. With the tika 
of Visvanatha. 

RORI Cat. XVI 37186. 18ff. (as serial 2933), 14ff. 
(as serial 3077). Copied by Amrtalala in Sam. 
1905 = A.D. 1848. Incomplete (candra- 

darsanadhikara). 

RORI Cat. XVI 37187. lOff. Copied in Sam. 1905 = 
A.D. 1848. Incomplete (grahanaparvanayanadhi- 
kara). 

NPS (Sanskrit) 8509. 15ff. Copied on 13 suklapak^a 
of Phalguna in Saka 1777 = ca. 18 February 

1856. 

Vrndavana 8494. 25ff. Copied in Sam. 1914 = a.d. 

1857. 

Kathmandu (1964) 97 (2897). 107ff. Copied on 
Thursday 12 kr§napak§a of A$adha in Sam. 
1915, Saka 1779 = 6 August 1858. With the tika 
of Visvanatha. 

RORI (Chittorgarh) 1757. 13ff. Copied by 

Camanirama in Sarn. 1946 = a.d. 1889. Incom¬ 
plete (to adhikara 3). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


71 


RORI (Udaipur) 4374. Ff. 9-89 and 91-92. Copied 
in Sarn. 1958 = a.d. 1901. Incomplete. 

ABSP 1302. 2ff. Incomplete (10, 1-13, 2). 

AS Bombay 215. 14ff. With the tika of Visvanatha. 
Incomplete (adhikara 9). From Bhau Daji. 

BHU B.257. 23ff. Incomplete. 

BHU C.84. 154ff. With the fika of Mallari. 

BHU C.148. 39ff. Sarada. With the fika of Visvana¬ 
tha. Incomplete. 

BHU C.266. 23ff. Sarada. Incomplete. 

BHU C.320. 82ff. Sarada. With the fika of Visvana¬ 
tha. 

BHU C.842. 23ff. 

BHU C.843. 47ff. With the tika of Visvanatha. 

BHU C.1363. 6ff. 

BHU C.1461. 40ff. With the fika of Visvanatha. 
Incomplete. 

BHU C.3175. 16ff. Incomplete. No author men¬ 
tioned. 

GJRI 8312/537. Ff. 1-12. 

GJRI 8313/538. Ff. 1-29. Maithili. Incomplete (ends 
with grahanadhikara). 

Jaipur (Khasmohor) 1086; 5086 (ascribed to Kesa- 
va); 5314; 5319; 5394; and 5530. 

Jodhpur 789 (A). 6ff. (f. 1 missing). Incomplete. 

Kathmandu (1964) 91 (2872). 27ff. Incomplete (ends 
with pahcaiigadhikara). 

Kathmandu (1964) 92 (2869). 20ff. Incomplete (ends 
with aharganotpannadhikara). 

Kathmandu (1964) 95 (7069). 12ff. 

Kathmandu (1964) 96 (2871). 14ff. 

Mysore (1905) 630. 9pp. Telugu. 

Mysore ORI C.599/2. Ff. 1-54. Incomplete (diksa- 
dhana to khecaradarsana). 

Mysore ORI C.4060/2. Ff. 1-2. Incomplete. 

Mysore ORI C.4700/22. Ff. 75-75 (sic!). Nandina- 
gari. Incomplete (end only). 

Mysore ORI *P.2263/I. Ff. 1-166. Telugu. 

Mysore ORI *P.2568/4. Ff. 20-40. Kannada. 

Mysore ORI P.3771/12. Ff. 152-163. Grantha. 
Incomplete (adhikaras 1-6). 

Mysore ORI P.5163/1. Ff. 1-18. Grantha. Incom¬ 
plete. 

Mysore ORI P.7101/1. Ff. 1-7. Nandinagari and 
Telugu. Incomplete (adhikara 1). 

Mysore ORI P.8016. Ff. 1-13. Nandinagari and 
Telugu. Incomplete (end of suryagrahanadhi- 
kara). 

Mysore ORI P.8283/1. If. Telugu. Incomplete 
(verses 1-11). 

Mysore ORI P.10334. Ff. 1-15. Nandinagari and 
Telugu. 

New Delhi, N M 63/899. 42ff. 

NPS (Sanskrit) 9048. Ff. 1-17 and 19-22. Incom¬ 


plete. 

Oxford CSS I 43 (c. 316 (8)). Ff. 2-16, 16b (= 17), 
and 18-21; and ff. 1-6, 8-9 (= 7-8), 9b, 10-11, 
and < 12-13>. With the tika of Mallari. Incom¬ 
plete. 

Oxford CSS I 44 (*d. 766 (10)). Ff. 1-32. 

Oxford CSS I 45 (d. 766 (8)). Ff. 1-19 and 21-22. 

Oxford CSS I 46 (*d. 924 (12) A I). Ff. 4-5, <6>, 
7, 11, 16-17, 19, and <20>. Bengali. Incom¬ 
plete (1, 16-3, 14; 4, 1-8; 6, 4-7, 11; and 7, 17-9, 
2 ). 

Oxford CSS I 47 (*e. 143 (1)). Ff. 1-17, 17b (= 18), 
and 19-20. Incomplete (adhyayas 1-8). 

Oxford (Vyasa) 162. Ff. 1-5. Incomplete (ends in 3, 
17). 

Panjab JB I 749 (Nakodar 394). ll.ff. No author 
mentioned. 

Pattan II 13314. 127ff. With the tika of Mallari. 

*Poleman 4690 (Columbia, Smith Indie 88). Ff. 
1-12. Incomplete (adhikaras 1-4). 

PrSB 3587 (Berlin or. oct. 761). 29ff. 

PrSB 3588 (Berlin or. oct. 827). 24ff. Copied by 
Ramakr§na Moresvara Pathaka. 

PrSB 3589 (Berlin or. 6238). 86ff. Telugu. With the 
tika of Visvanatha. 

PrSB 3590 (Berlin or. fol. 2436). 17ff. With the tika 
of Visvanatha. Incomplete (adhikaras 5-6). 

RORI Cat. Ill 11021. 9ff. With a stabaka in Old 
Rajasthani. Incomplete. 

RORI Cat. IV 18774. 47ff. With the tika of Visva¬ 
natha. 

RORI Cat. IV 20870. 16ff. With the tika of Visva¬ 
natha. Incomplete. 

RORI Cat. VI 23752. 9ff. Incomplete (to adhikara 

4). 

RORI Cat. VI 24985. Ff. 2-11, 13-70, and 72-80. 
With a tika. Incomplete. 

RORI Cat. IX 28690. 93ff. With the tika of Visva¬ 
natha. 

RORI Cat. IX 28700. 29ff. With the tika of Visva¬ 
natha. 

RORI Cat. IX 29272. 25ff. With a tika. 

RORI Cat. IX 29768. 35ff. (f. 1 missing). With the 
tika of Nrsirnha. Incomplete. 

RORI Cat. XVI 34332. 26ff. With the tika of Visva¬ 
natha. 

RORI Cat. XVI 34365. 14ff. With the tika of Visva¬ 
natha. 

RORI (Alwar) 2628. 122ff. With the tika of Visva¬ 
natha. 

RORI (Alwar) 6157. 37ff. With the tika of Visvana¬ 
tha. Incomplete. 

RORI (Bikaner) 14695. 6ff. Incomplete. 


72 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Bikaner) 14715. 3ff. Incomplete (bhaumadi- 
spa§ta). 

RORI (Bikaner) 16993. 14ff. With a Rajasthani 
artha. 

RORI (Bikaner) 16995. lOff. Incomplete. 

RORI (Bikaner) 17144. 6ff. Copied by Udayacanda. 

RORI (Bikaner) 17220. 13ff. 

RORI (Chittorgarh) 268. 2ff. Incomplete (suryagra- 
hanadhikara). 

RORI (Chittorgarh) 1503. Ff. 12-14. Incomplete 
(spa^tadhikara). 

RORI (Chittorgarh) 1779. 3 Iff. 

RORI (Chittorgarh) 2132. 8ff. Incomplete (to adhi- 
kara 4). 

RORI (Chittorgarh) 2237. 6ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Chittorgarh) 2765. 13ff. With a Rajasthani 
stabaka. 

RORI (Chittorgarh) 2949. 16ff. Incomplete (to adhi- 
kara 3). 

RORI (Chittorgarh) 4111. lOff. (ff. 1-2 missing). 
Incomplete. 

RORI (Chittorgarh) 4157. F. 8. Incomplete. 

RORI (Chittorgarh) 4304. 21ff. With a fika. Incom¬ 
plete. 

RORI (Chittorgarh) 4784. 23ff. With the Rajasthani 
stabaka of Caturavijaya. 

RORI (Jaipur) 2560. 19ff. Incomplete (begins with 
masagana and ends with nalikabandhana). 

RORI (Jaipur) 2956. 19ff. (ff. 11, 17, and 20 miss¬ 
ing). With a Hindi stabaka. Incomplete. 

RORI (Jaipur) 3369. 3ff. 

RORI (Jaipur) 3394. 7ff. (f. 1 missing). Incomplete. 

RORI (Jaipur) 3854. 16ff. 

RORI (Jaipur) 4480. If. Incomplete (candragra- 
hana). 

RORI (Jaipur) 4762. 13ff. 

RORI (Jaipur) 5497 (1). 15ff. Incomplete. 

RORI (Jaipur) 5642. 16ff. (f. 1 missing). With a 
tika. Incomplete. 

RORI (Jaipur) 8586. 14ff. Incomplete. 

RORI (Jaipur) 9018. 32ff. (ff. 1-5 missing). Incom¬ 
plete. 

RORI (Jaipur) 9081. If. Incomplete (pMadhyaya). 

RORI (Jaipur) 9240. 7ff. (ff. 3-4 missing). Incom¬ 
plete (pancataraspa^fikarana). No author men¬ 
tioned. 

RORI (Jaipur) 10433. 12ff. (f. 5 missing). Incom¬ 
plete. 

RORI (Udaipur) 4724. Ff. 1-4. Incomplete (madh- 
yamadhikara). 

RORI (Udaipur) 4773. Ff. 1-5. With a Rajasthani 
tika. 

RORI (Udaipur) 4801. Ff. 1-10. Incomplete. 


RORI (Udaipur) 5192. Ff. 1-95. With the tika of 
Nrsirnha. Incomplete. 

RORI (Udaipur) 5209. 25ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Udaipur) 5575. 4ff. 

RORI (Udaipur) 6203. 7ff. Incomplete. 

RORI (Udaipur) 6236. llff. 

RORI (Udaipur) 6414. llff. Incomplete. 

RORI (Udaipur) 6461. 7ff. (f. 2 missing). Incom¬ 
plete. 

Udaipur RVSS 1616. 20ff. (ff. 2-4 and 17-18 miss¬ 
ing). Incomplete. 

Visvabharati (Adyar) 733 (c). 8ff. Telugu. 

Vrndavana 1570. 6ff. Incomplete. 

Vrndavana 1880. 8ff. Bengali. 

Vrndavana 3619. 19ff. 

Vrndavana 3621. 22ff. 

Vrndavana 3696. 14ff. Incomplete. 

Vrndavana 6635. 6ff. No author mentioned. 
Vrndavana 8479. 14ff. Incomplete. 

Vrndavana 8862. 21ff. Incomplete (adhikaras 1-8). 
Vrndavana 9703. 6ff. Incomplete. 

Vrndavana (micro) 1150. 14ff. Property of Hari- 
sahkara Dasa of Vrndavana. 

VSM (Upadhye) 12784. Ff. 1 and 10-12. Incom¬ 
plete. 

*WHMRL K.2.f. Ff. 8-14, 16, 20-24, 26-34, and 
36-39. Incomplete (3, 5-4, 13; 4, 15-23; 6, 3-8, 
3; 9, 1-14, 3; 14, 8-15, 14; and 16, 4). 

WHMRL j3 304. Ff. 1-12. Incomplete (adhikaras 
1-3). With an interlinear tika. 

*WHMRL M.2.a (7 230). Ff. 1-10. Incomplete 
(ends after 4, 10). 

The Grahalaghava with the tikas of Mallari and 
Visvanatha was edited with his own Hindi vyakhya 
by Kedaradatta Josi, Dilli-Varanasi-Patana 1983; 
with his own anvaya and Hindi tika by Ramasva- 
rupa, Bambai 1987; and with his own anvaya and 
Sarnskrta (Tara) and Hindi tikas by Brahmananda 
Tripathin as CSG 125, Varanasi 1987. 

2. Additional manuscripts of his Patasaranl (see 
CESS A 2, 100b, and A 4, 74a): 

Jaipur (Khasmohor) 5557. 

Kathmandu (1965) 146 (2980). 4ff. Incomplete. 
*Poleman 5130 (U Penn 657). The scribe’s (or 
patron’s) name is probably to be read: Govinda- 
rama Tivadi; the relevant part of the post-colo¬ 
phon is: <li>$itarn tivadigornarndaramakary- 
yartham. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


73 


3. Additional manuscripts of his Tithicintamani (see 

CESS A 2, 100b-I03a; A 3, 28a; and A 4, 74a-75a): 

VSM (Upadhye) 12802b. Ff. 1-9. Copied by 
Kr§nabhatta in Saka 1738 = a.d. 1816. 

RORI Cat. XVI 36790. 36ff. Copied in Sam. 1898 = 
A.D. 1841. With the fika of Yajnesvara. 

VSM (Upadhye) 12732. 13ff. Copied by Kr§na 
Gopalabhatta Adhyapaka in Saka 1764 = a.d. 
1842. With a sarnvatsaraphala. 

Oxford (Vyasa) 11. Ff. 1-7. Copied for Pranajivanta 
Madhavaji Vyasa on Sunday 8 kr§napak$a of 
Bhadrapada in Sarn. 1918, Saka 1783 = 14 Sep¬ 
tember 1862. Expanded version in 73 verses. 

RORI (Jaipur) 2434. 5ff. Copied at Bhavapura in 
Sam. 1953 = a.d. 1896. 

BHU C.333. 9ff. Sarada. Incomplete. 

BHU C.846. llff. With the tika of Veiikafesa. 

BORI 706 of 1883/84. 36ff. (sarani). No author 
mentioned. 

Mysore (1905) 546. Pp. 262-266. Telugu. 

Mysore ORI C.4697/8. Ff. 1-32. Incomplete. No 
author mentioned. 

Mysore ORI P.2649. Ff. 45-69. Telugu. Incomplete 
(Tithicakrapadakani). 

Oxford CSS I 62 (*d. 746 (2)). Ff. 1-4. 

Oxford CSS I 63 (*d. 791 (3)). Ff. 1-3. Incomplete. 

Oxford CSS I 64 (*d. 796 (3)). Ff. 1-3. 

Oxford CSS I 65 (*d. 796 (4)). Ff. 1-2. 

Oxford (Vyasa) 12. Ff. 1-4. (sarini; incomplete). 

RORI (Chittorgarh) 2612. 5ff. Copied by Lacha- 
mana. 

VSM (Upadhye) 12762. 5ff. 

VSM (Upadhye) 12770. 30ff. Copied by Govinda 
Lak§mana Upadhye. 

VSM (Upadhye) 12799. 3ff. Incomplete. 

VSM (Upadhye) 12801b. 20ff. 

4. Additional manuscripts of his Buddhivildsini (see 

CESS A 2, 103a-104a, and A 4, 75a-75b): 

PrSB 3573 (Berlin or. quart. 1653). Ff. 1, 5-15, 17, 
20, 22-23, 26-55, 58-95, 97-104, and 107. Cop¬ 
ied by Paramananda Kayastha at Kasi on Friday 
4 kr^napaksa of Margasir^a in Sarn. 1657 = 12 
December 1600. Formerly property of 
Gambhiraraja Bharatidik§ita. 

PrSB 3572 (Berlin or. quart. 1657). Ff. 2-20, 23-47, 
and 50-113. Copied by Kr§na of Vairatadesa in 
<Sarn. > 1769 = a.d. 1712. Incomplete. 

RORI (Udaipur) 3477. lOlff. Copied by Vaijanatha 
Josi, the son of Balakr§na, at Brahmavartaksetra 
in Sarn. 1897 = a.d. 1840. No author mentioned. 


AS Bengal I.B.4. Bengali. 

Bhubaneswar 2. G/4 = Bhubaneswar IV ganita 51 
(G/4). 59ff. Oriya. From Puri. 

GJRI 9209/37. Ff. 1-33. Maithili. Incomplete. 

Jaipur (Khasmohor) 5463; and 5538. 

Mysore ORI A.896/2. Ff. 1-24. Telugu. Incomplete. 

Oxford CSS I 110 (*d. 786). If.; and ff. 1, 3-73, 
80-124, and 126. Incomplete (verses 187-192 
missing). 

Paris BN Sans. 1781a. Part of a manuscript of 72ff. 
Grantha. 

RORI (Alwar) 2574. 104ff. 

RORI (Alwar) 2593. 113ff. 

RORI (Jaipur) 2519. 74ff. Incomplete. 

5. Additional manuscripts of his Brfiattithicintdmani 

(see CESS A 2, 104a-104b; A 3, 28a; and A 4, 

75a-75b); 

Oxford (Vyasa) 46. Ff. 1-54. Copied by Sivasahkara 
Prabhuji Vyasa on Wednesday 13 kr§oapak§a of 
Jye^fha in Sarn. 1847, Saka 1713 = 29 June 
1791. (sarini; incomplete). 

Oxford (Vyasa) 45. Ff. 1-10. Copied by Sivasahkara 
Prabhujika Vyasa for Mulaji Vyasa on Friday 30 
kr§napak§a of Jye§tha in Sam. 1847, Saka 1713 
= 1 July 1791. Expanded version in 79 verses. 

RORI (Alwar) 2681 = *Alwar 1871. 22ff. Copied in 
Sarn. 1912 = a.d. 1855. With the t ika of Visnu. 

6 . Additional manuscripts of his Vivahadlpikd (see 

CESS A 2, 104b-105a; A 3, 28a; and A 4, 75b): 

BHU B.167. 13ff. Incomplete. 

GJRI 8672/897. Ff. 1-26. Maithili. Incomplete. 

New Delhi, H. B. Lall 59. 96ff. Incomplete (ends 
with 16, 4). 

RORI Cat. VII 25170. 72ff. (ff. 5 and 56 missing; f. 
61 repeated). Incomplete. 

RORI Cat. XVI 34456. 255ff. (ff. 249-254 missing). 
Incomplete. 

RORI Cat. XVI 36577. 63ff. Copied by Sankara 
Bhafta, the son of Sukadeva. 

RORI (Alwar) 2941. 153ff. 

RORI (Alwar) 2942. 118ff. 

RORI (Jaipur) 11809. 13ff. Ascribed to Kesava. 
Incomplete. 

7. Additional manuscripts of his Muhunadlpikd (see 

CESS A 2, 105b-106a, and A 4, 75b): 

VSM (Upadhye) 12814. 185ff. Copied in Saka 1687 
= A.D. 1765. 


74 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. IX 28288. 22ff. Copied by Abherama, the 
son of Tuljarama Josi, at Vafapuri in Iladurga 
District in Sam. 1835 = A.D. 1778. 

RORI Cat. XVI 36007. 21 Iff. Copied by Narayana in 
Sam. 1888 = A.D. 1831. 

RORI (Alwar) 2911 = *Alwar 1903. 155ff. Copied 
in Sarn. 1912 = A.D. 1855. 

Oxford CSS I 404 (*d. 756). Ff. 1-162. 

8 . Additional information concerning a manuscript 

of his Cabukayantra (see CESS A 2, 106a): 

*BORI 43 of 1898/99. Ff. 12-13. Copied on Wed¬ 
nesday 9 suklapak§a of Jye§tha II in Sarn. 1812, 
Saka 1677 = 18 June 1755. 

9. Additional manuscripts of his Pratodayantra (see 

CESS A 2, 106a-106b, and A 4, 75b): 

*AS Bombay 245 IV. Ff. 9-10. Copied on Saturday 
13 kr§napak§a of the first month <in Sarn. 
1716> = 9 April 1659. 

RORI (Jaipur) 4697. 4ff. Copied by Nanurama in 
Sam. 1885 = a.d. 1828. With a fika. 

^Bombay U 375. Ff. 13v-14v. 

RORI (Alwar) 2697 = * Alwar 1844. 5ff. 

*VVRI 4731 A. 2ff. The fika in this manuscript is 
by a pupil of Ganesa; it begins: etat prasiddharn 
pratodayantram ganesadaivajnair asmadgurubhih 
kalpitarn. 

The Pratodayantra was published by Shakti Dhara 

Sharma, Kurali [1982]. 

11. Additional manuscripts of his Sudhirahjana- 

yantra (see CESS A 2, 106b): 

*AS Bombay 245 III. Ff. 8v-9. Copied on Saturday 
13 kr$napak§a of the first month <in Sam. 
1716> = 9 April 1659. 

Mysore ORI P.2057/6. F. 105. Telugu. 


GANESA or GANAPATl (fl. 1529) 

The son of Damodara, Ganesa or Ganapati wrote 
a Pahcahgasiddhi whose epoch is Saka 1441 = a.d. 
1519; cf. the Ganapatisdrari'i of Ganapati. Manu¬ 
script: 

Oxford CSS I 58 (d. 791 (7)). Ff. 1-33. Copied by 
Devaji Bhafa, the son of Ganesa Bhafa, for Pila 
Josi on Wednesday 2 suklapak§a of Bhadrapada 
in Saka 1567 = 13 August 1645. 


The first verse is: 

sriherambapadambuje druhinajarn suryadikan 
khecaran 

dhataram sivam acyutarn girisutam yogesvaram 
sadgurum / 

natvaharn subhage^inirn sphufataram brahmarya- 
pak§anvitarn 

var^adau pafusiddhaye ganapatih pancahgasiddhirn 
bruve // 

The colophon begins: iti srijyotirvitsuganesaviracita. 

^GANESA {fl. ca. 1550/1600) 

1. Additional manuscripts of his Tajikabhit^aria (see 

CESS A 2, 107a-109a; A 3, 28b; and A 4, 75b-76a): 

BM Or. 13780. Copied at Jhujhuvagrama in Sam. 
1692 = A.D. 1635. 

BHU C.4867. 28ff. Copied in Sam. 1815 = A.D. 
1758. 

Oxford CSS I 355 (*d. 774 (2)). Ff. 1-29. Copied by 
Prabhurama, the son of Jivanaka Pandya of the 
Visanagarajnati, a resident of Ahmadabad, on 
Saturday 13 suklapak§a of Asadha in Sarn. 1840, 
Saka 1705 = 12 July 1783. 

RORI (Chittorgarh) 735. 39ff. Copied at Indra- 
vatinagara in Sam. 1843 = a.d. 1786. Incomplete 
(bhojanavicara). 

BHU C.2253. 22ff. Copied in Sam. 1852 = a.d. 
1795. 

RORI (Jaipur) 2833. 8ff. Copied by Maiigalarama 
Dadhica in Sarn. 1876 = a.d. 1819. Incomplete 
(grahabhavaphala). 

RORI (Jaipur) 5133. 13ff. Copied by Dayadatta 
Bhafta in Sarn. 1887 = a.d. 1830. 

RORI Cat. IV 20709. 42ff. Copied by Narad ika 
Bhafta in Sam. 1888 = a.d. 1831. 

RORI (Alwar) 2791. 33ff. Copied in Sam. 1908 = 
A.D. 1851. 

BHU C.4440. 27ff. Sarada. Copied in Sam. 1923 = 
A.D. 1866. 

Jaipur (Khasmohor) 5276. 

Jesalmere II Pothi 112, no. 1842. lOff. Incomplete. 
No author mentioned. 

Mysore ORI *P.1147. Ff. 1-42. Nandinagari. Incom¬ 
plete. 

Oxford CSS I 356 (*d. 795). Ff. 1-20 and 22-36. 
Incomplete. 

RORI Cat. Ill 14030. lOff. Incomplete (§odasayoga- 
vicara). No author mentioned. 

RORI Cat. XVI 36679. 25ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


75 


RORI (Alwar) 2790. 36ff. Incomplete. 

RORI (Jaipur) 3478. 38ff. (f. 24 missing). Incom¬ 
plete. 

RORI (Jaipur) 10203. 41ff. 

VVBISIS 793. 4ff. Incomplete. No author men¬ 
tioned. 

WRI 1590. If. Incomplete (masaphala). No author 
mentioned. 

2. Additional manuscripts of his RatnavaUpaddhati 
(see CESS A 2, 109a-109b): 

RORI Cat. VI 24391. 9ff. (f. 5 missing). Incomplete. 
RORI Cat. XVI 36748. 13ff. 

The RatnavaU paddhati was edited by K. K. 
Raikva in his Jatakapaddhatisamuccaya, Surata Sarn. 
1993 = A.D. 1936, pp. 16-42. 

3. Additional manuscripts of his Ganitamahjarl (see 
CESS A 2, 110a): 

RORI Cat. VI 24859. Ff. 2-106. Incomplete. 

RORI (Udaipur) 3665. 8ff. 


^GANESA ifl. 1613) 

Additional manuscripts of his Jdtakdlahkdra (see 
CESS A 2, 110a-114a; A 3, 28b; and A 4, 76a-77b): 

Vrndavana 3373. 21ff. Copied by Sitarama Misra in 
Sam. 1714 = a.d. 1657. Incomplete. 

Rattan II 14145. 9ff. Copied in Sarn. 1746 = a.d. 
1689. 

Oxford CSS I 280 (*d. 768 (3)). Ff. 1-17. Copied by 
Thakura on a Wednesday in A§adha in Saka 1617 
= 3, 10, 17, or 24 July 1695. 

*Poona, Mandlik. Jyotisha 42. 14ff. Copied in Sarn. 
1808 = A.D. 1751. 

RORI (Jaipur) 4618. 17ff. Copied by Tryambaka in 
Sam. 1840 = a.d. 1783. 

RORI (Chittorgarh) 184. 17ff. Copied in Sam. 1842 
= A.D. 1785. 

Oxford CSS I 281 (*e. 145 (2)). Ff. 1-11 and 13. 
Copied by Bapu Pathaka Netaka on Sunday 10 
suklapak§a of Pau§a in Sam. 1846 = 27 Decem¬ 
ber 1789. Incomplete (adhyaya 7 omitted). 

RORI Cat. V 23642. 17ff. Copied in Sam. 1849 = 
A.D. 1792. 

Wien UB 30 (I 9814). Ff. 1-15. Copied on Monday 
12 kr§napak§a of Sravana in Sam. 1879, Saka 
1744 = 12 August 1822. Bought by E. Hultzsch 


in 1884/85. 

RORI Cat. IX 29913. 13ff. Copied in Sam. 1887 = 
A.D. 1830. 

BHU B.3726. 113ff. Copied in Sam. 1890 = a.d. 
1833. With the tika of Narmadagiri. Incomplete. 
No author mentioned. 

RORI (Jaipur) 4267. 16ff. Copied by Ramanatha at 
Kukade in Sarn. 1890 = a.d. 1833. 

RORI (Jaipur) 10451. 24ff. Copied in Sam. 1892 = 
A.D. 1835. 

RORI Cat. IX 28689. 24ff. Copied by Dayarama Sar- 
man Misra in Sam. 1893 = a.d. 1836. With a 
flka. 

RORI (Chittorgarh) 1414. 14ff. Copied by Guru 
Moti in Sarn. 1899 = A.D. 1842. Incomplete (to 
yogadhyaya). 

NPS (Sanskrit) 8166. Ff. 1-20. Copied by Baladeva 
Caube on Sunday pQrnima of Margasir^a in 
Sam. 1905 = 10 December 1848. With the tika 
of Haribhanu Sukla. 

RORI (Jaipur) 4007. 34ff. Copied at Didavana in 
Sam. 1909 = a.d. 1852. 

RORI (Udaipur) 4042. 21ff. Copied in Sam. 1911 = 
A.D. 1854. With a Rajasthani tabartha. 

BHU C.2699. 36ff. Copied in Sam. 1912 = a.d. 
1855. With a tika. No author mentioned. 

Nagpur 732 (1729). 20 ff. Copied in Sam. 1912 = 
A.D. 1855. Ascribed to Ramakr^na. From Nag¬ 
pur. 

NPS (Sanskrit) 8569. Ff. 1-39. Copied in Sam. 1913, 
Saka 1778 = a.d. 1856. With the tika of Jayago- 
pala. 

NPS (Sanskrit) 9045. 32ff. Copied for Gahgadhara 
on Thursday 4 kr§napak§a of A^adha in Sarn. 
1914 = 29 July 1858. 

RORI (Jaipur) 11146. 12ff. Copied in Sam. 1915 = 
A.D. 1858. 

GJRI 8361/586. Ff. 1-31. Maithili. Copied on Sun¬ 
day 2 suklapaksa of Phalguna in Saka 1780 = 6 
March 1859. 

Mysore ORI C.4662/16. Ff. 1-33. Copied on Satur¬ 
day 2 suklapaksa of Phalguna in Saka 1787 = 17 
February 1866. 

RORI (Alwar) 5575. 19ff. (ff. 1-4 missing). Copied 
in Sarn. 1923 = a.d. 1866. Incomplete. 

RORI (Chittorgarh) 2616. llff. Copied by Ramadasa 
Kabirapanthin in Sarn. 1923 = a.d. 1866. With a 
tika. 

Vrndavana 3738. 29ff. Copied by Gahgadhara Misra 
in Sam. 1925 = a.d. 1868. 

RORI (Chittorgarh) 1780. 3ff. Copied by Ramadasa 
Kabirapanthin in Sarn. 1927 = a.d. 1870. Incom¬ 
plete (adhyaya 4). 


76 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. VI 23821. 17ff. Copied by Viradicanda 
Srimalin in Sam. 1931 = A.D. 1874. 

GJRI 8360/585. Ff. 1-14. Maithili. Copied in Saka 
1798 = A.D. 1876. 

RORI (Alwar) 5523. 40ff. Copied by Baladatta in 
Sam. 1940 = A.D. 1883. With the tika of Hari- 
bhanu Sukla. 

RORI (Alwar) 5468 (8). Ff. 41-75. Copied by 
Kr§nalala in Sam. 1942 = A.D. 1885. With the 
tika of Haribhanu Sukla. 

RORI Cat. IV 20873 (1). Ff. 1-15. Copied by 
Madhava in Sarn. 1956 = A.D. 1899. 

AS Bengal III.A.72. 

BHU B.3317. 6ff. Incomplete. No author mentioned. 

BHU B.3727. 25ff. With a tika. Incomplete. No 
author mentioned. 

BHU B.4333. 18ff. Incomplete. No author men¬ 
tioned. 

BHU C.5. 66ff. With the tika of Haribhanu Sukla. 

BHU C.993. 9ff. Sarada. 

BHU C.2079. 14ff. Said to have been copied in Saka 
1535 = A.D. 1613. 

BHU C.2235. 16ff. With a tika. Incomplete. 

BHU C.2698. 14ff. Incomplete. No author men¬ 

tioned. 

BHU C.4583. 14ff. Sarada. 

BHU C.5402. 6ff. Incomplete. 

Bhubaneswar 2. Bs/27. Bengali. 

Bhubaneswar IV 41 (Jy/lOa). 23ff. Oriya. From Puri. 

Bhubaneswar IV 42 (Jy/13b). 29ff. Oriya. From 

Puri. 

Bhubaneswar IV 43 (Jy/19b). 13ff. Oriya. From 

Ranapur, Mayurbhanj District. 

Bhubaneswar IV 44 (Jy/30d). 19ff. Oriya. From 

Baripada, Mayurbhanj District. 

Bhubaneswar IV 45 (Jy/93b). 16ff. Oriya. Incom¬ 
plete. From Sanakhemendi, Ganjam District. 

Bhubaneswar IV 46 (Jy/65). 91ff. Oriya. With the 
Oriya translation of Durlabha Dasa. From Bhu¬ 
baneswar. 

Bhubaneswar IV 47 (Jy/73b). 34ff. Oriya. With the 
tika of Kavicandra. From Bhubaneswar. 

Bhubaneswar IV 48 (Jy/74a). 48ff. Oriya. With a 
tika. Incomplete. From Bhubaneswar. 

Bhubaneswar IV 49 (Jy/86a). 5Iff. Oriya. With the 
tika of Kavicandra. From Bhubaneswar. 

Bhubaneswar IV 50 (Jy/89). 28ff. Oriya. With an 
Oriya translation. From Haladia, Puri District. 

Bhubaneswar IV 51 (Jy/136a). 31ff. Oriya. From 
Parlakhemendi, Ganjam District. 

Bhubaneswar IV 179 (Jy/49). 102ff. Oriya. At the 
beginning of the manuscript. Incomplete. From 
Gadamanitri, Begunia, Puri District. 

Bhubaneswar IV 181 (Jy/71). 113ff. Oriya. At the 


end of the manuscript. Incomplete. From Turin- 
tra, Bahama, Puri District. 

GJRI 8359/584. Ff. 1-13. Maithili. Incomplete (ends 
in adhyaya 4). 

GJRI 11011/1065. 3ff. Maithili. Incomplete (begins 
in adhyaya 5). 

Jaipur (Khasmohor) 5396. 

Kathmandu (1965) 12 (5903). 34ff. 

Kathmandu (1965) 13 (6332). 4ff. Incomplete. 

Kathmandu (1965) 16 (5899). 15ff. 

Kathmandu (1965) 17 (5899). 36ff. With the fika of 

Haribhanu Sukla. 

Nagpur 731 (1681). 14ff. Said to have been copied 
in Saka 1535 = A.D. 1613. Ascribed to 

Ramakr§na. From Nasik. 

NPS (Sanskrit) 8431. lOff. Incomplete. No author 
mentioned. 

NPS (Sanskrit) 9173. 7ff. Incomplete. 

Oxford CSS I 282 (*d. 772 (10)). Ff. 1-13. Incom¬ 
plete (ends in 7, 2). Property of Pandita Vijaya- 
rama on Friday 10 suklapak§a of Pau§a in Sam. 
1915 = 14 January 1859. 

Oxford CSS I 283 (*d. 924 (9)). Ff. 1-18 and If. 
Bengali. 

RJ IV 2991. llff. Incomplete. No author mentioned. 

RORI Cat. IV 18959. 5ff. Incomplete. 

RORI Cat. IX 30147. 2Iff. With the tika of Seva- 
rama. 

RORI (Alwar) 2766. 35ff. With a tika. 

RORI (Alwar) 5086. lOff. Incomplete. 

RORI (Alwar) 5421. 5ff. Incomplete (horoscopic 
diagrams). 

RORI (Chittorgarh) 2954. 18ff. 

RORI (Jaipur) 3408. 17ff. Incomplete. 

RORI (Jaipur) 5204. 8ff. (f. 2 repeated). Incomplete. 

RORI (Jaipur) 10331. 6ff. Incomplete. 

RORI (Udaipur) 4000. 18ff. Said to have been cop¬ 
ied at Varddhanapura in Sam. (read Saka) 1535 
= A.D. 1613. With the tika of Jayagopala. 

RORI (Udaipur) 5447. lOff. (ff. 1-2 missing). 
Incomplete. 

RORI (Udaipur) 6508. 36ff. (f. 1 missing). With a 
tika. Incomplete. 

Varendra 214. Ff. 1-40. With the tika of Jayago¬ 
pala. 

Vrndavana 7495. 15ff. With a tika. Incomplete. 

Vrndavana 8440. 6ff. Incomplete. 

Vrndavana 10233. 20ff. (ff. 3-5 missing). Incom¬ 
plete. 

Vrndavana 10577. llff. Said to have been copied in 
Sam. 1670 = a.d. 1613. Incomplete. 

WHMRL E.12.m. Ff. 1 and 5-21. Incomplete (1, 
5-7; and 2, 12-6, 6). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


77 


The Jatakalahkara was edited with the Samskrta 
and Hindi tika, Tattvaprakasika, of La§analala Jha 
as CAG 31, Varanasi 1979; reprinted as Kr^nadasa 
SS 56, Varanasi 1984. It was also published with the 
Hindi fika of Budhavasati Rama at Kalyana- 
Bambai in 1986. 

*GANESA (/?. 1681) 

Additional manuscript of his Tithimahjarl (see 
CESS A 2, 93a, and A 3, 28b-29a): 

RORI (Chittorgarh) 1239. 6ff. 

^GANESADATTA PATHAKA (fl. 1935/1972) 

Author also (see CESS A 2, 114a; A 3, 29a; and 
A 4, 77b) of a Hindi tika Subodhinl, on the Mu- 
hurtamdnanda of Narayana (fl. 1571/72), published 
at Varanasi [N.D.]; and of a Vdstuprabodha pub¬ 
lished with a Hindi fika at Varanasi in 1972. 

*GADADHARA 

Additional manuscript of his tika on the Bhuva- 
nadlpaka of Padmaprabha Suri (fl. 1165) (see CESS 
A 2, 114b, and A 3, 29b): 

RORI Cat. VIII 27505. 16ff. Copied by Amaracandra 
Ojha at Nasiravada on Monday 8 suklapak^a of 
Phalguna in Sarn. 1900 = 26 February 1844. 

Verse 2 at the beginning is: 

sugamarn sarvair jheyarn yad gudharn tajjagad- 
adharena maya / 

pratipadakathanair bhuvanadipakasastram bahir 
neyam // 

The last verse is: 

yathamati yathadhitarn sastrarn bhuvanadipakam / 
gadadharadvijenedam vyakhyatam svasutaya tat // 

GADADHARA 

Author of a tika on the Siddhantasiromani of 
Bhaskara (b. 1114). Manuscript: 


GADADHARA PATTANAYAKA 

The son of Padmanabha Pattanayaka, Gadadhara 
wrote a Suryendugrahana = Ravlndugrahana in 
Sarnskrta and Oriya, based on the Grahacakra of 
Kucanacarya. Manuscript: 

Bhubaneswar IV 139 (Jy/26c). 24ff. Oriya. With the 
Grahacakravivarana of Kr^naratha. From Rana- 
pur, Puri District. 

The first verse is: 

patibijavisaradas tu sakalagranthantarakunthadhir 
daivajnalikiritahatakamanir yah padmanabhabhi- 
dhah / 

suryendugrahanarn bravimi subhagam natva mu- 
rareh padarn 

tatsunus ca gadadharo batuhitayaharn budhananda- 
kam // 


^'^GADADHARA MISRA 

Additional manuscript of his Brhajjatakatlkd 
(see CESS A 2, 114b): 

BHU C.244. 15ff. 


^^GADADHARA RAJAGURU (fl. ca. 1725/1750) 

Additional manuscripts of his Gadadharapaddhau 
(see CESS A 2, 115a-115b; A 3, 29b; and A 4, 77b): 

Bhubaneswar 2.Dh/982; and Dh/1002. (both Kdla- 
sdra). 


^'GADADHARA DIK^ITA (fl. 1787) 

Additonal manuscripts of his Vratarka (see CESS 
A 4, 77b-78a): 

RORI (Udaipur) 211. 453ff. (ff. 320-338 missing). 

Copied in Sarn. 1895 = a.d. 1838. 

RORI (Udaipur) 210. 114ff. (ff. 30-34, 40-43, and 
52-62 missing). 


Jaipur (Khasmohor) 6568. 


78 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GANNAMACARYA 

Author of a Telugu tika on the Silpasastravi- 
dhana of Maya. Manuscripts: 

lO 3150 (2579) 1. Ff. l-45v. Telugu. From Colin 
Mackenzie. 

lO 3151 (2680) I. Pp. 1-7. Telugu. Incomplete (adh- 
yayas 1-2). From Colin Mackenzie. 

The colophon begins: iti gannamacaryaviraci- 
tayam andhrabha§atikayarn. 


GARGA 

Alleged author of a Keralaprasna\ cf. the Garga- 
prasna. Manuscripts: 

RORI (Alwar) 2858. 12ff. Copied in Sarn. 1912 = 
A.D. 1855. 

RORI (Alwar) 2867. 7ff. Copied in Sam. 1912 = 
A.D. 1855. 

RORI (Alwar) 2868. 15ff. Copied in Sarn. 1912 = 
A.D. 1855. 

RORI (Alwar) 2859. llff. 


*GARGA 

A Gargajdtaka (cf. CESS A 2, 115b) in 84 verses 
was published with the Hindi tika of KaUrama 
Pathaka at Kalyana-Murnbai in 1987. 


*GARGA 

Addtional manuscripts of his Gargaprasna (see 
CESS A 2, 116a): 

BHU C.383. lOff. (Sugargaprasna). 

Jaipur (Khasmohor) 5449. (yatraprakarana). 


*GARGA 

Additional information concerning a manuscript 
of his Gargamuhuna (see CESS A 2, 116a): 

*Poona, Mandlik. Jyotisha 9. 26ff. Copied in Saka 
1804 = A.D. 1882 from a manuscript belonging 
to Vyavahare Josi of Poona. 


^GARGA 

1. Additional manuscripts of his Vrddhagargasamhitd 
(see CESS A 2, 116a-117b; A 3, 29b; and A 4, 78a; 
see D. Pingree [A5 1987b] and [A5 1987c]): 

RORI (Alwar) 2549. 186ff. Copied in Sarn. 1912 = 
A.D. 1855. Incomplete. 

Poona, Mandlik. Jyotisha 19. 192ff. Copied in Saka 
1803 = A.D. 1881 from BORI 345 of 1879/80. 
BHU S. 34. 227ff. Copied in Sarn. 1939 = A.D. 
1882. 

AS Bengal I.D.20. 160ff. Property of the College of 
Fort William in 1825. See Yugapurdna, BI ed., p. 
22 . 

Gangajala Vidyapeeth, Aliyavada, Gujarat 127 = 
*Tuljashankar 16. See Yugapurdna, BI ed., p. 22. 
New Delhi, NM 57/78/1. 315ff. 

NL, Calcutta, Th. 171. 147ff. See Yugapurdna, BI 
ed., p. 24. 

NL, Calcutta, Th. 216. 228ff. See Yugapurdna, BI 
ed., p. 24. 

NL, Calcutta, Th. 218. Incomplete. See Yugapurdna, 
BI ed., p. 20, fn. 57. 

NL, Calcutta, Th. 319. 295ff. From Bhau Daji. See 
Yugapurdna, BI ed., p. 23. 

RORI (Alwar) 2548. 244ff. Incomplete. 

The Yugapurdna was published with his own 
Hindi translation by Kr§riamaiii Tripafhin as CSG 
16, Varariasi 1975; with an English translation in J. 
Mitchiner, Indo-Greek and Indo-Scythian Coinage, 
vol. 9, London 1976, pp. 918-924; and was edited 
with an English translation and a commentary by J. 
Mitchiner as BI 312, Calcutta 1986. 

3. Additional manuscripts of his Vrddhagdrgisarn- 
hitd (see CESS A 2, 118a): 

BHU C.1083. 78ff. Sarada. 

Oxford CSS I 459 (e. 260B and Cl). Ff. 1-10 and 
lOb-29. Sarada. Copied in Jye^tha of Sarn. 61. 
PrSB 2926 (Gottingen, Sanscr. Sham 55). 37ff. 

5. Additional manuscripts of his Gdrgyasarnhitd (see 
CESS A 2, 118b, and A 3, 29b): 

Mysore ORI P.10056/38. Ff. 55-76. Nandinagari. 
(phalanirtiaya of Gargya). 

Visvabharati (Adyar) 1056 (a). 76ff. Nandinagari. 
Incomplete (ends in adhyaya 11). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


79 


6 . Additional manuscripts of sections, apparently, of Mysore ORI P.9764/44. Ff. 81-82. Telugu. 
his Uttaragargyasamhita (see CESS A 2, 118b-119a; 

A 3, 29b-30a; and A 4, 78a-78b): 13. ekanak§atrajananasanti of Vrddhagargya. 


1 . anuradhanak§atrasanti. 

Mysore ORI P.9254/102. Ff. 85-86. Nandinagari. 

2 . abhijinnak§atrasanti. 

Mysore ORI P.9254/107. Ff. 89-90. Nandinagari. 

3. amavasyasantihoma. 

Mysore ORI P.9254/117. Ff. 97-98. Nandinagari. 

4. asvininak§atrajananasanti. 

Mysore ORI P.9254/114. Ff. 95-96. Nandinagari. 

5. ardranak^atrajananasanti. 

Mysore ORI P.9254/90. Ff. 77-78. Nandinagari. 

6 . asle§ajye§thajananasantiprayoga. 

Benares (1953) 6700. Ff. 1-4. 

7. asle§anak§atrajananasanti. 

Mysore ORI P.9254/94. If. Nandinagari. 

8 . uttaraphalgunijananasanti. 

Mysore ORI P.9254/97. Ff. 81-82. Nandinagari. 

9. uttarabhadranak§atrasanti. 

Mysore ORI P.9254/112. Ff. 94-95. Nandinagari. 

10 . uttarasadhanak^atrasanti. 

Mysore ORI P.9254/106. If. Nandinagari. 

11 . utpatasanti. 

Mysore ORI P.604/31. Ff. 35-36. Grantha. 

Mysore ORI P.3023/110. Ff. 66-67. Telugu. 

Mysore ORI P.3804/61. Ff. 107-109. Nandinagari. 
Mysore ORI P.4863/78. Ff. 86-87. Telugu. 

Mysore ORI P.5672/113. Ff. 173-176. Kannada. 
Mysore ORI P.5930/117. Ff. 135-136. Nandinagari. 

12 . ulukagrdhrakapotasanti. 


Mysore ORI P.60/8. Ff. 11-12. Nandinagari. 

Mysore ORI P.604/75. Ff. 102-103. Grantha. 

Mysore ORI P.734/4. Ff. 12-13. Nandinagari. 

Mysore ORI P.3804/36. F. 66. Nandinagari. 

Mysore ORI P.4863/118. F. 138. Telugu. 

Mysore ORI P.9254/195. F. 168. Nandinagari. 
Mysore ORI P.9428/17. F. 10. Nandinagari. 

14. kuhusanti. 

Mysore ORI P.4863/44. Ff. 61-63. Telugu. 

Mysore ORI P.9254/85. Ff. 71-72. Nandinagari. 
Mysore ORI P.9254/86. Ff. 72-74. Nandinagari. 
Mysore ORI P.10070/58. Ff. 60-62. Nandinagari. 

15. kurmasanti. 

Mysore ORI P.3085/69. Ff. 89-91. Grantha. 

16. krttikanak§atrasantividhi. 

Mysore ORI P.9254/87. Ff. 74-76. Nandinagari. 

17. kr§nacaturdasijananasanti. 

Mysore ORI P.60/5. Ff. 8-9. Nandinagari. 

Mysore ORI P.3804/30. Ff. 52-55. Nandinagari. 
Mysore ORI P.4863/126. F. 143. Telugu. 

Mysore ORI P.9254/203. Ff. 171-172. Nandinagari. 
Mysore ORI P.9951/95. F. 117. Nandinagari. 

Mysore ORI P.9965/5. Ff. 9-10. Nandinagari. 

18. gandajatasanti. 

AS Bengal 2617 (G. 3244) I. Ff. 1-lv. 

19. gandado§ajananasanti. 

Mysore ORI 3804/52. Ff. 90-91. Nandinagari. 

20 . gomukhasanti. 

AS Bengal 2619 (G. 2319). 3ff. 

Benares (1953) 7286. Ff. 1-5. (gomukhaprasavavi- 
dhi). 

21 . jye§thanak§atrajananasanti. 

Mysore ORI B. 117/50. Ff. 57-58. Kannada. 

Mysore ORI P.604/81. Ff. 109-111. Grantha. 


80 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.734/1. Ff. 3-10. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.1723/14. Ff. 46-49. Nandinagari. 
Mysore ORI P.2239/38. Ff. 38-41. Telugu. 

Mysore ORI P.2579/48. Ff. 40-42. Nandinagari. 
Mysore ORI P.3023/36. Ff. 24-25. Telugu. 

Mysore ORI P.3128/8. Ff. 87-89. Nandinagari. 
Mysore ORI P.3804/53. Ff. 91-94. Nandinagari. 
Mysore ORI P.4720/11. Ff. 18-19 and 24. Nandina¬ 
gari. Incomplete. 

Mysore ORI P.4863/129. Ff. 148-150. Telugu. 

Mysore ORI P.4992/3. Ff. 5-8. Nandinagari. 

Mysore ORI P.5587/77. Ff. 153-155. Nandinagari.- 
Mysore ORI P.5635/99. Ff. 106-108. Grantha. 

Mysore ORI P.5672/37. Ff. 63-65. Kannada. 

Mysore ORI P.6820/4. Ff. 6-9. Nandinagari. 

Mysore ORI P.7401/14. 3ff. Telugu. 

Mysore ORI P.7970/153. Ff. 178-180. Nandinagari. 
Mysore ORI P.8000/12. Ff. 15-16. Nandinagari. 
Mysore ORI P.9254/103. Ff. 86-87. Nandinagari. 
Mysore ORI P.9254/206. Ff. 176-177. Nandinagari. 
Mysore ORI P.9764/20. Ff. 45-47. Telugu. 

Mysore ORI P.9951/96. Ff. 117-120. Nandinagari. 
Mysore ORI P.9965/87. Ff. 100-101. Nandinagari. 
Mysore ORI P.10023/5. Ff. 125-126. Nandinagari. 
Mysore ORI P.10041/26. Ff. 39-41. Telugu. 

22 . tithigandajananasanti. 

Mysore ORI P.4180/30. Ff. 45-46. Nandinagari. 
Mysore ORI P.5587/88. F. 170. Nandinagari. 

Mysore ORI P.5635/37. Ff. 30-31. Grantha. 

Mysore ORI P.8532/14. Ff. 106-107. Nandinagari. 
Mysore ORI P.9254/216. F. 181. Nandinagari. 

23. tithyadigandasanti. 

Mysore ORI P.2239/50. F. 62. Grantha. 

Mysore ORI P.10041/38. Ff. 53-54. Telugu. 

24. ti§yadinak§atrajananasanti. 

Mysore ORI P.604/82. Ff. 111-112. Grantha. 

Mysore ORI P.4863/130. Ff. 150-151. Telugu. 

Mysore ORI P.5313/49. F. 83. Nandinagari. 

25. darsajananasanti. 

Mysore ORI P.4992/10. Ff. 23-24. Nandinagari. 

26. dinak§ayadigandasanti. 

Mysore ORI P.2239/51. Ff. 63-64. Telugu. 

Mysore ORI P.9254/217. Ff. 181-182. Nandinagari. 


Mysore ORI P.10041/39. F. 54. Telugu. 

27. dinodayadigandasanti. 

Mysore ORI P.4180/31. Ff. 47-48. Nandinagari. 

28. dvadasabdad urdhvam avalokavidhi. 

Benares (1953) 7535. Ff. 1-4. 

RORI (Jaipur) 4685. 2ff. (from Gargasamhita). 

29. dhani^thapahcakasanti. 

Mysore ORI P.9254/109. Ff. 91-92. Nandinagari. 

30. nak§atragandasanti. 

Mysore ORI P.604/84. Ff. 114-115. Grantha. 
Mysore ORI P.2239/52. F. 64. Telugu. 

Mysore ORI P.10041/37. F. 53. Telugu. 

31. naksatrabalividhi. 

Mysore ORI P.3804/59. Ff. 103-104. Nandinagari. 

32. nak§atrasanti. 

Mysore ORI P.604/27. Ff. 31-32. Grantha. 

Mysore ORI P.10070/59. Ff. 62-77. Nandinagari. 

33. nalave§tanasanti. 

Mysore ORI P.5293/52. F. 69. Nandinagari. 

Mysore ORI P.9428/7. F. 66. Nandinagari. 

34. parive§akalajananarajasvalasanti. 

Mysore ORI P.3804/50. F. 88. Nandinagari. 

35. punarvasujananasanti. 

Mysore ORI P.9254/91. F. 78. Nandinagari. 

36. pusyanak§atrajananasanti. 

Mysore ORI P.9254/93. Ff. 78-79. Nandinagari. 

37. pusyapurva^adhajananasanti. 

Mysore ORI B. 117/52. Ff. 62-63. Kannada. 

Mysore ORI P.5635/58. Ff. 53-54. Grantha. 

Mysore ORI P.7970/155. Ff. 183-184. Nandinagari. 
Mysore ORI P.8000/10. Ff. 13-15. Nandinagari. 
Mysore ORI P.8000/37. Ff. 66-67. Nandinagari. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


81 


Mysore ORI P.8532/30. Ff. 127-128. Nandinagari. 

38. purvabhadraprathamartavasanti. 

Mysore ORI P.9254/111. Ff. 93-94. Nandinagari. 

39 . purva§a(^hanak§atrajananasanti. 

Mysore ORI P.9254/105. Ff. 88-89. Nandinagari. 

40. paurnamasisanti. 

Mysore ORI 9254/116. F. 97. Nandinagari. 

41. bhadrasanti. 

Benares (1953) 8126. Ff. 1-2. 

RORI (Jaipur) 4684. 2ff. 

42. maghanaksatrajananasanti. 

Mysore ORI P.4992/1. Ff. 1-4. Nandinagari. 

Mysore ORI P.6820/2. Ff. 2-5. Nandinagari. 

Mysore ORI P.8532/29. Ff. 125-127. Nandinagari. 

43. mulanak^atrajananasanti. 

Mysore ORI P.9254/104. Ff. 87-88. Nandinagari. 
Mysore ORI P.9951/54. Ff. 53-54. Nandinagari. 

44. mulasle^ajananasanti. 

Mysore ORI P.3128/22. Ff. 103-104. Nandinagari. 

45. mrgasir§anak§atrajananasanti. 

Mysore ORI P.9254/89. Ff. 76-77. Nandinagari. 

46. mrgotpatadisanti. 

Mysore ORI P.4180/17. Ff. 18-21. Nandinagari. 
Mysore ORI P.5587/63. Ff. 138-140. Nandinagari. 
Mysore ORI P.7970/139. Ff. 158-159. Nandinagari. 
Mysore ORI P.9254/123. Ff. 101-102. Nandinagari. 
Mysore ORI P.10070/64. Ff. 78-80. Nandinagari. 

47. rudrasanti. 

Mysore ORI P.9428/44a. F. 33. Nandinagari. 

48. revatinak§atrajananasanti. 

Mysore ORI P.9254/113. If. Nandinagari. 


49. roganak§atrasanti. 

Mysore ORI P.2914/32. Ff. 60-62. Telugu. 

Mysore ORI P.2914/34. Ff. 65-69. Telugu. 

Mysore ORI P.3023/121. Ff. 74-75. Telugu. 
Mysore ORI P.3023/124. Ff. 76-77. Telugu. 
Mysore ORI P.7401/89. 2ff. Telugu. 

Mysore ORI P.7401/91. 3ff. Telugu. 

50. rohininak§atrajananasanti. 

Mysore ORI P.9254/86. F. 76. Nandinagari. 

51. valmikasanti. 

Mysore ORI P.9428/83. F. 75. Nandinagari. 
Mysore ORI P.9764/12. F. 5. Telugu. 

52. visakhanaksatrajananasanti. 

Mysore ORI P.9254/101. Ff. 84-85. Nandinagari. 

53. visanadijananasanti. 

Mysore ORI P.604/61. F. 81. Grantha. 

Mysore ORI P.3128/14. F. 96. Nandinagari. 
Mysore ORI P.8000/16. F. 21. Nandinagari. 
Mysore ORI P.8532/13. F. 106. Nandinagari. 
Mysore ORI P.9167/19. F. 19. Grantha. 

Mysore ORI P.9428/16. Ff. 9-10. Nandinagari. 

54. vaidhrtyadiprathamartavasanti. 

Mysore ORI P.9951/86. Ff. 104-105. Nandinagari. 

55. vyatipatadiprathamartavasanti. 

Mysore ORI P.604/72. Ff. 99-101. Grantha. 

56. santiprayoga. 

Calcutta Sanskrit College (Smrti) 367. 7ff. 

57. sularogaharasanti. 

Mysore ORI P.7970/68. Ff. 52-53. Nandinagari. 

58. sravananak§atrajananasanti. 

Mysore ORI P.9254/108. Ff. 90-91. Nandinagari. 

59. §a§thyartavasanti. 

Mysore ORI B. 117/22. F. 22. Kannada. 


82 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.7970/42. F. 27. Nandinagari. 

60. sarvagandantasanti. 

Mysore ORI P.9965/90. F. 104. Nandinagari. 

61. sinivalijananasanti. 

Mysore ORI P.2239/46. Ff. 58-59. Grantha. 

Mysore ORI P.4180/68. Ff. 124-126. Nandinagari. 
Mysore ORI P.10041/35. Ff. 50-51. Telugu. 

62. svatinak§atrasanti. 

Mysore ORI P.5930/96. F. 119. Nandinagari. 

Mysore ORI P.9254/100. Ff. 83-84. Nandinagari. 
Mysore ORI P.9951/50. Ff. 50-51. Nandinagari. 

63. hastanaksatrasanti. 

Mysore ORI P.5930/94. Ff. 117-118. Nandinagari. 
Mysore ORI P.9254/98. Ff. 82-83. Nandinagari. 
Mysore ORI P.9951/48. Ff. 47-48. Nandinagari. 

7. Additional manuscripts of unidentified Garga- 
samhitas (see CESS A 2, 119b; A 3, 30a; and A 4, 
79a): 

RORI (Udaipur) 524. lOff. Copied by Rupaji 
Bhatta in Sarn. 1746 = A.D. 1689. 

ABSP 4234. lOff. {Jyotisa of Garga Muni). 

Mysore ORI *P.4665. Ff. 1-65. Grantha. Incomplete 
(ends with adhyaya 25, prakirnavidhi). 

Oxford (Vyasa) 117. Ff. 12-18. Incomplete (ketuda- 
yaphala; suryacandramaso mantralak§ana; can- 
drodayaphala; rajyadhikaraphala; mantriphala; 
sasyadhipaphala; purnimaphala; saptanadivicara; 
and varimandalabheda). 

*Poona, Mandlik. Jyotisha 8. 6Iff. Incomplete. 

RORI Cat. IV 20005. 5ff. 

RORI (Alwar) 2547. 31ff. Incomplete. 

8 b. Additional manuscripts of his Kakaruta (see 
CESS A 2, 119b, and A 4, 79a): 

Pattan II 9766. If. Copied in Sam. 1793 = A.D. 
1736. {Kakapindavicara). 

RORI (Udaipur) 4369 (30). F. 80. {Karuiantra\ 
incomplete). 

8 c. Additional manuscripts of his Kdkavaikrtyasdnti 
(see CESS A 2, 119b, and A 4, 79a): 


Benares (1953) 7001. Ff. 1-2. 

Benares (1953) 7105. 4ff. {Kdkamaithunddisanti; 
incomplete). 

Benares (1953) 10315. If. {Kdkamaithunadarsana- 
sdnti). 

Benares (1953) 10564. Ff. 1-5. {Kdkasdnti). 

Mysore ORI P.1967/1. Ip. Nandinagari. {Kdkamai- 
thunadars anas anti). 

Mysore ORI P.5587/69. Ff. 146-147. Nandinagari. 
{Kdkaspars anas anti). 

Mysore ORI P.7970/89. Ff. 73-74. Nandinagari. 
{Kdkamaithunadar Sana's anti). 

8 e. Additional information concerning the manu¬ 
script of his Jvarasdnti (see CESS A 2, 120a): 

AS Bengal 2621 (G. 2166) = *Mitra, Not. 4086. 

8 g. Additional manuscript of his PalUkdrikd (see 
CESS A 2, 120a): 

Kathmandu (1965) 138 (5821). 8ff. 

8 h. Additional manuscripts of his Megfiamdld (see 
CESS A 2, 120a): 

RORI (Bikaner) 14724. llff. Copied in Sam. 1763 
= A.D. 1706. 

RORI Cat. IX 28639. 42ff. 

8 i. Additional manuscript of his Ydtrdlagna'suddhi 
(see CESS A 2, 120a): 

Mysore ORI P.9270/16. Ff. 235-236. Telugu. 


GARGA 

To Garga is attributed a Gargahora translated 
into English by R. Santhanam, New Delhi 1983. It 
is, in fact, adhyayas 40-51 of Minaraja’s Vrddhaya- 
mnajdtaka as quoted in adhyaya 9 of Balabhadra’s 
Horaratna. 


*GARGA 

Additional manuscript of his Jhanapradlpaka 
(see CESS A 2, 120a-120b): 

WHMRL a 1276 (v). Ff. 15v-17. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


83 


GARGA 

Alleged author of a Tajikabhavaphala. Manu¬ 
script: 

RORI Cat. V 22813. 15ff. (f. 1 missing). 


*GARGA 

Additional manuscripts of his Palllsaraiavi- 
dhana (see CESS A 2, 120b; A 3, 30a; and A 4, 
79a-79b): 

RORI (Alwar) 3799. 5ff. Copied in Sam. 1898 = 
A.D. 1841. 

BHU C.2358. 2ff. Copied in Sarn. 1951 = A.D. 1894. 
(Pall 7 Sara tasantividhana). 

Allahabad Municipal Museum 28 (8). See NCC, vol. 
11, p. 246. 

Benares (1953) 7761. Ff. 1-9. (Palllpatanasanti). 
Mysore ORI P.604/29. Ff. 32-33. Grantha (Palllsa- 
raiasanti). 

Mysore ORI P.734/39. Ff. 79-80. NandinSgari (Pal- 
llsara^asanti). 

Mysore ORI P.2914/15. Ff. 21-23. Telugu. (Palllsa- 
raiasmti). 

Mysore ORI P.3083/84. F. 52. Telugu. (Saratapalll- 
patanasanti). 

Mysore ORI P.4863/75. Ff. 83-84. Telugu. (Pall!Sa¬ 
ra (as anti). 

Mysore ORI P.5587/44. Ff. 113-115. Nandinagari. 
(Pall i Sara tasanti). 

Mysore ORI P.5930/115. Ff. 132-134. Nandinagari. 
(Pairisaratasmti). 

Mysore ORI P.8000/4. F. 10. Nandinagari. (Pallisa- 
ra tasanti). 

Mysore ORI P.9428/28. Ff. 17-18. Nandinagari. 
(Pallisaraiasmti). 

Mysore ORI P.9764/40. Ff. 76-78. Telugu. (Palllsa- 
ra\asantl). 

Mysore ORI P.10070/61. F. 77. Nandinagari. (Palll- 
sara(asanti). 

Pattan II 6220 (7). Ff. 8-10. (Pall is ara tasantivi¬ 
dhana). With the Palli Sara tasantividhana of 
Vasantaraja. 

RORI (Alwar) 3800. 4ff. 

RORI (Alwar) 5058. 5ff. 

Vrndavana 6949. 30ff. (Pallipatanaphalavicara). 


GARGA 

Author of a Matrkasakuna. Manuscript: 
Jaipur (Khasmohor) 2115 (20). 


^GARGA 

Additional manuscripts of his Lokamanorama 
(see CESS A 2, 120b-122b; A 3, 30a-30b; and A 4, 
79b): 

BHU B.3717. 8ff. Copied in Sam. 1843 = a.d. 1786. 
Oxford CSS I 516 (*d. 766 (7)). Ff. 1-2. Copied by 
Vima<la>rama (?) Vidyarthin at Kasi on Fri¬ 
day 12 suklapaksa of Phalguna in Sarn. 1869 = 
12 March 1813. 

RORI Cat. V 22421. 8ff. Copied by Kasturacandra in 
Sarn. 1882 = a.d. 1825. 

RORI Cat. V 22795. 4ff. Copied by Ramaratna 
Bohara at Nindavanavataka in Sarn. 1889 = a.d. 
1832. With a fippaiia. 

BHU C.2518. 9ff. Copied in Sarn. 1890 = A.D. 1833. 
No author mentioned. 

NPS (Sanskrit) 9298. Ff. 1-3. Copied by Silacanda 
Padha on Tuesday 5 suklapak§a of Magha in 
Sarn. 1898 = 15 February 1842. 

RORI (Alwar) 2843. 9ff. Copied in Sarn. 1912 = 
A.D. 1855. 

Oxford CSS I 517 (*d. 767 (6)). Ff. 1-4 and 7. Cop¬ 
ied on Monday 4 suklapaksa of Karttika in Sarn. 
1936 = 17 November 1879. With a tika. Incom¬ 
plete (verses 14-18 missing). 

AS Bengal 7169 (G. 2698). 3ff. 

BHU B.3320. 9ff. Bengali. (Gargaprasnavall). 
With a tika. 

BHU B.4335. 7ff. With a tika. Incomplete. 

BHU C.3202. 5ff. Incomplete. 

BORI 532 of 1895/1902. 4ff. With an upapattika. No 
author mentioned. 

GJRI 8528/753. F. 4. Incomplete. 

GJRI 8529/754. Ff. 1-7. With a tika. 

GJRI 8660/885. Ff. 1-4. Maithili. No author men¬ 
tioned. 

GJRI 11143/1197. F. 1. Maithili. 

Kathmandu (1964) 67 (4028). 3ff. 

NPS (Sanskrit) 8457. roll. 

NPS (Sanskrit) 9049. Ff. 1-3. (Prasnavall). 

Oxford CSS I 518 (*d. 767 (7)A). Ff. 1-3. With a 
tika. Incomplete (ends with verse 3). 

PrSB 3674 (Berlin or. fol. 2117). 7ff. With a tika. 
RORI Cat. VI 24712. 2ff. No author mentioned. 
RORI (Chittorgarh) 586. 4ff. 


84 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Chittorgarh) 1615. 9ff. Incomplete. 

RORI (Jaipur) 8951. 2ff. 

RORI (Jaipur) 9447. If. 

RORI (Jaipur) 9778. 2ff. 

Udaipur RVSS 1982. 2ff. Copied by Bhagiratha 
Vidyarthin. 

Vrndavana 3423. lOff. Incomplete. 

Vrndavana 10573. 9ff. Incomplete. No author men¬ 
tioned. 


GARGA 

Interlocutor (Vrddhagarga) with Jak^uki in a 
Vastus^tra. Manuscript: 

Kathmandu (1905) III 397 A. Ff. 1-61. Nevari. 
Incomplete (ends in adhyaya 35). 


GARGA 

Author of a Sivaruna. Manuscript: 

RORI (Udaipur) 4369 (35). F. 85. Copied in Sarn. 
1793 = A.D. 1736. 


GARGA 

Alleged author, with other munis, of a Sarvapra- 
kasad!pika, in which is mentioned Saka 1560 = A.D. 
1638. Manuscript: 

Oxford CSS I 135 (e. 168 (3)B). Ff. 11 and 20-33. 
Incomplete. 


GARGA 

To Garga is also attributed a Svapnddhydya. 
Manuscripts: 

GJRI 11717/1255. Ff. 1-3. Maithili. 

GJRI 11718/1256. Ff. 1-2. Maithili. Incomplete. 
RORI (Jaipur) 10972. 4ff. (f. 3 missing). Copied by 
Thakaradasa at Kasi. (Svapnakeraliya). Incom¬ 
plete. 


^GARGA (fl. ca. 900?) 

Additional manuscripts of his Pdsakevali (see 

CESS A 2, 122b-126a; A 3, 30b-31a, and A 4, 

80a-80b): 

EDI (VDS) 1385 (9816) = *LDI (DSC) 9816. 9ff. 
Copied by Mandava Josi at Senapura in Sam. 
1559 = A.D. 1502. 

RORI (Udaipur) 574. 8ff. Copied in Sarn. 1628 = 
A.D. 1571. 

New Delhi, NM 50/198. 12ff. Copied in Sam. 1654 
= A.D. 1597. 

RORI (Bikaner) 15951. 5ff. Copied by Ramacandra 
at POgala in Sarn. 1663 = A.D. 1606. 

Jodhpur 2847. 8ff. Copied by Devaji in Sarn. 1665 
= A.D. 1608. No author mentioned. 

RORI Cat. IV 20362 (1). 5ff. Copied by Sugunakirti 
in Sarn. 1699 = A.D. 1642. 

RORI Cat. IV 20498 (1). Ff. 37-44. Copied by Gah- 
garama at Balotara in Sarn. 1722 = A.D. 1665. 

RORI (Chittorgarh) 4514. 8ff. Copied by Rajase- 
khara at Manaragrama in Sarn. 1722 = A.D. 
1665. 

RORI (Jaipur) 5172. 8ff. Copied by Ramacandra in 
Sarn. 1724 = A.D. 1667. 

NFS (Sanskrit) 9277. 40ff. Copied by Jagajjivana 
Sarman Caturveda on Thursday 7 suklapak^a of 
Bhadrapada in Sarn. 1728 = 31 August 1671. 

RORI (Chittorgarh) 1527. 5ff. Copied by Rinamalla 
in Sarn. 1747 = A.D. 1690. 

RORI (Chittorgarh) 362. 5ff. Copied at Jodhapura 
in Sarn. 1752 = A.D. 1695. 

RORI (Bikaner) 17000. 13ff. Copied at Burahana- 
pura in Sarn. 1754 = a.d. 1697. 

RORI (Chittorgarh) 298. 4ff. Copied in Sarn. 1758 
= A.D. 1701. 

RORI (Bikaner) 15094. 7ff. Copied by Sukhananda 
at Multana in Sarn. 1780 = a.d. 1723. 

RORI Cat. IV 19402. 5ff. Copied by Vidyasekhara at 
Gudha in Sarn. 1783 = a.d. 1726. 

LDI (Gujarati)' 3706 (6231/2) = *LDI (MFC) 
F/6261/2. Ff. 5-10. Copied by Nemaratna Gaiii, 
the pupil of Nayaratna Gaiii, in Sarn. 1787 = 
A.D. 1730. (Prcchdsakundvali in Gujarati). 

RORI Cat. IV 19236. 6ff. Copied in Sarn. 1787 = 
A.D. 1730. 

RORI (Udaipur) 6218. Off. (f. 1 missing). Copied 
by Sukharama Misra in Sarn. 1792 = A.D. 1735. 
Incomplete. No author mentioned. 

RORI Cat. V 23066. (10). Ff. 223-240. Copied in 
Sarn. 1793 = a.d. 1736. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


85 


RORI (Jaipur) 6283. 7ff. (ff. 1-2 missing). Copied 
by Panc^ita Jivanadasa at Padalau in Sam. 1793 
= A.D. 1736. Incomplete. 

RORI Cat. IV 19364. 9ff. Copied at Dilli in Sarn. 
1795 = A.D. 1738. 

RORI (Jaipur) 3278. 4ff. Copied by Raghavacandra 
Gani in Sarn. 1799 = A.D. 1742. No author men¬ 
tioned. 

RORI (Chittorgarh) 4261. 7ff. Copied by Rupacan- 
dra at Kalauna in Sarn. 1810 = A.D. 1753. 

EDI (VDS) 1334 (9715) = *LDI (DSC) 9715. 5ff. 
Copied by Devendravijaya at Surata in Sarn. 1828 
= A.D. 1771. 

RORI (Jaipur) 2636. 7ff. Copied in Sarn. 1837 = 
A.D. 1780. No author mentioned. 

RORI Cat. IV 21301. 7ff. Copied by Lak§micandra 
Yati in Sarn. 1838 = A.D. 1781. 

RORI Cat. IV 18674. 8ff. Copied by Rupacandra, 
the pupil of Devacandra Gani, in Sarn. 1843 = 
A.D. 1786. 

RORI (Jaipur) 6914. 6ff. (f. 1 missing). Copied by 
Pandita Gaudidatta in Sarn. 1848 = a.d. 1791. 
Incomplete. 

WHMRL /3 663. Ff. 1-8, 9/10, and 11. Copied in 
Sarn. 1848 = A.D. 1791. 

RORI Cat. IX 29194 (1). 3ff. Copied by Dharmacan- 
dra, the pupil of Sivacandra, at Pali in Sam. 1853 
= A.D. 1796. 

Pattan II 13756. 7ff. Copied in Sarn. 1860 = a.d. 
1803. 

Kathmandu (1965) 151 (5978). 7ff. Copied by Jaya- 
rama on Friday 11 kr§napak§a of Karttika in 
Sam. 1862 = 15 November 1805. 

Vrndavana (micro) 429. 6ff. Copied in Sam. 1865 = 
A.D. 1808. Property of Visvambhara Gosvamin of 
Vrndavana. 

Oxford CSS I 203 (*d. 766 (6)). Ff. 1-11. Copied by 
Adhara Tripathin at the Ramacandrasannidhi 
near Kasi on Saturday 9 suklapak§a of Pro§tha- 
pada in Sarn. 1870, Saka 1735 = 4 September 
1813. 

RORI (Jaipur) 6743. 6ff. Copied by Mahimaratna at 
Nathusara in Sarn. 1870 = a.d. 1813. 

RORI (Bikaner) 15097. 4ff. Copied by Kirtisagara at 
Vikramapura in Sarn. 1872 = a.d. 1815. 

Pattan II 13526. 4ff. Copied in Sarn. 1875 = a.d. 
1818. (Sakunavall in Gujarati). 

Pattan II 14482. 6ff. Copied in Sarn. 1875 = a.d. 
1818. In Gujarati. No author mentioned. 

RORI (Jaipur) 6020. 5ff. Copied at Patodi in Sarn. 
1875 = A.D. 1818. 

RORI (Chittorgarh) 1909. 5ff. Copied in Sarn. 1875 
= A.d. 1818. 


RORI Cat. XVI 36501. 8 ff. Copied by Caritrase- 
khara at Malasisara in Sarn. 1880 = a.d. 1823. 

RORI (Bikaner) 15953. 7ff. Copied by Samatisena at 
Nathusara in Sam. 1882 = a.d. 1825. 

RORI (Jaipur) 8469. 7ff. Copied in Sam. 1882 = 
A.D. 1825. 

RORI (Bikaner) 15093. 7ff. Copied by Rajarupa in 
Sam. 1884 = a.d. 1827. 

RORI (Bikaner) 17498. 4ff. Copied in Sam. 1884 = 
A.D. 1827. 

RORI (Jaipur) 3947. 5ff. Copied by Pandita Laid at 
Bhujanagadha in Sarn. 1884 = a.d. 1827. 

RORI (Jaipur) 3287. 2Iff. Copied in Sam. 1888 = 
A.D. 1831. No author mentioned. 

RORI (Chittorgarh) 1943. 9ff. Copied by Nihala- 
canda at Pali in Sarn. 1889 = a.d. 1832. 

RORI (Chittorgarh) 1659. 8 ff. (f. 1 missing). Copied 
in Sam. 1890 = a.d. 1833. Incomplete. 

New Delhi, H. B. Lall 58. 8 ff. Copied by Ramanuja- 
dasa Salagrama at Mathura on 13 suklapak§a of 
Vaisakha in Sarn. 1898 = ca. 3 May 1841. 

RORI (Bikaner) 15952. 8 ff. Copied at Mirajapura in 
Sarn. 1900 = a.d. 1843. 

RORI (Chittorgarh) 4529. 9ff. Copied by Balacanda 
at Kalakatta in Sarn. 1916 = a.d. 1859. 

GJRI 11075/1129. Ff. 1-5. Copied in Saka 1788 = 
A.D. 1866. No author mentioned. 

RORI (Jaipur) 9395. 8 ff. Copied by Kalulala in Sarn. 
1927 = A.D. 1870. 

RORI Cat. IV 21457. 4ff. Copied by Cunnilala 
Vyasa, the son of Madhoraya, at Pokarana in 
Sarn. 1931 = A.D. 1874. 

RORI (Alwar) 5417. llff. (f. 3 repeated). Copied by 
Baladatta in Sarn. 1934 = a.d. 1877. 

RORI (Chittorgarh) 1795. 6 ff. Copied in Sarn. 1939 
= A.D. 1882. 

Oxford CSS I 204 (*d. 773 (15)). Ff. 1-13. Copied 
by Ramasahaya on Tuesday 1 suklapaksa of 
Pausa in Sarn. 1952 = 17 December 1895. 

AS Bengal III.A. 198. No author mentioned. 

BHU B.2907. 12ff. No author mentioned. 

BHU C.89. 14ff. Sarada. (Marutjnana). 

BHU C.302. 13ff. Sarada. 

Bhubaneswar IV 39 (Jy/22c). 4ff. Oriya. From Rana- 
pur, Puri District. 

BM Or. 13735. Ascribed to Narada. With a < Saku- 
navall >. 

Delhi Jaina (Dharmapura) 428 (Gutaka No. 52). 
20ff. Incomplete. 

GJRI 8515/740. Ff. 1-12. No author mentioned. 

GJRI 8516/741. Ff. 1-12. No author mentioned. 

GJRI 8517/742. Ff. 1-11. Maithili. No author men¬ 
tioned. 


86 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GJRI 8678/903. Ff. 1-3. Maithili. Ascribed to Kala- 
bhaskara. 

GJRI 11076/1130. 3ff. Incomplete. No author men¬ 
tioned. 

Jaipur (Khasmohor) 2164 (with a bha§artha); 3215 
(3) (in bha§a); 3428 (1) (in bha§a; no author 
mentioned); 5039; 5133; and 5605. 

Jodhpur 2848. 12ff. 

Jodhpur 2849. 7ff. 

Jodhpur (Hindi/Rajasthani) 339ka. Ff. 107-116. 

EDI (Gujarati) 3705 (7333). 2ff. Copied by Sujhana- 
vijaya Gani at Mandavi. In Gujarati. 

NFS (Sanskrit) 9050. Ff. 3-8. Incomplete. 

NFS (Sanskrit) 9051. Ff. 1-19 and 21-28. Incom¬ 
plete. 

Oxford CSS I 205 (*d. 790 (3)). Ff. 1-24. 

Oxford CSS I 206 (*e. 145 (5)). Ff. 1-17. Appar¬ 
ently formerly the property of Kevalakr§na of 
Visvesvarapura. 

Fattan II 2791. 4ff. In Gujarati. No author men¬ 
tioned. 

Fattan II 2792. 3ff. In Gujarati. No author men¬ 
tioned. 

Fattan II 7271. 7ff. In Gujarati. 

Fattan II 8900. 3ff. In Gujarati. No author men¬ 
tioned. 

Fattan II 12435. 5ff. In Gujarati. No author men¬ 
tioned. 

Fattan II 14203. 14ff. In Vrajabha§a. No author 
mentioned. 

Fattan II 14237. llff. No author mentioned. 

Frayaga 3776. 25pp. (SakunavaU in Hindi/ 

Rajasthani). Acquired from Mahendra Kumara 
Manava of Vindhyapradesa. 

RORI Cat. IV 20029. lOff. (f. 3 missing). Copied by 
Sakarmana at Savai Jayapura. 

RORI Cat. IV 20860. 15ff. 

RORI Cat. IV 21291. 7ff. 

RORI Cat. V 22408. 3ff. Copied by Fremacandra at 
Fali. 

RORI Cat. V 22537 (3). Ff. 1-94. 

RORI Cat. V 23158. 9ff. 

RORI Cat. VII 25574 (71). Ff. 99-101. 

RORI Cat. VII 26083. 4ff. (f. 2 missing). Incomplete. 

RORI Cat. VII 26263. 16ff. Copied by Savai, the 
son of Giridharin Vyasa, at Fokarana. 

RORI Cat. IX 30072 (1). 12ff. Copied by Vrddhi- 
sundara. 

RORI Cat. XVI 35165. 7ff. 

RORI (Chittorgarh) 3102. 7ff. No author mentioned. 

RORI (Chittorgarh) 3370. 8ff. 

RORI (Chittorgarh) 3849. 4ff. 

RORI (Chittorgarh) 4085. 5ff. (ff. 3-4 missing). 


Incomplete. 

RORI (Jaipur) 5191. 5ff. 

RORI (Jaipur) 5641. 9ff. Copied by Fandita Manasu- 
kha Devikota. 

RORI (Jaipur) 6003. 6ff. 

RORI (Jaipur) 7649. 6ff. Incomplete. 

RORI (Udaipur) 1430. 17ff. 

RORI (Udaipur) 4129 (7). Ff. 1-4. Incomplete. No 
author mentioned. 

RORI (Udaipur) 6181. 6ff. No author mentioned. 
Vrndavana 2233. 23ff. 

Vrndavana 6588. 7ff. 

WHMRL a 1284. Ff. 1-6. 

WHMRL 300. Ff. 1-5. 

The version of this work preserved in the Bower 
manuscript is also edited by Kaviraj Balwant Singh 
Mohan in his Navanltakam, Lahore 1925, pp. 
134-142. 


GIRADHARAJI {fl. 1980) 

Author of a Hasta samudrika sastra in Hindi, 
published at Mathura in 1980. 


^GIRIJAPRASADA DVIVEDIN (fl. 1911/1926) 

The son of Durgaprasada Dvivedin (fl. 
1891/1936) and, like him, a resident of Fanditapuri 
to the west of Ayodhya, Girijaprasada (see CESS A 
2, 126b) also wrote a tika, Prabha, together with a 
Hindi explanation and an upapatti on the ganitadh- 
yaya of the Siddhantasiromani of Bhaskara (b. 
1114). This was completed on 16 February 1913, but 
was published at Lucknow only in 1926. The Pra- 
bha's upasarnhara is: 

ayodhyapascimaprante sarayutamasantare / 
nanadrumalatavarnsaprasunodyanabhu$ite //!// 
kOjadvihaiigamakridakamaniyakale vare / 
svarjite panditapurigrame sambasivalaye HIH 
brahmadhyanaratasvantah sarvagamani§iktadhih / 
srimaddurgaprasado ’sti dvivedakulacandramah //3// 
tatsuteneha girijaprasadena yathamati / 
anuvadah krtah samyak tena tu^yatu sahkarah HAH 
yate§u vikramabde§u navahganavabhumi§u / 
siromaneh suprabheyarn sabha§ya purnatam agat 

H5H 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


87 


GIRIDHARA 

The son of Virabhatta or Vanibhafta, Giridhara 
wrote a Tajakasabdaugha. Manuscript: 

WHMRL a 1462. Ff. 1-4 and If. Copied in Sam. 
1870 = A.D. 1813. Formerly property of 

Badrinarayana Misra of Daulatganj, Chhopra. 

Verse 1 is: 

vighnarajam namaskrtya balanam hitakamyaya / 
vak^ye tajakasabdaugharn vanibhattatmajah krti // 

The colophon begins: iti srivirabhattatmajagiri- 
dharakrto. 


^GIRIDHARA BHATTA {fl. 1587) 

Additional manuscript of his Jaganmani (see 
CESS A 2, 126b-127a): 

RORI Cat. VIII 28057 (7). Ff. 52-56. Copied at Pali 
in Sam. 1702 = A.D. 1645. 

GIRIDHARA S ARM AN {fl. 1847) 

The son of Nandakisora of the Gargavarnsa, Gi¬ 
ridhara composed a Grahasantipaddhati at Jayapat- 
tana on 6 krsnapak^a of Sahasya in Sarn. 1903 = 7 
January 1847. Manuscript: 

RORI (Jaipur) 2858. 53ff. Copied by Yamunalala 
Sarman for Cirahjiva Harivallabha Sarman. 

Verse 2 at the beginning is: 

vande nandakisorarn pitararn harim atmanah 
prabodhaya / 

radhayutam aravinde hrdi sukhapuhjarn sama- 
sinam // 

The last two verses are: 

jayapattanamadhyagatena maya- 
khilarak§asanatharipoh sadane / 
nigamanadhikarijanasya krte 
racita khagasantir iyam subhada // 
gunakhaiikarupasahkhye 
var§e sahasyasitadale sa§tyam / 
racita grahamakhasantir 
giridharanamna dvijagryena // 


The colophon begins: iti srigargasavamsodbhave 
nandakisorasunugiridharasarmaviracita. 

GIRIDHARIN LALA PACAURl 

Author of a Jhdnasarodhd in Hindi. Manuscript: 

Vrndavana (Hindi) 2833. 22ff. (ff. 20-62 missing). 
Incomplete. 

^GIRIDHARIN MISRA (fl. 1821/1849) 

Additional manuscripts of this author’s (see 
CESS A 4, 80b) Lagnavada (see CESS A 2, 127a, 
and A 3, 31a): 

Kathmandu (1964) 26 (3016) B. 2ff. (with Bala- 
kr§na’s Uccavada). 

RORI (Alwar) 2691 = *Alwar 1945. 3ff. 

The colophon begins: iti srigurudurgasahkara- 
panditacaranaptabodhamaithilagiridharimisrakrto. 

GIRIDHARIN LALA GOSVAMIN (fl. 1965/1974) 

The son of Lak§midevi and Jivanadasa Gosva- 
min, Giridharin wrote a Phalitajyou^aviveca- 
natmakabrhatparasarasamlk^d, for which he 
received a Ph.D. from Delhi University in 1965. It 
was published at Dehali in [1974]. 

GIRIPRASADA 

Author of a Kalamana in Hind!. Manuscript: 
Vrndavana (Hindi) 10712. 6ff. 

GIRISACANDRA 

Author of a Panjika. Manuscript: 

BHU C.5231. 19ff. Bengali. 

^GUNARATNA SURI (fl. ca. 1375) 

Additional manuscripts of his avacurni on the 
Navyabrhatk^etrasamasa of Somatilaka Suri (fl. 


88 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


1298/1367) (see CESS A 2, 127a-127b; A 3, 
31a-31b; and A 4, 80b-81a): 

Pattan II 1167. 12ff. Copied in Sam. 1462 = a.d. 
1405. 

Pattan II 7635. 16ff. Copied in Sam. 1508 = a.d. 
1451. 

RORI (Bikaner) 14138. 25ff. Copied in Sam. 1520 
= A.D. 1463. 

BM Or. 5178 = *Jacobi. Copied in Sam. 1526 = 
A.D. 1469. 

Pattan II 3713. 71ff. Copied in Sam. 1537 = a.d. 
1480. 

Pattan II 1165. 9ff. 

Pattan II 1166. 19ff. 

Pattan II 3585. 8ff. 

Pattan II 7634. 12ff. 

Pattan II 10589. 23ff. 

RORI Cat. IV 19535. 39ff. (f. 38 missing). 


*GUNAKARA (/?. between 1100 and 1400) 

Additional manuscripts of his Horamakaranda 
(see CESS A 2, 127b-128b; A 3, 31b; and A 4, 81a): 

RORI (Udaipur) 547. 19ff. Copied by Thakursi Cela 
in Sam. 1720 = A.D. 1663. 

RORI (Alwar) 2778. 54ff. Copied in Sam. 1907 = 
A.D. 1850. 

AS Bengal I.B.9. Bengali. 

BHU B.815. 52ff. 

BHU C.249. 5ff. Incomplete. 

Oxford (Vyasa) 179. Ff. 19-21. Incomplete (adhyaya 

11 ). 

RORI Cat. VII 26159. 32ff. (ff. 2 and 8 missing). 
Incomplete. 

RORI (Alwar) 2779. 103ff. 

RORI (Chittorgarh) 1226. 14ff. Incomplete. 

RORI (Udaipur) 5349. 17ff. Incomplete (to adhyaya 
3). 

WHMRL 169 = *G.75.b. Ff. 1-30. 


*GURUPRASADA NYAYABHU^ANA 

Author also (see CESS A 2, 129a) of a vyakhya 
on the Suddhitattva of Raghunandana (fl. ca. 
1520/1570). Manuscript: 

Sastri, Not. 1900. 368. 16ff. Bengali. Property of 
Pandita Raghurama Tarkaratna of Vi$nupura, 
Vakuda. 


The colophon begins: iti mahamahopadhyayagu- 
ruprasadanyayabha§anabhat facaryaviracita. 

GURUMISRA (or GURUSI^YA) BHATTA 

Author of a Mayuracitra, apparently a part of a 
Suraparvan. Manuscripts: 

Bhubaneswar IV 131 (Jy/27). 86ff. Oriya. Incom¬ 
plete. From Puri. 

Bhubaneswar IV 133 (Jy/47a). llff. Oriya. Incom¬ 
plete. From Bhubaneswar. 


^GURUSEVAKA {fl. 1731) 

The son of Visvesvara, the son of Paramananda, 
the son of Pafhinasa of Rautasipura, Gurusevaka 
was the pupil of Cidrupa Kaula, the son of Sahiva 
Kaula, the son of Siva Rajanaka of Kasmira. He 
completed his Ganakapuspasirovatamsa (see CESS 
A 2, 129a, and A 3, 31b) on Sunday 5 suklapaksa of 
Magha in Sam. 1787 = 31 January 1731. The Gana- 
kapu^pasirovatatnsa has 5 stabakas: varjyavarjyava- 
ravaranavivahavidhupravesadviragamana; sarnskara- 
muhurta; grhasthadharmavicara; rajadharmavicara; 
and se§avyavaharavicaramuhurtaguruvarakulasva- 
kulavarnanavicara. Additional information concern¬ 
ing a manuscript: 

WHMRL i3 569 = *G.93.k. Ff. 1-20. Copied by 
Suddha R§i, the pupil of Vajira R§i, at 
Paftinagara on Wednesday 13 suklapaksa of 
Magha in Sam. 1921 = 8 February 1865. 

Some verses of stabaka 5 are: 

kasmire sivanamadheya iti yo rajanako ’bhot 
prabhur 

jyotirvin nigamagamajnamukutah satsastrakarta 
svayam / 

siddhir yasya sulekhikapi mahati sa sa subha 
paddhatir 

yais tattacchubhakarmanarn gunavatam anandahetoh 
krta //38// 

jhanananda udaradhir gunagani tatputrako ’jayata 
vedacaravicaramarganipunah §atsastraparahgami / 
vedante sivadharmake ’pi mahatijhane krta candrika 
tika yena vinirmita suvimala srikhandakhadye 
sub ha //39// 

srimadsahivakaulakah sivasutah putro ’vabha$ad- 
bhutah 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


89 


kr§nanandapitajito budhavaraih sabde yadiye ha- 
that / 

japta tena ca sarada hy anasanam dvavimsa ca svam 
krtam (?) 

prita tatra samagata bhagavati datum varam sada- 
ram //40// 

vikhyatas te trilokyam gunaganamahima miyate 
kena te§am 

siddhinam a§takam yatpadayugalaparair apyate 
si§yavargaih / 

tadvamse nathakaulo gunaganasahito ’bhut parasra- 
stahobhih (?) 

svalpais tajjau sutau dvau prabhubhir api krtau 
sthapitau tatpade ca II52II 

srimadbhupatipujitanghriyugalah satyaikasarah sada- 
nandadyotitamanasah sumanasam ekantasevyo 
munih / 

sricidrupasukaulako gunanidhih srisahivasyatmajo 
jato ’nyah svakulaprakasavibhavah prakasakaulabhi- 
dhah //53// 

pathinaso dvijavaro gananajnavaryo 
rautasinamni puri karapathe babhuva / 
tasyatmajah paramananda iti prasiddho 
visvesvarah paramanandasuto babhuva //55// 
tasyatmajo gunanidhir gurusevako ’ham 
sahityatarkagananagamasabdavijnah / 
vedantadharmaphanibha§itasastrasahghas 
cidrupakaulapadakahjadayaptavidyah //56// 
tantre saubhagyacandrodaya iti racita paddhatis 
carkasahkhya- 

sahasrair yena ramya dasasu viracita stotrapahktih 
sivasuh (?) / 

tenayam nirmito vai dvijavarakavina vikramaditya- 
sake 

saila§tar§indusahkhye sati tapasi sita pahcami 
suryavare //58// 

bhuyac ciram ganakapuspasirovatamsah 
prityai maya viracito vidusam hitaya / 
dr§tva matani bahuso muninirmitani 
k^antavyam atra yadi kim ca bhaved asuddharti //59// 

The colophon begins; iti srimacchrisarvasastra- 
visaradasrisaccidrupakaulapadapadmopajivimisra- 
gurusevakaviracite. 

GULABARAYA 

Author of a Kalaniri^aya. Manuscripts: 

Jaipur (Dharma) 137. 58ff. Incomplete. 

Jaipur (Dharma) 138. 9ff. Incomplete. 

Jaipur (Dharma) 139. 3ff. Incomplete. 


GULABAVIJAYA (fl. 1919) 

The pupil of Vijayaraja SQri of the Brhattapagac- 
cha, Gulabavijaya completed a Muhunaraja at 
Vagara on 5 suklapak^a of Karttika in Sam. 1976 = 
ca. 28 October 1919. This was published with the 
parisi§tas of Govindarama Gaurisahkara Dvivedin 
and the Hindi tika, Rajendra, of Jayaprabhavijaya 
at Rajagadha in 1986. The next to the last verse is: 

srimadrajendrasurer nikhilagurugunakhyMamQrteh 
krpabhir 

jyotirgranthabdhimadhyan manir iva vihitas cai§a 
mauhartarajah // 

§atsaptahkenduvar§e jagati gunavare ’vagarakhye 
pure sri- 

pancamyarn jnanadatryam munivijayayutaih 
srigulabaih pramodaih // 

The colophon begins: iti srisaudharmabrhattapa 

gacchiyasrivijayarajendrasurisvarantevasimunisri- 

gulabavijayasahgrhite. 

GOKARNA SARMAN 

Author of a Masamlmamsd; cf. the Masa 
mlmamsd of Gokulanatha Upadhyaya (fl. ca. 
1675/1740). Manuscript: 

BHU B.1248. 15ff. Bengali. 

^GOKULANATHA 

Additional manuscripts of his Makarandavasand 
(see CESS A 2, 129b, and A 4, 81a): 

RORI (Alwar) 2607 = *Alwar 2024. 125ff. Copied 
in Sarn. 1902 = a.d. 1845. 

Kathmandu (1964) 70 (7257). 120ff. 

RORI (Alwar) 5717. 28ff. Copied by Ramadhana. 
(Pancdhgopapatti). 

^GOKULANATHA UPADHYAYA (fl. ca. 
1675/1740) 

Additional manuscripts of his Dvaitanirnaya- 
pradlpa (see CESS A 2, 129b; A 3, 32a; and A 4, 
81b) on the Dvaitanirnaya of Vacaspati Misra: 



90 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GJRI 9467/619. Ff. 1-7. Maithili. Copied in Saka 
1792 = A.D. 1870. 

GJRI 9987/687. Ff. 1-4. Maithili. Copied in Saka 
1818 = A.D. 1896. 

AS Bengal I.D.5. Bengali. 

GJRI 5339/370. Ff. 1-2. Maithili. Incomplete. 

GJRI 7478/578. Ff. 3-7. Maithili. Incomplete. 

GJRI 9466/618. Ff. 1-5. Maithili. 

Gokulanatha also wrote a KundakMambari. 
Manuscripts: 

Darbhanga, Raja Library. See NCC, vol. 6. p. 113.- 
Mithila I 65. 95ff. Maithili. Property of the Citra- 
dhar Library, Tabhaka, Dalsing Sarai P.O., Dar¬ 
bhanga. Formerly property of Citradhara Misra. 

The KundakMambari was edited by Dharmana- 
tha Jha and Kumudanatha Misra as Gokulandtha- 
granthavali 7, Darabhahga 1982. 

He also wrote a KundakMambarisaroddhara. 
Manuscript: 

Mithila I 66. 8ff. Maithili. Property of Babu Can- 
dradhari Singh, Rauti Deaurhi, Madhubani P. O., 
Darbhanga. 

GOPALA 

Author of a part of a Ganita in Oriya. Manu¬ 
script: 

Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 
From Ranapur, Puri District. 

GOPALA 

Author of a GrahakalpavalPi on which he also 
wrote an udaharana. Manuscript: 

Mysore ORI P.4232/1 and 2. Ff. 1-4 and 4-12. 

*GOPALA 

Additional manuscripts of his Grahacudamani- 
sMinl (see CESS A 3, 32b): 

*Poona, Mandlik. Jyotisha 30. 12ff. 

RORI (Chittorgarh) 1241. 4ff. Incomplete. 


GOPALA 

Author of a Jyotiratna\ cf. the Gopalaratndkara 
of Gopala (see CESS A 2, 130a; A 3, 32a-32b; and 
A 4, 81b-82a). Manuscript: 

Bhubaneswar IV 68 (Jy/57a). 196ff. Oriya. Incom¬ 
plete. From Jagatsirnhapur, Cuttack District. 

The Jyotlratna contains the following lines: 

Jyotiratnam idarn tanoti sudhiyarn modaya nanaga- 
man 

sahgrhyakhilakarmasu k§itisuro gopalanama krti / 

^GOPALA 

The manuscript of his Nak^atres (iprayoga (see 
CESS A 4, 82a), which follows Baudhayana, is: 

RORI (Alwar) 580 = *Alwar 90. 55ff. 


'^GARGYA GOPALA 

Manuscripts of his RahasyaprakMa (see CESS A 
2, 130b, and A 3, 32b): 

PUL I Srauta 96. Ff. 22-90. Copied in Sarn. 1867 = 
A.D. 1810. 

AS Bengal 556 (G. 1253) = AS Bengal I 2. 743. 
30ff. 

RORI (Alwar) 569 = Alwar 66 = Alwar (1884) 
Taittiriya 51. 86ff. 

WBISIS 1371 (C). 30ff. Microfilm of AS Bengal G. 
1253. 

WRI 192. 33ff. 

Verse 2 or 3 at the beginning is: 

vadhuianvayarahgarajavidu§ah si§yena vidyanidher 
gargyasrinarasimhayajvatanayenodgrahini nirmala / 
apastambamunindravaktrajanu§irn sulbahvayanarn 
girarn 

gopalena viracyate nayavati sadyajnikalahkrtih // 

The colophon begins: iti srimadvadhulasrirahgaraja- 
misrasi§yasya gargyasrinrsirnhasomasutsutasya go- 
palasya. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


91 


GOPALA 

Author of a Ratrilagnajhana. Manuscript: 

RORI (Chittorgarh) 4188. If. With a Rajasthani sta- 
baka. 


GOPALA 

The son of Narasimha, Gopala wrote a vyakhya 
on the Suryasataka of Mayura. Manuscripts: 

Kerala — (C 1131; C 1134 (ascribed to Gopasiva); 

and C 1621 B). See NCC, vol. 6, p. 134. 

Oppert II 8421. Property of T. Ramarow of Tanjore. 
PUL II 4692. lOOff. Grantha. 


GOPALA DESIKA 

The son of Kr§narya of the Atreyagotra and the 
pupil of Vedanta Ramanuja, Gopala wrote the fol¬ 
lowing works: 

1. Jayantinirnaya. Manuscripts: 

GOML Madras D.3117. Ff. l-86v. Grantha. Copied 
by Sisu, the pupil of Kasturi Rahgarya. 

Tirupati 2050 (4618). Grantha. Incomplete. 

The colophon begins: iti srimadatreyakr§narya- 
tanujasya taccaranakamalacahcarikasya srimad- 
vedantaramanujayogindramahadesikakatak^alabdha- 
vedantarahasyajalasya srigopaladesikasya krtisu. 

2. Nrsimhajayanunirnaya. Manuscript: 

GOML Madras D.3138. Ff. 98-100. Grantha. 

The colophon begins: srigopaladesikaviracitah. 

3. 'SravanadvMasanirti,aya. Manuscripts: 

GOML Madras D.3143. Ff. 19v-24. Grantha. 

GOML Madras D.3144. Ff. 87-97. Grantha. 

GOML Madras D.3145. F. 17. Grantha. Incomplete. 

The colophon begins as does that of the Jayann- 
nirnaya. 

4. Snramanavamtnirnaya. Manuscript: 

GOML Madras D.3146. Ff. lOO-lOlv. Grantha. 


The colophon begins: iti gopaladesikaviracita. 

GOPALA PANDURANGA 

Author of a Kundamrdanga. Manuscript: 

RORI (Alwar) 3750 = Alwar 1303. 4ff. Copied in 
Sam. 1910 = a.d. 1853. 

This may be identical with the Kundadipa of 
Gopala. Manuscripts: 

SOI. 2 manuscripts according to NCC, vol. 4, 179; 1 
manuscript according to NCC, vol. 4, p. 184. 

GOPALA SIDDHANTAVAGlSA 

Author of a commentary, Udvdhatattvaloka, on 
the Udvdhatattva of Raghunandana (ft. ca. 
1520/1570). Manuscripts: 

Benares (1956) 13228. Ff. 1-22. Incomplete. 

Dacca 201 D. (Udvahavyavasthdsahk^epa or Ud- 
vdhasahksepa). See NCC, vol. 6, p. 151. 

He is presumably identical with the Gopala Bhaf- 
tacarya who wrote a commentary, Tithitattvdloka, on 
the Tithitattva of Raghunandana. Manuscript: 

BHU C.4112. 91ff. Sarada. Incomplete. 

GOPALA {fl. before ca. 1000) 

Author of a Gopalakarika = Baudhayanakdrika, 
which includes a section, viharakarika, on sulba. 
Manuscripts: 

BORI 27 of 1883/84. 22ff. Copied in Sam. 1739 = 
A.D. 1682. (prayascitta). From Gujarat. 

Bombay U 788. 20ff. Copied by Govinda Bhaskara 
on Friday 3 kr§napak§a of Margasir§a in Saka 
1657 = 21 November 1735. Incomplete (ends 
with caturmasya). 

Baroda 5989. 2ff. Copied by Laksmana, the son of 
Rama Umrajakara, on Sunday 30 kr§napak§a of 
Jye^tha in Saka 1674 = 31 May 1752. 

Baroda 10904. Off. Copied at KaU in Saka 1679 = 
A.D. 1757. Incomplete (darsa to caturmasya). 
Baroda 11094. 17ff. Copied at Kasi in Sarn. 1814 = 
A.D. 1757. Incomplete (darsa to caturmasya; and 
vihara). 


92 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


AS Bombay 572. 12ff. Copied on 1 kr§napak§a of 
Magha in Sam. 1825 = ca. 20 February 1769. 
Incomplete (somakarika). Formerly property of 
Se§abhatta, the son of Nagesa Thai! of Ujjayini. 

Baroda 6018 (b). Ff. 57-58. Copied in Saka 1697 = 
A.D. 1775. Incomplete (adhana). 

Wai 2662. 40ff. Copied in Saka 1698 = a.d. 1776. 
Incomplete (begins with adhana). 

Wai 2664. 25ff. Copied in Saka 1709 = a.d. 1787. 
Incomplete (syenacayanakarika). 

lO 4738 (Buhler 52). 76ff. Ff. 1-47 copied by 
Ramacandra Devastha}a on Saturday 6 sukla- 
pak§a of Phalguna in Saka 1742 = 10 March 
1821; ff. 48-76 copied by Apabhata Devasthala 
on Thursday 5 kr§napak§a of adhika Jye^fha in 
Saka 1742 = 25 May 1821. Formerly property of 
Vahcabhatfa Karve. From G. Buhler. 

GOML Madras R.1360. Ff. 1-44. Grantha. Copied 
in 1914/15 from a manuscript belonging to Siva- 
rama Sastri of Trichinopoly. 

Anandasrama 148A; and 6049. See NCC, vol. 6, p. 
135. 

AS Bengal 709 (G.1683). 6ff. Incomplete (catur- 
masya). 

AS Bengal 710 (G.1874) = Mitra, Not. 4261. 26ff. 
Incomplete (somakarika). 

AS Bengal 785 (G.2084). 5ff. Incomplete (darsa- 
purnamasa and caturmasya). No author men¬ 
tioned. 

AS Bengal 786 (G.455) = Mitra, Not. 1358. 9ff. 
Incomplete. No author mentioned. 

Baroda 438. 2ff. Incomplete (darsapurnamasa). 

Baroda 489. 5Iff. Incomplete (darsa to soma). 

Baroda 490. 30ff. Incomplete (syenacitkarika). 

Baroda 8503. 26ff. Incomplete (darsa to catur¬ 
masya). 

Baroda 12713. Ff. 1-8. Incomplete (darsa to catur¬ 
masya). 

Benares (1953) 1961. Ff. 1-19. 

Benares (1953) 4397. 2ff. 

BISM thi 14. Incomplete (syenacitkarika). See NCC, 
vol. 6, p. 132. 

Bombay U 789. 2ff. Incomplete (darsapurnamasa). 

BORI 397 of 1883/84. 15ff. Incomplete (soma). 
From Mahara§tra. 

Hultzsch 2.681. 88ff. Grantha. Incomplete. Property 
of Sundaresvara Srauti of Tiruvaiyaru. 

IL Calcutta 331. Incomplete (cayana) See NCC, vol. 
6 , p. 135. 

IM Calcutta 1904; 2629 (incomplete); and 2639. See 
NCC, vol. 6, p. 135. 

IM Calcutta 8481. Incomplete. See NCC, vol. 6, p. 
132. 


lO 440 (619 d). 19ff. From H. T. Colebrooke. 

Kavindracarya 421. See NCC, vol. 6, p. 135. 

Kerala 5016 (1635). 415 granthas. Incomplete. 

Kerala 5017 (1636). 595 granthas. Incomplete. 

Kerala — (4783). Incomplete (viharakarika). See 
NCC, vol. 6, p. 132. 

Mysore ORI P.355/2. Ff. 43-70. Telugu. 

Nasik, Patawardhan 628; and 818. See NCC, vol. 6, 
p. 135. 

Oppert I 2136. 41pp. Grantha. Incomplete (begins 
with darsapurnamasa). Property of Yajhasrauti of 
Bhavani, Coimbatore District. 

Oppert II 8731. Incomplete (caturmasya). Property 
of Balakr^nasastrin of Tiruvadi, Tanjore District. 

Oppert II 10128. Property of Ramasvamidik§itar of 
Pinnaivasal, Trichinopoly District. 

SOI. See NCC, vol. 6, p. 132. 

Wai 2660. 20ff. Incomplete (begins with adhana). 

Wai 2661. 37ff. Incomplete (begins with adhana). 

Wai 2663. 15ff. Incomplete (begins with darsapurna¬ 
masa). 


^GOPALA NYAYAPANCANANA (fl. ca. 1600) 

1. Additional manuscripts of his Tithinirnaya (see 
CESS A 2, 131a; A 3, 33a; and A 4, 82a): 

GJRI 5298/329. Ff. 1-19. 

GJRI 9450/602. Ff. 1-21. Maithili. 

2. Additional manuscripts of his Kalanirnaya (see 
CESS A 2, 131a, and A 4, 82a): 

GJRI 5255/286. Ff. 1-32. Maithili. 

GJRI 9442/594. Ff. 1-21. Maithili. 

3. Additional manuscripts of his Sahkrantinirnaya 
(see CESS A 2, 131a-131b; A 3, 33a; and A 4, 82a): 

Calcutta Sanskrit College (Smrti) Suppl. II 6. No ff. 
given (14ff. with his Sraddhanirnaya). Bengali. 
Copied by Ramanarayana Sarman on Saturday 
purnima of Sravana in Saka 1632 = 29 July 
1710. 

GJRI 9451/603. 7ff. Maithili. 

RORI (Udaipur) 573. 6ff. 


GOPALAKR^NA 

Author of a Vratanirnaya. Manuscript: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


93 


Vrndavana 9143. 7ff. Copied by Kanharadasa in 
Sam. 1953 = a.d. 1896. 


GOPALARAMA 

Author of a Prasnalagnado^ajhana. Manuscript: 
Jammu 4044. 5ff. Copied in Sana. 1941 = a.d. 1884. 


GOPIJANAPRASADA 

Alleged author (is he rather the scribe?) of a 
Vedahgajyotisa. Manuscript: 

Vrndavana 2321. 4ff. Copied in Sarn. 1900 = a.d. 
1843. 


GO Pi NATH A 

Author of a part of a Vamphinala in Oriya. 
Manuscript: 

Bhubaneswar IV ganita 57 (G/40). 50ff. Oriya. 
Incomplete. From Bhubaneswar. 


^GOPlNATHA 

Additional manuscripts of his Budhavallabha (see 
CESS A 2, 132a-132b, and A 3, 33b): 

RORI Cat. XVI 35747. 26ff. Copied on Saturday 2 
krsnapaksa of Vaisakha in Sarn. 1741 = 9 May 
1685. 

RORI Cat. IV 21620. 36ff. Copied by Sarnvalarama 
in Sarn. 1751 = a.d. 1694. 

RORI Cat. IX 28724. 27ff. (ff. 1-2 missing). Incom¬ 
plete. 


GO Pi NATH A 

Author of a tika on the Suryasataka of Mayura. 
Manuscript: 

GOME Madras D.11320. Ff. lOv-39. Telugu. 


GOPlNATHA DAS A 

Author of an Ayurdayasiromani in 12 adhyayas: 
dasaphala, ri§ta, bhavadhipadasantardasaphala, su- 
bhasubhadasaphala, rajayoga, chayadisadhana, jata- 
ka, bhavasadhana, i§taka§tasadhana, balasadhana, 
dasakramadisadhana, and samjhaphala. Manuscript: 

Bhubaneswar IV 3 (Jy/llb). 43ff. Oriya. From Puri. 

He also wrote a Maghamdfiatmya in Oriya. Manu¬ 
script: 

Bhubaneswar 2. Cy/508. 

GOPlNATHA SARM AN 

Author of an Udvahddikalanirnaya; cf. the 
TithyMinirnaya of Gopinatha Bhatfa (see CESS A 
2, 132b). Manuscript: 

Baroda 10226. 14ff. Bengali. Incomplete. 
^GOPlNATHA SUDHl 

Additional manuscript of his Bhdsvatiprakasikd 
(see CESS A 2, 132b): 

NFS (Sanskrit) 9046. Ff. 1-12. Incomplete. 

GOPlNATHA DHARMADHIKARIN (fl. ca. 1650) 

The son of Venipandita (fl. ca. 1600/1650), the 
son of Nandapandita (fl. ca. 1580/1630), Gopinatha 
wrote a Balabhusasara based on his father’s BMa- 
bhu^a. Manuscript: 

Benares (1956) 12649. Ff. 1-34. 

GOPlRAJA 

Author of a Nalikaprabandha. Manuscript: 

RORI Cat. XVI 37225. 3ff. Copied in Sam. 1879 = 
A.D. 1822. 


94 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*GOPIRAJA 

The son of Ramakr$na of the Bharadvajagotra, a 
resident of Parthapura, Gopiraja (see CESS A 2, 
133a) wrote the Bha^ya on Madhusudana’s Paita- 
maht. Additional manuscripts: 

RORI Cat. XVI 37219. 34ff. Copied by Anandarama 
in Sarn. 1782 = a.d. 1725. 

BORI 424 of 1895/98. Ff. 1-47. Incomplete. For¬ 
merly property of Damodara Pan^ita of the 
Kr§natrigotra and the Udicyamelakajnati. 

The last verse begins: 

gahgatira x ivapi parthapure sriramakr^natmajo 
bharadvajakule ’bhavat suganakah srigopirajabhi- 
dhah // 


GOPILALA AMARA {fl. 1984) 

Editor, translator into Hindi, and commentator 
of the Prasavacintamani of Mukunda Daivajfia (/?. 
1917/1924), published at Nai Dilli in 1984. 

*GOPESA KUMARA OJHA (fl. 1956/1983) 

Author also (see CESS A 2, 133b-134a; A 3, 
33b-34a; and A 4, 83a) of a Hindi tika Saurabha- 
bha^ya, on the Jatakaparijata of Vaidyanatha (fl. ca. 
1425/1500). This was published in two volumes at 
Dilli-Varanasi-Patana, 1979-1981. His edition with 
his own tika of the Phaladlpika of Mantresvara saw 
a 2nd ed. in 1975; repr. Dilli-Varanasi-Patana. 
1981. A 4th ed. of his Hastarekhdvijhdna was pub¬ 
lished at Dilli-Varanasi-Patana in 1973; repr. ibid, 
in 1983. 


*GOBHILA 

Additional manuscripts of his Navagrahasdnti 
(see CESS A 2, 134a; A 3, 34a; and A 4, 83a): 

RORI Cat. I 3018. 20ff. Copied by Samala Nagara at 
Giripura in Sarn. 1613 = A.D. 1556 during the 
reign of Maharaya Asakaraiia Raula. Incomplete. 
RORI Cat. Ill 13429. 38ff. Copied by Umasaiikara 
Harisahkara Trivadin in Sarn. 1955 = A.D. 1898. 
Benares (1953) 7103. Ff. 1-14. 

*BORI 249 of 1887/91 = BORI (Dharma) 406. 7ff. 


(ff. 4-5 and 8 missing). Copied by Govardhana 
U < padhyaya > for Gopa < la >, the son of Pad- 
manabha Tri< pathin? >, a resident of Pefali. 


GOVARDHANA 

Author of a Tiihiprakdsa\ cf. the Tithikalpa- 
druma of Malaviya Govardhana Suri (CESS A 3, 
34a) and the Tithiprakdsa of Gaiigadasa Trivedin. 
Manuscript: 

GJRI 5295/326. Ff. 1-4. 


GOVARDHANA DAS A 

Author of a Sagunapradlpa in Hindi. Manu¬ 
script: 

Prayaga 4237. 30pp. Copied on 12 kr§iiapak§a of 
Vaisakha in Sarn. 1928 = ca. 16 May 1871. 
Acquired from Babulala Jaina of Tikamagadha. 


^GOVARDHANA (fl. 1544) 

Additional manuscripts of his Padmakosa (see 

CESS A 2, 134b-135b; A 3, 34a; and A 4, 83b-84a): 

AS Bombay 306 (2). Ff. 9v-16. Copied in Sarn. 1627 
= A.D. 1570. (As (ottarltajika). No author men¬ 
tioned. From Bhau Daji. 

RORI (Jaipur) 7128 (2). Ff. 41-52. Copied by Muni 
Devacandra, the pupil of Kalyariacandra Gaiii, at 
Jodhapura in Sarn. 1675 = a.d. 1618. No author 
mentioned. 

Pattan II 2770. 4ff. Copied in Sarn. 1710 = a.d. 
1653. (bhavadhyaya). 

RORI Cat. Ill 15422. 7ff. Copied by Jayarama in 
Sarn. 1714 = a.d. 1657. No author mentioned. 

RORI Cat. Ill 11584 (6). Ff. 97-103. Copied by 
Jayaratna at Medinipura in Sarn. 1729 = a.d. 
1672. No author mentioned. 

AS Bombay 327. 6ff. Copied in Sarn. 1732, Saka 
1597 = A.D. 1675. No author mentioned. From 
Bhau Daji. 

Oxford (Vyasa) 124. Ff. 1-10. Copied by Rariachoda, 
the son of Vasudeva Vyasa, on Thursday 5 sukla- 
pak§a of A§adha in Sarn. 1736, Saka 1601 = 3 
July 1679. Ascribed to Raghunatha of the 
Karidolakanvaya. Formerly property of Mulaji 
Sivasafrkara Vyasa. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


95 


U Penn 3015. F. 3. Copied on Friday 3 kr§napak§a 
of Jye§tha in Sarn. 1750 = 9 June 1693. Incom¬ 
plete (begins in sani 5d). 

Oxford CSS I 351 (*c. 315 ( 6 )). Ff. 1-6. Copied by 
Krparama on Thursday 7 suklapak§a of Vaisa- 
kha in Sarn. 1786 = 24 April 1729. 

RORI (Bikaner) 14633. llff. Copied by Bhagyavi- 
lasa Muni in Sarn. 1802 = a.d. 1745. No author 
mentioned. 

RORI Cat. I 31. 13ff. Copied by Bhavadatta in Sam. 
1816 = A.D. 1759. No author mentioned. 

RORI (Chittorgarh) 553. 6 ff. Copied by Meghavijaya 
in Sarn. 1818 = a.d. 1761. No author mentioned. 

RORI Cat. V 23131. 4ff. Copied by Bhimaraja in 
Sarn. 1821 = a.d. 1764. No author mentioned. 

RORI (Jaipur) 2675. lOff. Copied in Sam. 1832 = 
A.D. 1775. No author mentioned. 

RORI Cat. I 410. 16ff. (ff. 6-7 missing). Copied by 
Sevarama in Sarn. 1837 = a.d. 1780. No author 
mentioned. 

RORI Cat. IV 22049. 6 ff. Copied by Phatehacanda 
in Sarn. 1839 = a.d. 1782. 

RORI Cat. XVI 35692. 16ff. Copied by Sivanarayana 
Vyasa in Sarn. 1846 = a.d. 1789. No author 
mentioned. 

Nagaur 992. 6 ff. Copied on 7 suklapak§a of Magha 
in Sam. 1853 = ca. 4 February 1797. 

RORI Cat. Ill 11079 (3). 6 ff. Copied in Sam. 1855 
= A.D. 1798. No author mentioned. 

RORI (Jaipur) 4363. 18ff. Copied by Nandarama 
Dube at Saupura in Sam. 1859 = a.d. 1802. No 
author mentioned. 

GJRI 3112/324. Ff. 1-12. Copied at Varanasi on 
Wednesday 1 kr§napak§a of Bhadrapada in Sarn. 
1861, Saka 1726 = 19 September 1804. 

RORI Cat. Ill 15067. lOff. Copied in Sam. 1864 = 
A.D. 1807. No author mentioned. 

RORI Cat. VII 26626. 8 ff. Copied by Jayacanda 
Muni at Jesalamera in Sarn. 1872 = a.d. 1815. 
No author mentioned. 

RORI (Jaipur) 4583. 14ff. Copied by Ramacaraja in 
Sarn. 1877 = A.D. 1820. No author mentioned. 

RORI (Chittorgarh) 682. 14ff. Copied by ChotQ- 
rama at Parvatasara in Sarn. 1884 = a.d. 1827. 
No author mentioned. 

Oxford CSS I 352 (*d. 772 (11)). Ff. 1-8. Copied on 
Monday 5 kr§napak§a of Phalguna in Sam. 1888 
= 19 March 1832. 

RORI Cat. I 2558. 6 ff. Copied by Sivadasa Muni at 
Nagora in Sarn. 1899 = a.d. 1842. No author 
mentioned. 

Mithila III 232. 6 ff. Maithili. Copied by Jayakanta 
Dvija on Sunday 4 suklapak§a of Kanyaka in 


Saka 1767 = 5 October 1845. (Bhavaphala). 
Property of Pandita Dharmadatta Misra of 
Babhangama, Supaul, Bhagalpur. 

RORI Cat. Ill 17234 (3). Ff. 17-28. Copied in Sam. 

1904 = A.D. 1847. No author mentioned. 

RORI (Jaipur) 3734. 12ff. (f. 11 missing). Copied by 
Govindarama Brahmana at Dravyapura in Sam. 

1905 = A.D. 1848. Incomplete. No author men¬ 
tioned. 

RORI (Jaipur) 6136. 8ff. Copied by Gunavilasa 
Muni, the pupil of Udyarahgopadhyaya, in Sarn. 

1906 = A.D. 1849. No author mentioned. 

BHU C.4486. 9ff. Copied in Sam. 1910 = a.d. 1853. 
No author mentioned. 

RORI (Chittorgarh) 1416. 18ff. (ff. 11-12 missing). 
Copied by Ramagopala at Manoharapura in Sarn. 
1911 = A.D. 1854. Incomplete. No author men¬ 
tioned. 

Vrndavana 2240. llff. Copied by Thakuradatta 
Misra, the son of Yamunadatta Misra, at Karuna- 
pura in Sarn. 1911 = A.D. 1854. No author men¬ 
tioned. 

RORI (Jaipur) 9143. 13ff. Copied by Mahadeva at 
Rayasarapura in Sarn. 1912 = a.d. 1855. No 
author mentioned. 

WHMRL a 1269. Ff. 1-5. Copied by Jayadyala on 
Friday 12 suklapak§a of A§adha in Sarn. 1918 = 
12 July 1861. 

GJRI 8509/734. Ff. 1-8. Copied by Ramaviharin Sar- 
man on Thursday 7 kr§napak§a of Margasir§a in 
Sam. 1922, Sal. San. 1273 = 13 December 1866. 
No author mentioned. 

RORI Cat. IV 18682 (2). Ff. 11-16. Copied by Tilo- 
kacanda at Karmavasa in Sam. 1963 = a.d. 1906. 
No author mentioned. 

BHU C.3088. 7ff. Incomplete. No author mentioned. 
GJRI 3174/386. Ff. 1-11. Maithili. No author men¬ 
tioned. 

GJRI 3175/387. Ff. 1-6. Maithili. Incomplete. No 
author mentioned. 

GJRI 8508/733. Ff. 1-11. Maithili. No author men¬ 
tioned. 

GJRI 11072/1126. Ff. 1-2. Maithili. Incomplete. No 
author mentioned. 

Jaipur (Khasmohor) 5306; 5318; 5411 (no author 
mentioned); and 5422. 

Jesalmere II Pothi 112, no. 1853. 5ff. 

Jodhpur 869 (A). Ff. 123-134. Incomplete. No 
author mentioned. 

Kathmandu (1965) 131 (7412). 6ff. No author men¬ 
tioned. 

Kathmandu (1965) 132 (6683). 9ff. No author men¬ 
tioned. 


96 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oxford CSS I 353 (*d. 778 (7)). Ff. 1-9. Incomplete 
(verses 1-97). 

Oxford CSS I 354 (*e. 148). Ff. 1-9. Incomplete 
(verses 1-97). 

Oxford (Vyasa) 169. Ff. 1-9. Incomplete (ends in 
rahu 11). 

Panjab JB I 1565 (Nakodar 445). 9ff. No author 
mentioned. 

PrSB 3683 (Berlin or. oct. 576). 9ff. 

PrSB 3684 (Berlin or. fol. 2158). 6ff. Copied by 
Giridhara Sarman for Radhajivana. 

RORI Cat. I 409. 3ff. No author mentioned. 

RORI Cat. I 606. Ff. 3-9. Incomplete. No author 
mentioned. 

RORI Cat. I 3135. 6ff. No author mentioned. 

RORI Cat. I 3715. 4ff. No author mentioned. 

RORI Cat. Ill 10793. 24ff. No author mentioned. 

RORI Cat. Ill 11029 (12). 2ff. Incomplete. No 
author mentioned. 

RORI Cat. Ill 12886. 13ff. (var§esabhavadhyaya). 
With the ari^tadhyaya from the Tajikasara. 

RORI Cat. Ill 14015. 8ff. Incomplete. No author 
mentioned. 

RORI Cat. Ill 14606. 7ff. No author mentioned. 

RORI Cat. Ill 14941. 8ff. (bhavacakragatagraha- 
phala). No author mentioned. 

RORI Cat. Ill 16002. 142ff. No author mentioned. 
With the Vrddhayavanajataka of Minaraja. 

RORI Cat. Ill 16008 (1). Ff. 1-6. No author men¬ 
tioned. 

RORI Cat. Ill 17982. llff. (ff. 5-6 missing). Incom¬ 
plete. No author mentioned. 

RORI Cat. IV 18291. 9ff. No author mentioned. 

RORI Cat. V 22648. lOff. 

RORI Cat. VI 24589. 4ff. Incomplete. No author 
mentioned. 

RORI Cat. VIII 27609. 14ff. No author mentioned. 

RORI Cat. IX 29420. lOff. No author mentioned. 

RORI Cat. IX 29440. 9ff. No author mentioned. 

RORI Cat. IX 29730. 5ff. No author mentioned. 

RORI Cat. XVI 34726. 12ff. No author mentioned. 

RORI Cat. XVI 35285. 9ff. Incomplete. No author 
mentioned. 

RORI Cat. XVI 36477. 7ff. 

RORI (Alwar) 2801. 14ff. No author mentioned. 

RORI (Alwar) 2802 = *Alwar 1803. 14ff. 

RORI (Bikaner) 14634. 7ff. Incomplete. No author 
mentioned. 

RORI (Bikaner) 14671. Ff. 1-4. 

RORI (Chittorgarh) 582. 8ff. Copied at Tonka. 
(Var^apravesapadmakosl). No author mentioned. 

RORI (Chittorgarh) 2282. 7ff. 

RORI (Jaipur) 2656. 18ff. Incomplete. No author 
mentioned. 


RORI (Jaipur) 2697. 8ff. No author mentioned. 

RORI (Jaipur) 3480. 8ff. No author mentioned. 

RORI (Jaipur) 3834. 5ff. Incomplete. No author 
mentioned. 

RORI (Jaipur) 8024. 2ff. Incomplete. No author 
mentioned. 

RORI (Jaipur) 8415. 14ff. No author mentioned. 

RORI (Udaipur) 559. 8ff. 

RORI (Udaipur) 5459. Ff. 5-8. No author men¬ 
tioned. 

RORI (Udaipur) 5807. Ff. 1-21. Incomplete. No 
author mentioned. 

RORI (Udaipur) 6103. llff. Incomplete. No author 
mentioned. 

Vrndavana 1881. 8ff. No author mentioned. 

WHMRL E.3.h. Ff. 1-15. Incomplete (ends in verse 
84). 

*WHMRL E. 13.ee. Ff. 16-17. Incomplete (verses 
87-97 and 2 concluding verses). 

WHMRL a 828. Ff. 1-15. Incomplete (ends in verse 
87). 

The next to the last verse in some manuscripts 

names Govardhana’s guru Bhudhara and gives the 

date of the Padmakosa as Saka 1466 = a.d. 1544: 

gururn sribhudhararn natva vilokyakhilatajakam // 

krto ’yam padmakosakhyas caiigahgendreti sakake // 


GOVINDA 

Author of a tika on the Llldvatl of Bhaskara 
(b. 1114). Manuscript: 

Jaipur (Khasmohor) 4604. Copied in Sarn. 1785 = 
A.D. 1728. 


^'GOVINDA KAVVSVARA 

Additional manuscripts of his Samvitprakdsa (see 
CESS A 2, 136b-137a; A 3, 34b; and A 4, 84b): 

RORI Cat. IX 28670. 48ff. Copied by Dasaratha in 
Sam. 1756 = a.d. 1699. 

Oxford CSS I 521 (*d. 760 (1)). Ff. 1-58. Copied on 
Friday 4 suklapak§a of Kuara in Sarn. 1889 = 26 
October 1832. 

RORI (Udaipur) 3335. 44ff. Copied by Sivaprasada 
Brahmana at Mathura in Sarp. 1892 = a.d. 1835. 
RORI (Udaipur) 3847. 73ff. Copied in Sam. 1908 = 
A.D. 1851. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


97 


RORI (Alwar) 5468 (12). Ff. 115-139. Copied by 
Kr§nalala in Sam. 1942 = a.d. 1885. 

RORI Cat. VII 26322. 17ff. (f. 1 missing). Incom¬ 
plete. 

RORI Cat. XVI 36740. 30ff. 

RORI (Jaipur) 9449. 12ff. Incomplete. 

RORI (Udaipur) 3614. Ff. 1-33 and 2ff. Incomplete. 


* GOV IN DA DlK^ITA 

Addtional manuscript of his Govindadlksitiya 
(see CESS A 2, 137a, and A 3, 35a): 

GOME Madras D. 13684. Ff. 6-6v (?). Telugu. 
Incomplete. 


GOVINDA DlK$ITA TORO 

The brother of Narayana Toro, Govinda wrote a 
Kundarka, of which the several short pieces listed 
below are apparently sections. Manuscripts: . 

Baroda 8950. 2ff. Copied in Saka 1763 = a.d. 1841. 
(prakrtivihara). 

Benares (1953) 4061. Ff. 1-2. (Kundarka of Govinda 
Dik§ita). 

Benares (1953) 4198. Ff. 1-2. (Apastambadarsa- 
purnamasaviharakarika). With a caturmasya- 
karika. 

Benares (1953) 4206. Ff. 1-2. (Baudhayanavihara- 
pramana). 

Benares (1953) 4332. If. (prakrtiviharakarika). 
Benares (1953) 4391. Ff. 1-3. (cayanaviharakarika). 

With an ekavidhasyene§tikavidhi. 

BISM vi 953. (prakrtiviharakarika). See NCC, vol. 6, 
p. 198. 

BISM 753 (syenacidahkanakarika). See NCC. 


GOVINDA NAY AKA 

Author of a Kadiratnacautisa in Oriya. Manu¬ 
scripts: 

Bhubaneswar 2. Cy/303. 

Bhubaneswar IV ganita 4 (G/26a) = Bhubaneswar 2. 
G/26a. 170ff. Oriya. Copied by Vasudeva Patfa- 
nayaka. From Khallikota, Ganjam District. 

He also wrote a Ganitacautisa. Manuscript: 

Bhubaneswar IV ganita 61 (G/26b). 44ff. Oriya. 


Incomplete at the end. From Khallikota, Ganjam 
District. 


GOVINDA SUTRADHARA 

Author of a Kalanidhi. Manuscripts: 

Baroda 11001. llff. Copied in Saka 1810 = a.d. 

1888. Incomplete (prakasas 1-4). 

Baroda 6856. Ff. 32-80. Incomplete. 

Baroda 8276. 9ff. Incomplete (prakasas 4-8). 

Baroda 9214. Ff. 1-119 and 175-312. Incomplete. 
Baroda 11069 (a). 17ff. 

Rajputana, p. 38. At Udaipur. 

He also wrote a Dvaradlpika. Manuscript: 

Rajputana, p. 38. At Udaipur. 


GOVINDA STRAP ATI {fl. ca. 1475) 

The son of Mandana (/?. ca. 1450), Govinda 
wrote an Uddhdradharanl. Manuscript: 

Rajputana, p. 38. At Udaipur. 


■^'GOVINDA (fl. ca. 1500) 

The Nijamasaha under whom he wrote the Pras- 
nasdra (see CESS A 2, 14la-14lb, and A 4, 
85b-86a) at Devagiri was probably Ahmad Nizam 
Shah of Ahmadnagar, who controlled Devagiri from 
1499 till his death in 1510, rather than Nizam al- 
Mulk of Hyderabad as suggested in CESS A 2, 141a. 
Addtional information concerning a manuscript: 

Oxford CSS I 502 (*d. 773 (7)). Ff. 1-4. 


^^GOVINDA (b. 2 October 1569) 

Govinda includes among his several accomplish¬ 
ments that of having copied a number of Prakrta 
manuscripts, many of which are now in Cole- 
brooke’s collection in the India Office Library; see S. 
Goldschmidt, Rdvanavaha Oder Setubandha, Strass- 
burg-London 1880, p. ix and fn. 2. 

1. Additional manuscripts of his Rasdld (see CESS A 

2, 138a-138b; A 3, 35a; and A 4, 85a): 


98 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. XVI 34393. 315ff. Copied in Sam. 1863 
= A.D. 1806. 

RORI (Alwar) 5513. 89ff. Copied in Sam. 1884 = 
A.D. 1827. (samjna). 

RORI (Alwar) 5514. 93ff. Copied in Sam. 1884 = 
A.D. 1827. (sarnjna). 

Jaipur (Khasmohor) 1621 (samjna); 1622; and 5270 
(sarnjna). 

Kathmandu (1965) 76 (5535). 202ff. 

Kathmandu (1965) 77 (4202). No ff. given, (sarnjna). 

Kathmandu (1965) 78 (4203). No ff. given, (sarnjna; 
incomplete). 

Mysore (1905) 546. 41pp. Telugu. 

RORI Cat. IV 18961. 59ff. (samjna). 

RORI Cat. IV 18963. 75ff. 

RORI Cat. IV 19474. Ff. 28-144. Copied by Khusa- 
lacanda, the son of Jubaramalla. 

RORI Cat. IV 21995. 27ff. 

RORI Cat. XVI 34171. 108ff. (ff. 19, 47-49, 54, 62, 
and 67 missing), (sarnjna; incomplete). 

RORI (Alwar) 2805. 7Iff. Incomplete. 

RORI (Alwar) 2808. 112ff. 

RORI (Jaipur) 7102. 7Iff. (f. 1 missing). Incomplete 
(bhavMhyaya). 

RORI (Udaipur) 6501. 26ff. (f. 2 missing). Incom¬ 
plete (tika of Govindadeva on a § 0 (^asayoga). 

3. Additional manuscripts of his Piyu^adhara (see 

CESS A 2, 138b-141a; A 3, 35a; and A 4, 85a-85b): 

BHU C.826. 250ff. Copied in Saka 1528 = A.D. 
1606. 

RORI (Bikaner) 17375. 16ff. Copied by Tilakodaya 
at Canderi in Sam. 1764 = a.d. 1707. 

RORI (Udaipur) 1707. 51 Iff. Copied in Sarn. 1813 
= A.D. 1756. 

BHU C.3836. 78ff. Sarada. Copied in Sarn. 1820 = 
A.D. 1763. Incomplete. Attributed to Nilakantha. 

RORI (Udaipur) 6518. 17ff. (ff. 4-5 missing). Cop¬ 
ied in Sam. 1849 = a.d. 1792. Incomplete (grha- 
pravesa). 

Oxford CSS I 420 (*d. 803 and 804). Ff. 1-87; 
<1-17>, 18, and < 19-25>; f. <1>; ff. 2-15 
and 17; ff. 1-85; ff. 2-119; ff. 1-25 and 25b-35; 
and ff. 1-3, <4-27>, 28-30, and <31-41 >. 
Partly copied on 11 kr§napak§a of Vaisakha in 
Sarn. 1873 = ca. 21 May 1816. Incomplete. 

RORI Cat. IX 29296. 196ff. Copied at Kr§nagadha 
in Sarp. 1889 = A.D. 1832. Incomplete (vivaha). 

Vrndavana 8811. 78ff. Copied in Sam. 1890 = a.d. 
1833. 

Vrndavana 8812. 90ff. Copied in Sam. 1890 = a.d. 
1833. 


Vrndavana 8814. 6ff. Copied in Sam. 1890 = a.d. 
1833. Incomplete (dviragamana; incomplete). 

Vrndavana 8835. 3ff. Copied in Sam. 1890 = a.d. 
1833. Incomplete (vadhupravesa; incomplete). 

RORI Cat. IX 29294. 34ff. (f. 9 repeated). Copied at 
Krsnagadha in Sam. 1899 = a.d. 1842. Incom¬ 
plete. 

RORI (Alwar) 2952 = * Alwar 2001. 13ff. Copied in 
Sarn. 1912 = a.d. 1855. Incomplete (simhastha- 
makarasthagurunirnaya). 

RORI (Jaipur) 3462. 29ff. (f. 1 missing). Copied by 
Jayanarayana at Savai Jayanagara in Sarn. 1915 
= A.D. 1858. Incomplete (tithivicaranak§atra). 

RORI Cat. XVI 35581 (1). 45ff. (samjna); (2). 52ff. 
(nak^atra); and (3). 15ff. (sahkranti). Copied by 
Haranarayana in Sarn. 1979 = a.d. 1922. 

AS Bengal III.E.223. Attributed to Nilakantha. 

BHU B.808. 17ff. Incomplete. 

BHU C.680. 124ff. Sarada. 

BHU C.722. 57ff. Samda. 

BHU C.3832. 53ff. Sarada. Mistakenly said to have 
been copied in Saka 1431 = a.d. 1509. Incom¬ 
plete. 

BHU C.3853. 54ff. Sarada. Incomplete. 

BHU C.4559. 23ff. Sarada. Incomplete. 

BHU C.4774. 91ff. Sarada. Incomplete. 

Jaipur (Khasmohor) 5568. 

Mysore ORI C.1806/2. Ff. 1-109. Kannada. No 
author mentioned. 

Oxford CSS I 423 (*c. 318) Ff. 1-63. Incomplete 
(prakarana 6). 

RORI Cat. IX 29289. 171ff. Incomplete (yatra). 

RORI Cat. IX 29290. 46ff. Incomplete (gocara). 

RORI Cat. IX 29291. 46ff. (f. 33 missing). Incom¬ 
plete (sahkranti). 

RORI Cat. IX 29292. 154ff. Incomplete (nak§atra). 

RORI Cat. IX 29293. 117ff. (ff. 102-103 missing). 
Incomplete (subhasubha; incomplete). 

RORI Cat. IX 29295. 50ff. Incomplete (grharam- 
bha). 

RORI Cat. IX 29297. 147ff. Incomplete (sarnskara). 

RORI Cat. IX 29298. 26ff. Incomplete (rajabhi§eka). 

RORI (Alwar) 2886-2894. 58ff. (subhasubha); 

llOff. (nak§atra); 21ff. (sahkranti); 15ff. (gocara); 
67ff. (sarnskara); lOOff. (vivaha); 102ff. (yatra); 
24ff. (vastu); and 18ff. (grhapravesa). 

RORI (Udaipur) 4949. Ff. 1-19. Incomplete (sah¬ 
kranti). 

RORI (Udaipur) 5005. Ff. 13-62. Incomplete. 

RORI (Udaipur) 5010. Ff. 1-19. Incomplete (to 
gocara). 

RORI (Udaipur) 5318. 13ff. Incomplete (rajya- 
bhi§eka and agnyadhana). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


99 


RORI (Udaipur) 6101. 26ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Udaipur) 6476. 85ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Udaipur) 6510. 83ff. (ff. 21-22 missing). 
Incomplete. 

Vrndavana 8813. 4ff. Incomplete (agnihotra; incom¬ 
plete). 

A revised version of the edition by Kedaradatta 
Josi, Varanasi 1972, was published at Varanasi in 
1979; reprinted at Dilli in 1983 and 1988. 


GOV IN DA (/Z. 1691) 

The son of Gadadhara, a resident of Junnara who 
was honored by the lord of I la, Govinda finished his 
Kundamartanda in 71 verses on a Monday in the 
kr§napak§a of Margasirsa in Saka 1613 = 30 
November or 7 December 1691; there is a fika, Pra- 
bha, by Ananta (/?. 1692). Manuscripts: 

Baroda 4617. llff. Copied in Sam. 1793 = a.d. 
1736. 

BORI 770 of 1882/83. 26ff. Copied in Saka 1672 = 
A.D. 1750. With the tika of Ananta. 

Baroda 8619. 72ff. Copied in Saka 1673 = a.d. 

1751. With the tika of Ananta. 

PUL 1 Dharma 176. Ff. 6-11, 18-31. 34-39, 42-43, 
and 46-125. Copied in Saka 1692 = a.d. 1770. 
With the fika of Ananta. Incomplete. 

Wai 3025. 62ff. Copied in Saka 1703 = a.d. 1781. 
With the tika of Ananta. 

AS Bombay 422. 12ff. Copied in Saka 1704 = a.d. 
1782. 

Baroda 8733 (b). Ff. 15-58. Copied in Saka 1707 = 
A.D. 1785. With the tika of Ananta. Incomplete. 
Bombay U 552. 8ff. Copied on Friday 6 suklapak§a 
of Asvina in Saka 1714 = 21 September 1792. 
Wai 3027. 38ff. Copied in Saka 1714 = a.d. 1792. 

With the tika of Ananta. Incomplete. 

RORI Cat. XVI 36321. 8ff. Copied by Sivanatha in 
Sam. 1856 = a.d. 1799. 

Wai 3023. lOff. Copied in Saka 1727 = a.d. 1805. 
RORI Cat. II 908^ 12ff. Copied at Khacaroda in 
Sam. 1867 = a.d. 1810. 

PUL I Dharma 175. 32ff. Copied in Sam. 1869 = 
A.D. 1812. With the tika of Ananta. 

Baroda 2301. 46ff. Copied in Sana. 1874 = A.D. 

1817. With the tika of Ananta. 

WRI 118. 37ff. Copied in Sam. 1894 = a.d. 1837. 
With the tika of Ananta. 

BORI 101 of 1895/1902 = BORI (Dharma) 313. 


47ff. Copied by Raghunatha, the son of Parasu- 
rama Somana, on 13 suklapak§a of Karttika in 
Saka 1764 = ca. 15 November 1842. With the 
tika of Ananta. 

RORI (Alwar) 3751 = Alwar 1302. 34ff. Copied in 
Sam. 1909 = a.d. 1852. With the tika of 
Ananta. 

AS Bengal III.F.175. With the tika of Ananta. 

Baroda 4618. 58ff. With the tika of Ananta. 

Baroda 8733 (a). 14ff. 

Baroda 11554. 19ff. (ff. 9-11 missing). With the 
tika of Ananta. Incomplete. 

Benares (1953) 4047. Ff. 1-37. With the tika of 
Ananta. 

Benares (1953) 4385. Ff. 1-13. 

BHU C.3518. 39ff. With the tika of Ananta. Incom¬ 
plete. 

BISM thi 17. See NCC, vol. 4, p. 183. 

Bombay U 553. 45ff. With the tika of Ananta. 
Incomplete (ends in verse 50). 

BORI 43 of A 1882/83 = BORI (Dharma) 314. lOff. 

CP, Hiralal 924. Property of Asaram of Semri Har- 
cand, Chindwara District. 

CP, Hiralal 925. Property of Munnalal of Jubbul- 
pore. 

CP, Kielhorn XIX 59. 39ff. With the tika of Ananta. 
Property of Gadipanta Patalavara of Canda. 

Dahilak§mi XLV 4. See NCC, vol. 4, p. 183. 

Kerala 3802 (4822). 150 granthas. 

Kerala 3803 (4825). 150 granthas. 

Kerala 3804 (7120). 150 granthas. 

Kerala 3805 (7331 A). 150 granthas. 

PUL I Dharma 174. 8ff. 

Rajapur 377; 378 (with a tika); 496 (with a tika); 
540; 766; and 767 (with a tika). See NCC, vol. 4, 
p. 183, and vol. 6, p. 199. 

SOI. See NCC, vol. 4, p. 183. 

WRI 601. 9ff. 

WRI 935. 45ff. With the tika of Ananta. 

Wai 3022. 13ff. 

Wai 3024. 7ff. 

Wai 3026. 55ff. With the tika of Ananta. 

The Kundamartanda was published in Vi((hala- 

dik^itaviracita mandapakundasiddhih, Kalyana- 

Murnbai Sam. 1982, Saka 1847 = a.d. 1925, pp. 

36-45. Verses 68-69 are: 

srimajjunnarapattane sivagirer asannasarnsthe sada 

yah srikr§narato gadadhara ilanathaprapujyo 
’bhavat // 

tatsQnur ganakagranir vimaladhir govindasamjhah 
krti 


100 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


lilavan akarod amum susaralam grantham vipascin- 
mude //68// 

gunasasirasacandraih sammite sakakale 
sahasi bahulapak§e kamatithyam sasaiike // 
vibudhagurukavinam har^ado 'yam sphularthah 
samagamad atipurtim kundamartandasamjnah //69// 

The colophon begins: iti srijunnarapattananivasi- 
govindadaivajhakaviviracitah. 

*GOVINDA {fl. 1826) 

This author of a vivrti on the first two adhikaras 
of the Karanaprakasa of Brahmadeva (/?. 1092) (see 
CESS A 2, 135b-136a) uses in his examples Friday 
12 suklapak^a of Pau§a in Saka 1747 = 20 January 
1826. 


GOVINDA JANARDANA BORKAR (b. 10 March 
1903) 

Also known as Gajanana Svamin and, familiarly, 
as Buva, Govinda was born on 10 March 1903 at 
Chinchkhari, a suburb of Ratnagiri in the Koiikana, 
to a K^atriya Bhandari, Janardana Panta, a shop¬ 
keeper at Dadar in Bombay who died on 28 Novem¬ 
ber 1926 at the age of 60. Govinda’s early life is 
recounted by K. A. Keluskar in his Govind Janardan 
Borkar, alias Shri Gajananaswami, Astrologer & Pal¬ 
mist, Bombay 1933. From this we learn that, largely 
self-taught, he began to practice astrology in Bom¬ 
bay at the age of 15. In his library was a manuscript 
of a part of the Bhrgusarnhitd, presented to him by a 
Brahmana from Benares (pp. 55-57). His writings 
include a Satyasrlstha Hindu Dharma Pahcdhga for 
Saka 1850 = a.d. 1928 (pp. 117-120) and a Yoga- 
sastra\ he also dictated a work on navamarnsas to 
Ramacandra Balakr§na Bhafta, and one on palmis¬ 
try to Govindaraja Vinayaka Tamhane (pp. 
120-121). It seems that only the pancahga was pub¬ 
lished—by Buva himself. 


GOVINDADATTA 

Alleged author of a Balaviveka, cf. the Bala- 
vivekini of Govinda (see CESS A 2, 136a) and the 
Balavivekinl of Nahnidatta (see CESS A 3, 
171b-172b, and A 4, 140b). Manuscript: 

RORI Cat. XVI 34237. 4ff. Copied by Alamacandra. 


GOVINDADASA VINITA (fl. 1980) 

Author of a Sdmudrika sdstra bhd^d and of an 
Anga laksana in Hindi, published together at 
Mathura in 1980. 


^GOVINDABHATTA 

Additional information concerning a manuscript 
of his Tithinirniaya (see CESS A 2, 142b, and A 3, 
35a): 

RORI (Alwar) 3595 = *Alwar 1326. 37ff. With an 
anukramanika. Incomplete. 


*GOVINDABHATTA (fl. 1236/1314) 

Additional manuscript of his Dasadfiyayl (see 
CESS A 2, 142b-143a, and A 4, 86a): 

PrSB 2928 (Munchen, Malay. 8). Ff. 97-185. Mala- 
yalam. 

GOVINDARAMA 

Author of a Jyotirbindu. Manuscript: 

GJRI 8366/591. Ff. 1-4. Maithili. 


GOVINDARAMA GAURISANKARA DVIVEDIN (fl. 
1986) 

A resident of Ahora in Rajasthana, Govindarama 
edited the Muhurtaraja of Gulabavijaya, published at 
Rajagaglha in 1986, to which he added two Hindi 
parisi§tas: no. 1 on pp. 265-283 and no. 3 on pp. 
361-402, as well as, apparently, the Sarpskrta 
anvaya. 

GOVINDASARMAN 

A member of the Dasaputre family, 
Govindasarman wrote a Malamasanirupana. Manu¬ 
script: 

IM Calcutta 3135. Incomplete. See NCC, vol. 6, p. 
207. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


101 


GOVINDASUTA 

To the son of Govinda is attributed a vyakhya on 
a Jatakakarmapaddhati. Manuscript: 

Mysore (1905) 844. 35pp. Grantha. 

GOVINDASVAMIN 

Author of a Prasnasastra. Manuscripts: 

Mysore ORI P.1675/1. Ff. 2-12. Grantha. Incom¬ 
plete (3 prasnas). 

Mysore ORI P.1675/4. Ff. 15-34. Grantha. 

^GOVINDASVAMIN (fl. ca. 800/850) 

Additional manuscripts of his Prakafanfiadipika 
(see CESS A 2, 144a, and A 4, 86b): 

Mysore ORI *P.3166/2. Ff. 1-107. Grantha. Incom¬ 
plete (adhyayas 1-18). 

Mysore ORI P.10059/15. Ff. 48-61. Telugu. Incom¬ 
plete (prayana). 

Mysore ORI P.10367/6. Ff. 1-42. Nandinagari. 

Incomplete (adhyayas 14-20). 

Mysore ORI P.10762/12. F. 5. Nandinagari. Incom¬ 
plete (prayana). 

GOVINDANANDA 

Author of a Pahcapak^l tlka. Manuscript: 

GJRI 8490/715. Ff. 1-2. Maithili. Copied in Sal. 
San. 1280 = a.d. 1872. 


^GOVINDANANDA KAVIKANKANA (fl. 

1510/1535) 

2. Additional manuscripts of his AnhakaumudI (see 

CESS A 2, 144b-145a; A 3, 35b; and A 4, 86b): 

AS Bengal I.A.64. Bengali. 

Bhubaneswar IV 159 (Jy/133). lOff. Oriya. Incom¬ 
plete (ends with 2, 13). From Sundaragrama, 
Cuttack District. 

Bhubaneswar VII 255 (Dh/275). 136ff. Oriya. Cop¬ 
ied by Trilocana. From Kapileswar, P. S. Bhu¬ 
baneswar. 


Bhubaneswar VII 256 (Dh/389). 8Iff. Oriya. Incom¬ 
plete (through namanirnaya). From Medinipur, 
Bengal. 

Bhubaneswar VII 257 (Dh/390). 132ff. Oriya. 

Incomplete. From Medinipur, Bengal. 
Bhubaneswar VII 262 (Dh/477). 105ff. Oriya. 

Incomplete. From Gadamanitri, P. S. Begunia, 
Puri District. 

PrSB 2956 (Tubingen, Ma I 751). 132ff. Oriya. 
Incomplete (adhyayas 1-6). 

3. Additional manuscripts of his Var^akriydkau- 
mudl (see CESS A 2, 145a; A 3, 35b; and A 4, 
86b): 

AS Bengal I.A.50 and I.B.57. Bengali. 

Benares (1956) 12203. Ff. 1-37. Bengali. (Ddna- 
kriydkaumudl). 

Benares (1956) 13185. Ff. 1-96. Bengali. (Ddna- 
kaumudl). 

4. Additional manuscript of his Suddhikaumudl (see 
CESS A 2, 145a, and A 4, 86b): 

AS Bengal I.B.57. Bengali. 

5. He also wrote a Sraddhavivekakaumudl. Manu¬ 
scripts: 

Mitra, Not. 3175. 102ff. Bengali. Property of Kali¬ 
dasa Vidyavagisa of Santipura. 

Vangiya Sahitya Pari§ad 202. Ff. 1-75. Bengali. 
Incomplete. 

The SrMdhavivekakaumudi was edited by 
Kamala Kr§na Smrtibhusana as BI 157, Calcutta 
1904. 


GOSVAMIN BHAJTA 

Author of a Pahcmgaratnamdld. Manuscript: 

Pattan II 8828. If. Copied by Paru^ita Ravivardhana 
in Sarn. 1717 = a.d. 1660. 

GAUD A BHATJACARYA 

Additional manuscripts of his tippana on the 
Pahcasvarah of Prajapatidasa (see CESS A 2, 145a, 
and A 4, 87a): 


102 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Kathmandu (1965) 124 (7426). No ff. given. Copied 
in Sam. 1810 = A.D. 1753. 

Kathmandu (1965) 125 (7425). Ff. 1-7. Copied by 
Devanada at Mayapuri on Saturday 8 suklapak§a 
of Magha in Sana. 1897 = 30 January 1841. 

BHU C.1696. 4ff. 

RORI (Alwar) 2980 = *Alwar 1831. llff. (ff. 1-2 
missing). Incomplete. 

GAUD ID ASA 

Author of a tika, BMavabodha, on the Sahgra- 
hanlratna of Sricandra. Manuscript: 

RORI (Bikaner) 13269. 67ff. 


^GAUTAMA 

Additional manuscripts of his Gautamajataka (see 
CESS A 2, 145a-145b; A 3, 35b; and A 4, 87a): 

RORI (Udaipur) 4369 (25). F. 68. Copied by Dam- 
bara at Digarana in Sam. 1774 = A.D. 1717. 
Incomplete (sanicara, etc.). 

Kathmandu (1964) 71 (5890). 2ff. Copied on Mon¬ 
day 14 kr§napak§a of Jyestha in Sarn. 1885 = 9 
June 1828. 

RORI (Alwar) 2733. lOff. Copied by Kr§narama in 
Sam. 1912 = A.D. 1855. With the tika of 
Lak^mipati. 

GJRI 8281/506. Ff. 1-2. Maithili. 

RORI (Alwar) 2732. 4ff. 

RORI (Jaipur) 6726 (2). Ff. 3-4. (Gautamahora- 
jhana). 


^GAUTAMA 

Additional manuscripts of his works on santi (see 
CESS A 3, 36a): 

1. Apamrtyuhjayasdnti. Manuscript: 

Mysore ORI P.3656/15. Ff. 20-23. Grantha. 

2. VaidhrtyMi-, Vyatlpatavaidhrd-, or Vyatlpatddi- 
prathamartavasdnti. Manuscripts: 

Mysore ORI B.l 17/18. F. 20. Kannada. 

Mysore ORI P.2239/24. F. 16. Telugu. 

Mysore ORI ?3023121. Ff. 10-11. Telugu. 

Mysore ORI P.3804/39. Ff. 74-75. Nandinagari. 


Mysore ORI P.5293/49. Ff. 66-67. Nandinagari. 
Mysore ORI P.5672/27. Ff. 26-27. Kannada. 

Mysore ORI P.7935/44. Ff. 86-87. Telugu. 

Mysore ORI P.7970/37. Ff. 25-26. Telugu. 

Mysore ORI P.9254/165. Ff. 144-145. Nandinagari. 
Mysore ORI P.9764/5. Ff. 23-24. Telugu. 

Mysore ORI P.9951/107. Ff. 128-129. Nandinagari. 
Mysore ORI P.9965/43. F. 48. Nandinagari. 

Mysore ORI P.10041/111. Ff. 166-167. Telugu. 
Mysore ORI P.10265/16. Ff. 7-9. Nandinagari. 

GAURANGA 

Author of a part of a Darana in Oriya. Manu¬ 
script: 

Bhubaneswar 2.G/19 = Bhubaneswar IV ganita 36 
(G/19). 76ff. Oriya. From Kapileswar, Puri Dis¬ 
trict. 


GAURl SANKARA MANCHASANKARA RAIKVA 
(RAYEKAVALA) {fl. 1915/1925) 

A resident of Surata, Gaurisahkara wrote a Guja¬ 
rati translation of and parisi§ta to the Jatakacan- 
drika of Yajhikanatha (Jl. 1660), published with his 
edition of the text, 3rd ed., Surata 1924; the preface 
is dated Surata 1915. His anvaya and bhasafika on 
the Mandapakundasiddhi of Viuhala Dik§ita (/?. 
1619) was published on pp. 1-30 of his edition of 
the text, Kalyana-Mumbai Sarn. 1982 = A.D. 1925. 

^'GAURISANKARA KAPURA (fl. 1973/1983) 

Author also (see CESS A 4, 87b) of a Hindi 
translation of and vyakhya on the Kerariyajyoti^a of 
Sukra, the Keralasutra, and the Gopdlaratndkara of 
Sivasahkara Sastrin, all published in his Kerallya 
jyoti^a, Dilli 1974; of a Jyoti^a slkhie in Hindi 
published at Dilli in 1978; and of a Hindi transla¬ 
tion, Ahka camatkara, of the Numerology for All of 
Cheiro, published at Nai Dilli in 1983. 

GAURl SVARA 

Author of a Grahadipikd in 8 adhikaras: 
ravindukendradhruvanayana, bhaumadidhruvana- 
yana, ravindusphutapancahgasadhana, bhaumadi- 
spufanayana, candragrahana, candragrahana, surya- 
grahana, parilekha.,Manuscript: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


103 


Kathmandu (1964) 88 (7067). 16ff. Copied by Gha- 
nasyama on Saturday 6 suklapak§a of month 5 in 
Saka 1707 = 10 September 1785. 

Verse 1 is: 

natva grahendrarn sirasa ganesam 
gaurisvarena kriyate sphufartha // 
pahcaiigapatram grahanodayader 
draksiddhihetor grahadipikeyam // 

GHANADASA 

Author of part of a Ganita in Oriya. Manuscripts: 

Bhubaneswar IV ganita 19 (G/24). 69ff. Oriya. 
Incomplete. From Jagatsirnhapur, Cuttack Dis¬ 
trict. 

Bhubaneswar 2.G/29 = Bhubaneswar IV ganita 21 
(G/29). 120ff. Oriya. Incomplete. From Ranapur, 
Puri District. 


GHANASYAMA 

Author of part of a Nalacaiitisa in Oriya. Manu¬ 
script: 

Bhubaneswar 2. G/39 = Bhubaneswar IV ganita 37 
(G/39). 55ff. Oriya. From Kapileswar, Puri Dis¬ 
trict. 


^GHANASYAMA 

Additional manuscript of his Nrpatiyatramahgala 
or Yatramahgala (see CESS A 3, 36b): 

AS Bengal III.A.71. 

GHANASYAMA DAS A (fl. 1892) 

Once Deputy Inspector of Hamirapura, Ghana- 
syama was associated with Radhakr§na Misra in 
editing and in composing an anvaya and Hindi fika 
on the Samudrikasastra of Durlabharaja (fl. 1160), a 
task that they finished on Sunday Durgatithi in the 
krsnapak§a of Pau§a in Sarn. 1948 = 31 January or 
7 February 1892. This was published at Bombay in 
1894 (lO 26.G.6); and reprinted at Bombay in Sarn. 
1976 = A.D. 1919 (lO San. D.132), and at Bombay 
in 1956. 


'^GHASIRAMA 

Additional manuscript of his Tajakadipaka (see 
CESS A 2, 147b): 

Jaipur (Khasmohor) 5412. (Jdtakadlpikd). 


GHASIRAMA 

The son of Hariprasada, Ghasirama wrote a 
Vinodasdgarasiddhdntarahasya during the reign of 
Yasavantasirnha. Manuscript: 

RORI Cat. XVI 34781. Ff. 1-7. 


CAKRADHARA 

Additional manuscripts of his Yantracintdmani 

(see CESS A 3, 36b-37b, and A 4, 88a): 

Oxford CSS I 82 (*d. 751 (5)). Ff. 2-9. Copied in 
Sarn. 1732 = A.D. 1675. With his own vivarana. 
Incomplete (begins in 1, 2). 

RORI (Alwar) 2639. 2Iff. Copied in Sarn. 1805 = 
A.D. 1748. With the fika of Rama. 

*BORI 43 of 1898/99. Ff. lv-12. Copied on Wed¬ 
nesday 9 suklapak§a of Jye^fha II in Sarn. 1812, 
Saka 1677 = 18 June 1755. With his own viva¬ 
rana. 

Oxford CSS I 83 (*d. 780 (6)). Ff. 1-8. Copied on 
14 kr§napak§a of Phalguna in Sarn 1852 = ca. 5 
April 1796. 

Oxford CSS I 84 (*d. 774 (3)). Ff. 2-26. Copied by 
Har^adeva Jyotirvid at Kasi on 13 suklapak§a of 
Jye§tha in Saka 1714 (read 1718), Sam. 1853 = 
ca. 17 June 1796. With the fika of Rama. Incom¬ 
plete. 

BORI 620 of 1899/1915. llff. Copied in Saka 1728 
= A.D. 1806. 

Oxford CSS I 85 (*d. 779 (7)B). Ff. 2-27 and 29-53. 
Copied on Friday 5 suklapak§a of Jyesfha in 
Sam. 1870, Saka 1735 = 4 June 1813. With the 
fika of Rama. Incomplete. 

RORI (Chittorgarh) 4730. 26ff. Copied in Sarn. 1881 
= A.D. 1824. With the tika of Rama. 

RORI Cat. XVI 36784. 23ff. Copied by Nanurama in 
Sam. 1888 = A.D. 1831. With the flka of Rama. 

RORI Cat. XVI 35979. 20ff. Copied in Sam. 1907 = 
A.D. 1850. With the fika of Rama. 

RORI Cat. IV 18960. 13ff. Copied in Sam. 1910 = 
A.D. 1853. With the fika of Rama. 


104 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Alwar) 2640. 44ff. Copied in Sam. 1912 = 
A.D. 1855. With the tika of Rama. 

RORI (Jaipur) 2457. 4ff. Copied by Sundaralala in 
Sam. 1925 = a.d. 1868. 

Poleman 4712 (Columbia, Smith Indie 74). Ff. 1-21. 
Copied in Sam. 1921 = a.d. 1864, allegedly by 
Pandita “Joshti” of Jayapura, from whom D. E. 
Smith purchased it in 1907. With the tika of 
Rama. 

AS Bengal I.E.46. With a vivrti. 

*Bombay U 375. Ff. l-13v. With his own vivarana. 
Jaipur (Khasmohor) 4954. 

Mysore ORI *P.4440/3. Ff. 1-17. Nandinagari. 
Oxford CSS I 86 (*d. 779 (7) A). Ff. 1-3. With 
marginal notes. 

Oxford CSS I 87 (e. 132). Ff. 1-25; 3-7; 1-6; and 
1 — 7 and <8>. With the tika of Rama. 

RORI Cat. IX 28634. llff. With his own vivarana. 
Incomplete (turiyayantra). 

RORI Cat. IX 29132. 6ff. With the tika of Rama. 
Incomplete. 

RORI Cat. IX 29373. 18ff. (ff. 1-13 missing). With 
the tika of Rama. Incomplete. 

RORI Cat. XVI 36050. 13ff. With the tika of Rama. 

Incomplete (ends in adhikara 3). 

RORI (Alwar) 2642. 35ff. With the tika of Rama. 
RORI (Jaipur) 9406. 17ff. (ff. 7-16 missing). Incom¬ 
plete. 

Additional manuscripts of his Yantracintamani- 
vivarana (see CESS A 3, 37b, and A 4, 88a): 

Oxford CSS I 82 (*d. 751 (5)). Ff. 2-9. Copied in 
Sam. 1732 = A.D. 1675. Incomplete (begins in 1, 
2). 

*BORI 43 of 1898/99. Ff. lv-12. Copied on Wed¬ 
nesday 9 suklapak§a of Jye§tha II in Sarn. 1812, 
Saka 1677 = 18 June 1755. 

^Bombay U 375. Ff. l-13v. 

RORI Cat. IX 28634. 1 Iff. IncoJnplete 

(turiyayantra). 

RORI Cat. XVI 34965. 19ff. Copied by Gahgadhara. 


^CAKRADHARA {fl. 1920/1955) 

Cakradhara (see CESS A 3, 37b-38a) also wrote 
a Gadavall, which he completed on Monday 7 suk- 
lapak§a of Karttika in Saka 1877 = 21 November 
1955. This was published with his Hindi tika, 
Vidydvinodinl, as pu§pa 3 of the Srllak^mldhara- 
vidydmandira, Devaprayaga 1958. The last two 
verses are: 


mukundanamnarn vidusam gurunam 
si^tirp punitam hrdaye nidhaya // 
sake ’gasailoragarupatulya 
urjarjunadityatithau bhapahe // 
vyadhayi lak§midharadehajena 
gadavali cakradharena ramya // 
e§opakaraya dharasuranarn 
horavidam astu vimatsaranam // 

*CAKRAPANI 

Additional information concerning the Alwar 
manuscripts (*Alwar 1848) of his Prasnatattva (see 
CESS A 3, 38a-38b, and A 4, 88b): 

RORI (Alwar) 2835. 32ff. Copied by Madhorama in 
Sam. 1912 = a.d. 1855. 

RORI (Alwar) 2836. 29ff. Copied in Sarn. 1912 = 
A.D. 1855. 

He also wrote a Grahanatattva. Manuscript: 

Kathmandu (1964) 82 (2942). 3ff. Copied on 1 suk- 
lapak^a of Magha in Sarn. 1717 = ca. 21 January 
1661. 

The first verse is: 

nidhaya gurupaduke sirasi cakrapanir muda 
karoti ravicandrayor grahanam arkanak§atratah // 
gatamitihrtam gatark§ayutam abdhibha< + + > 
yad- 

ahrt sphuta inas tato mitihrta khakhebha gatih // 

The colophon begins: iti srisatyadharapanditMmaja- 
sricakrapaniviracita. 

^CAKRAPANI 

Additional manuscripts of his Vijayakalpalatd 
(see CESS A 3, 38b): 

New Delhi, H. B. Lall 29. 62ff. Copied by Ramava- 
kasa (?) Brahma <na> for Devakinandaji at 
Mathura in the Varahak^etra in the kr§napak§a 
of Bhadrapada in Sarn. 1861 = 19 September-3 
October 1804. 

RORI (Alwar) 2997 = * Alwar 1964. 47ff. Copied by 
Hiralala at Alavara in Sarn. 1912 = a.d. 1855. 
Jaipur (Khasmohor) 5210; and 5487. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


105 


In the Alwar manuscript verses 30-31 at the end 
are: 

ballalasarnjhanagare sujanalaye ’bhQd 
vipragranir vimalakasyapavarpsajanma // 
nihse§apan(^itanamaskrtapadapadmah 
khyatirn gato nijagunair bhuvi vasudevah //30// 
tasyatmajo jayati jatakavedivrnda- 
cu(;lamanir gajamukhahghryaravindabhrhgah // 
srikamarajaganakah k§itipalavancha- 
vispa§tavalakusalah svaravidvari§thah //31// 

CAKRAPANI 

Author of a Var^adasapravesaphala. Manuscript: 
RORI Cat. VIII 27818. 2ff. 


*CAKRAPANI path AKA 

Additional manuscript of his Tithiprakasaprakd- 
sikd on the Tithiprakdsa of Gahgadasa Trivedin (see 
CESS A 3, 39a): 

GJRI 5308/339. Ff. 1-25. 


^CAKRAPANI MISRA (fl. 1575/1577) 

Cakrapani composed his Muhiinamdld (see CESS 
A 3, 39a, and A 4, 88b) in Sarn. 1632 = a.d. 1575 
during the reign of Maharana Pratapasirnha, who 
ruled Mewar from 1572 till 1597. Additional manu¬ 
scripts: 

*RORI (Udaipur) 595. Copied in Sarn. 1700 = a.d. 

1643. Incomplete. 

Jaipur (Khasmohor) 5357. 

Udaipur RVSS 144. 16ff. Incomplete. 

He also wrote, for the same Maharana, a VTsva- 
vallabha in Sam. 1634 = a.d. 1577. Manuscript: 

Rajputana, p. 39. At Udaipur. 

*CANPIDASA 

Additional manuscript of his Karanakutuhala- 
tikd (see CESS A 3, 40a-40b): 


A.D. 1771. 


^CANDU {fl. 1769/1841) 

Additional manuscript of one of his pancahgas 
(see CESS A 3, 40b): 

RORI (Udaipur) 6601. llff. Incomplete. Pahcahga 
for Sarn. 1891 = A.D. 1834, during the reign of 
Raja Manasirnha. 

^CANDESVARA (fl. 1185) 

1. Additional manuscripts of his Suryasiddhdnta- 
bhdsya (see CESS A 3, 40b-41a): 

Jaipur (Khasmohor) 5139. Copied in Sarn. 1762 = 
A.D. 1705. (Somasiddhdntabhd^ya). 

Jaipur (Khasmohor) 5013. 

RORI (Alwar) 2609 = *Alwar 2025. 27ff. Incom¬ 
plete. 

2. Additional manuscripts of his Prasnavidyd (see 
CESS A 3, 41a-41b, and A 4, 88b): 

RORI Cat. VI 23991. Ff. 9-10, 14-18, 20, 24-31, 33, 
35-71, 81, and 89-100. Copied in Sarn. 1806 = 
A.D. 1749. Incomplete. 

RORI Cat. XVI 37152. 80ff. Copied by Balakrsiia 
Bhatta in Sarn. 1821 = a.d. 1764. 

RORI (Alwar) 2830 = * Alwar 1847. 45ff. Copied in 
Sain. 1844 = a.d. 1787. 

RORI Cat. VIII 28043. 7ff. Copied by Phatehacandra 
at Amarasara in Sarn. 1894 = a.d. 1837. 

AS Bengal III.A.42. 

RORI Cat. IV 18619. 37ff. (f. 34 repeated). 

RORI Cat. IV 19864. 49ff. 

RORI (Bikaner) 17333. 18ff. 

The Prasnavidyd in 41 adhyayas was published at 
Laksmaiiapura in 1896. 

^CANDESVARA THAKKURA {fl. 1314) 

Concerning this author see also B. Bhattacharya 
[A5. 1938]. 

1. Additional manuscripts of his Krtyaratndkara (see 
CESS A 3, 42a, and A 4, 88b); 


RORI Cat. V 22295. 71ff. Copied in Sarn. 1828 = 


106 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


GJRI 9437/589. Ff. 1-177. Maithili. Copied in Saka 
1703 = A.D. 1781. 

AS Bengal III.D. 19. Bengali. 

Benares (1956) 12096. If. Incomplete (sivaratrinir- 
naya). 

Benares (1956) 12907. Ff. 17-47 and 52-143. 
Incomplete. No author mentioned. 

Vrndavana (micro) 972. 4ff. Incomplete 
(pallisaratavidhana). No author mentioned. 
Property of Harisahkara Dasa of Vrndavana. 

2. Additional manuscripts of his Danaratnakara (see 

CESS A 4, 88b-89a): 

Benares (1956) 11827. Ff. 1-17. Copied in Sam. 
1847 = A.D. 1790. 

Benares (1956) 12072. Ff. 1-43 and 43b-54. {Dana- 
vakyavalt). Incomplete. 

Kathmandu (1905) III 306. 195ff. Nevari. 

4. Additional manuscript of his Suddhiratnakara (see 

CESS A 4, 89a): 

Anup 2618. 80ff. Incomplete. Perhaps not Candes- 
vara’s. 

5. Additional manuscript of his Pujaratnakara (see 

CESS A 4, 89a): 

Jaipur (Dharma) 102. 174ff. Copied by Balakarama 
at Lavapura on Thursday 5 kr§napak§a of Jye§- 
tha in Sam. 1792 = 29 May 1735. 

6. Additional manuscripts of his VivMaratnakara 

(see CESS A 4, 89a-89b): 

RORI (Alwar) 3718 = Alwar 1450. 352ff. Copied in 
Sam. 1911 = A.D. 1854. 

AS Bengal I.A.28. Bengali. 

Benares (1956) 12391. Ff. 5-91 and 91b-108. 

Incomplete. 

Benares (1956) 12434. Ff. 2-39. Incomplete. No 

author mentioned. 

Benares (1956) 12828. Ff. 1-77. Incomplete. No 

author mentioned. 

Benares (1956) 13065. Ff. 2-6. Incomplete. No 

author mentioned. 

Benares (1956) 13073. Ff. 63-64. Incomplete 

(svamipalavivadatarahga). 

GOME Madras D.3202. 222pp. 

Poona, Mandlik. Smrti and Dharma 95. 66ff. Incom¬ 
plete. No author mentioned. 

7. Additional manuscripts of his Grhastharatnakara 


(see CESS A 4, 89b-90a): 

*BORI 44 of A 1883/84 = BORI (Dharma) 365. Ff. 

1-30 and 72-133. Incomplete. 

BORI 247 of 1887/91 = BORI (Dharma) 364. 42ff. 
Incomplete. 

A section of the Grhastharatnakara that is miss¬ 
ing from the BI edition was published from a BORI 
manuscript by B. Bhattacharya [A5. 1946/47]; see 
also B. Bhattacharya [A5. 1967). 

8. Candesvara also wrote a Rajan'itiratnakara Manu¬ 
script: 

Darabhahga, Raj Library. Copied in Saka 1801 = 
A.D. 1879. 

The Rajanltiratnakara was published as an 
appendix to JBORS 22, 1936; and was edited with 
the Hindi tika, Prakasa, of Vacaspati Gairola and 
Tarinisa Jha as KSS 196, Varanasi 1970. 

M. CANMUKA MUTALIYAR (/?. 1910) 

Translator from Sanskrit into Tamil of a Puipa- 
pantam on astrology in A.D. 1910. Manuscript: 

BM Or. 13659. 


^CATVRAVUAYA GANl 

Additional manuscript of his Rajasthani stabaka 
on Rama’s Muhurtacintamani (see CESS A 3, 42b): 

RORI (Chinorgarh) 4166. 72ff. 


CATURAVIJAYA {fl. 1781) 

Author of a Rajasthani stabaka on Ganesa’s 
Grahalaghava, composed in Sarn. 1838 = a.d. 1781. 
Manuscript: 

RORI (Chittorgarh) 4784. 23ff. 

^'CATURTHlLALA SARM AN (fl. 1898/1900) 

Caturthilala (see CESS A 3, 42b, and A 4, 
90a-90b) completed his Muhurtaprakasa on 5 sukla- 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


107 


pak§a of Sravana in Sam. 1955 = ca. 23 July 1898. 
It was reprinted with his own Hindi tika at Bambai 
in 1985; his bhumika is dated Ratanagadha 29 Janu¬ 
ary 1900. He also composed a Santiprakasa, which 
was published at Murnbai in Sam. 2009, Saka 1874 
= A.D. 1952, and a Vratodyapanaprakasa, which 
was published at Bambai in 1986. 


^CATURBHUJA 

Additional manuscript of his tika on Devadatta’s 
Sr^ (ikarana (see CESS A 3, 43a): 

BHU C.22. 14ff. Sarada. Incomplete. 


*CATURBHUJA MISRA 

Additonal information concerning a manuscript 
of his Jyoti^aratnamdldi’ikd (see CESS A 3, 43a): 

RORI (Alwar) 2936 = *Alwar 1793. 175ff. Copied 
in Sam. 1716 = A.D. 1659. Incomplete. 


^CANDRACUDA BHATTA PAURANIKA {fl. 1610) 

1. Additional manuscripts of his Kdlasiddhdnta (see 
CESS A 3, 43b-44a, and A 4, 90b): 

RORI (Alwar) 3644. 124ff. Copied in Sarn. 1912 = 
A.D. 1855. 

RORI (Alwar) 3827. 68ff. Copied by La- 

k§minarayana in Sarn. 1923 = A.D. 1866. 

*BORI 528 of 1883/84 = BORI (Dharma) 297. 27ff. 
Incomplete. 

Columbia, Smith Sanskrit 4. Ff. 1-42. Incomplete. 
RORI (Alwar) 3826. 94ff. 

2. Additional manuscripts of his Satriskdranirnaya 
(see CESS A 4, 90b-91b): 

AS Bengal I 3. 656 = IM Calcutta 3226. Ff. 10-64. 

Copied in Sarn. 1797 = A.D. 1740. Incomplete. 

AS Bengal 796 (G. 522) = Mitra, Not. 1299. 6ff. 

Incomplete (rtusanti). 

AS Bengal III.F.231. 

AS Bengal I 3. 655 = IM Calcutta 5205. Ff. 3-7; 

and 1-5, 7-8, 11-15, and 17-34. Incomplete. 
Benares (1953) 9657. Ff. 1-87 and 93. Incomplete. 
Benares (1953) 9666. Ff. 1-130. 

Benares (1956) 13736. Ff. 1-119. 

Jodhpur 921. 6ff. Incomplete. 


Mysore ORI P.1563. Ff. 3-78. Telugu. Incomplete. 
Mysore ORI P.4520/2. Ff. 10-98. Nandinagari. 
Incomplete. 


*CANDRADATTA PANT A (b. 1915) 

The Candra hasta vijhdna of this author (see 
CESS A 3, 44a, and A 4, 91b) was reprinted at Dilli 
in 1983. 


CANDRAPRAKASA AC ARY A {fl. 1966) 

The great-grandson of Madhusudana Acarya and 
a resident of Mathura, Candraprakasa wrote Hindi 
tikas on Kasinatha’s Slghrabodha, 2nd edition 
published at Bareli in 1982 (preface dated Sam. 
2023 = A.D. 1966), and Lagnacandrikd, revised edi¬ 
tion published at Bareli in 1983. 


^CANDRAPRABHA 

Additional manuscripts of his Candronmliana 
(see CESS A 3, 44a) and of his Candronm!lana- 
dipaka (see CESS A 3, 44a, and A 4, 91b): 

RORI (Alwar) 2826. 54ff. Copied in Sam. 1907 = 
A.D. 1850. With his own tika. 

AS Bengal I.A.62. Bengali. With his own tika. 

RORI (Alwar) 2847. 47ff. With his own tika. 


^CANDRABHANU {fl. 1766) 

Additional manuscripts of his Subodhajananl (see 
CESS A 3, 44b): 

BHU B.362. 69ff. Copied in Sam. 1879 = A.D. 1822. 
RORI (Alwar) 2773 = * Alwar 1978. 98ff. The 
Subodhajananl is said to have been composed in 
Saka 1729 = A.D. 1807. 

RORI (Udaipur) 6198. 66ff. (ff. 16, 30-31, and 
43-55 missing). Incomplete (vivaha). (Slghra- 
bodhini). 

CANDRAMA PANDEYA {fl. 1982/1987) 

The son of Ramavrata Pandeya, a Sarayuparina 
Brahmana of Khajuriyam in the Bhojapura District 
of Bihara, Candrama has taught jyoti§a at the Catur- 


108 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


vedasamskrtamahavidyalaya in Mathura and at the 
Hindu Visvavidyalaya in Kasi. He has published a 
vyakhya in Hindi on the Keralaprasnasahgraha as 
Varanaseya SG I, Varanasi [N.D.]; a Samskrta 
anvaya, vyakhya and udaharana, with a Hindi tika 
on the Jatakapaddhati of Kesava (/?. 1496/1507) as 
Varanaseya SG 3, Varanasi Sam. 2039 = a.d. 1982; 
and a Hindi tika on the Brhadavakahaddcakra as 
Varanaseya SG —, Varanasi 1987. 

*CANDRASEKHARA SARMAN 

Additional manuscript of his Smrtidurgabhahjana 
(see CESS A 3, 45a, and A 4, 92a-92b): 

AS Bengal I.F.45. Bengali. 


^'CANDRASEKHARA VACASPATI (fl. 1640) 

According to NCC, vol. 6, p. 370, Candrasekhara 
was not the cousin of Jagannatha Tarkapancanana 
(1695/1806), but the brother of Jagannatha’s mater¬ 
nal grandmother. Also, it is there stated that he 
wrote his Dvaitanirnayasangraha in a.d. 1640. 

Addtional manuscript of his Smrtisdrasahgraha 
(see CESS A 3, 45a-45b): 

AS Bengal II.A.42. Bengali. 

^CANDRASEKHARA PAJTANAYAKA (fl. 1744) 

The son of Gautamamba and Bhagiratha Patta- 
nayaka, the nephew of Lokanatha Paffanayaka, and 
a resident of Brhadamradurga (Badamba) on the 
north bank of the Mahanadi, Candrasekhara fin¬ 
ished his tika on the Llldvatl of Bhaskara (b. 
1114), the Llldvatlvistara (see CESS A 3, 44b-45a), 
in Kali 4845 = A.D. 1744. He is probably identical 
with the author of the Jatakaratndkara (see CESS A 
3, 45a). Additional manuscript of his Llldvativi- 
stara: 

Bhubaneswar 2. G/23 = Bhubaneswar IV ganita 54 
(G/23). II8ff. Oriya. From Khallikota, Ganjam 
District. 

The first verse is: 

yasya srilabhagiratho janayita so ’yam pratik§mata- 
larn 


jiyat samprati candrasekharakrtih srigautamamba- 
sutah // 

yena syamalasailanathapadayoh smrtva subodhapta- 
ye 

balanam nirafahkanirmalataro lilavativistarah // 

^CANDRASEKHARA JHA (fl. 1923/1924) 

Author (see CESS A 3, 45b) of a vyakhya on the 
goliyarekhaganita and the capiyatrikonaganita from 
the Golaprakdsa of Nilambara Jha (b. 18 July 
1823); Candrasekhara finished this vyakhya at Kasi 
on 3 suklapaksa of Karttika in Saka 1845 = ca. 11 
November 1923. This was published with the tip- 
pani of Munindra Jha as MM 269, 2nd. ed., Kasi 
1956. The last two verses are: 

yajjvale vimale nirantaralasadvanivilasojjvale 
vamse ’bhuc chrutijatakarmanirato venisamakhyo 
dvijah // 

tajjanarn srutisahkhyadharmaniratanam sadvivekad 
dviti- 

yadyo ’bhuc caturananad budhavaras taddharma- 
labdhodayah // 

sricandrasekhara iti prathitena tena 
golasvarQpakumudavalikaumud iyam // 
tika krta sarayugebhakusakajorje 
kasyarn site ’gnipramite paripurttim agat // 

^^CANDRASENA 

Additional information concerning a manuscript 
of his Cuddmanisara (see CESS A 3, 46a): 

Mysore (1905) 753. 102pp. 

CANDRASENA 

Author of a Svaravarnakald. Manuscript: 

Mysore ORI P.611/2. Ff. 1-3. Grantha. Incomplete. 

It ends: 

candrasenamuniproktam svaravarnakalabhidham // 
evarn ca tri§u loke§u jhanam icchanti manavah // 
tat sarvam nama siddyartham karastham iva drsya- 
te // 

The colophon begins: iti sricandrasenaviracite. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


109 


*CANDRAYANA MISRA (Ji. 1748) 

The son of Jhahgi Misra and the pupil of Santo- 
§araya, Candrayana (see CESS A 3, 46a) composed 
his Siiryasiddhaniasaranipaddhati in Sam. 1805 = 
A.D. 1748. Additional manuscript: 

Jaipur (Khasmohor) 5250. 

Additional manuscript of his Tithikalpavrksa: 

Jaipur (Khasmohor) 5251. 

He also wrote a Grahaspa^ {asdrini. Manuscript: 

Jaipur (Khasmohor) 5495. 


^'^CARANADASA 

Additional manuscripts of his Jndnasvarodaya 
(see CESS A 3, 46a, and A 4, 93a): 

Vrndavana (micro) 378. 6ff. Copied in Sarn. 1873 = 
A.D. 1816. Original property of Krsna Caitanya 
Bhafta of Vrndavana. 

Poleman 5893 (Harvard 1681). 9ff. Copied by 
Ramadasa in Sarn. 1876 = A.D. 1819. 

Baroda 7541. Ff. 10-37. Copied in Sam. 1892 = A.D. 

1835. Incomplete. No author mentioned. 

Gondal (Jaina Dharma) 511. 18ff. Copied on 9 
kr^napaksa of Pausa in Sam. 1941 = ca. 9 Janu¬ 
ary 1885. 

Harvard 2488. Ff. 1-3. Incomplete (ends in verse 
33). 

Jaipur (Khasmohor) 1230; 1313; 1489 (16); and 
3789. 

Oxford CSS I 172 (*d. 1013 (2)). Ff. 1-19. 

Pattan II 12464. Ff. 2-13. 

Prayaga 1603/1. 21pp. (Ak^ara). 

Prayaga 1901. 48pp. Acquired from Gopala Candra 
Sirnha of Lakhanau. 


^CARITRA MUNI 

Manuscripts of his avacuri in Old Rajasthani on 
the Sangrahapt of Sricandra Suri (see CESS A 3, 
46b): 

RORI Cat. V 23528. 27ff. Copied at Rohinagara in 
Sam. 1592 = A.D. 1535. 

RORI Cat. V 23536. 18ff. 


*CITRABHANU (fl. 1530) 

Concerning this author (see CESS A 3, 47a, and 
A 4, 93a) see also R. C. Gupta [A5. 1980]. 

*CIDANANDA (fl. 1850) 

Additional manuscripts of his Svarodayasdstra 
(see CESS A 3, 47a-47b): 

Pattan II 12487. 22ff. Copied in Sam. 1907 = A.D. 
1850. 

LDI (Gujarati) 3695 (8497) = *LDI (MPC) P/8497, 
llff. Copied by Moticandaji at Siddhapura in 
Sam. 1939 = a.d. 1882. 

Pattan II 12815. 47ff. 


CINTAMANI 

Author of a tika, Kunddrkadldhiti = Kunddrka- 
vdsandtlkd, on the Kunddrka of Sankara; this may 
be identical with the tika, Cintdmani, on the Kun¬ 
ddrka, ascribed to Dik§ita. Manuscript; 

Wai 3046. 49ff. 


^CINTAMANI 

Cintamani was the son of Sundara. Additional 
manuscripts of his Camatkdracintdmani (see CESS A 
3, 47b): 

RORI (Jaipur) 5864. 8ff. Copied by Pandita Natha- 
mala in Sarn. 1780 = a.d. 1723. With a Raja¬ 
sthani stabaka. 

RORI (Udaipur) 4046. 19ff. Copied by Manajidasa 
Vyasa at Dadhicipura in Sarn. 1821 = a.d. 1764. 
RORI (Jaipur) 11123. 2ff. Copied by Vaijanatha 
Vyasa in Sarn. 1837 = a.d. 1780. Incomplete 
(bhavadhyaya). 

RORI (Jaipur) 6019. 15ff. Copied by Pandita Rupa- 
canda at Patodhi in Sarn. 1850 = a.d. 1793. 
With a Rajasthani stabaka. 

CINTAMANI 

Alleged author of a tika on the Tdjikanila- 
kanthl of Nilakantha (fl. 1569/1587); this is prob¬ 
ably the Rasdld of Govinda (b. 2 October 1569), the 


no 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


son of Nilakan^ha and the great-grandson of Cinta- 
mani. Manuscript: 

BHU C.2145. 52ff. 


*CINTAMANI 

Additional manuscripts of his Ramalotkarsa (see 

CESS A 3, 47b-49a, and A 4, 93a-93b): 

BHU C.4671. 9ff. Sarada. Copied in Satn. 1808 = 
A.D. 1751. Incomplete. No author mentioned. 

Rattan II 14116. 23ff. Copied in Sam. 1830 = A.D. 
1773. 

RORI (Jaipur) 3100. Copied by Haranarayana Misra 
in Sarn. 1844 = A.D. 1787. Incomplete (prasna). 

Oxford CSS I 219 (*e. 149 (4)). Ff. 1-34. Copied on 
Tuesday 10 kr§napak§a of Pau§a in Saip. 1851, 
Saka 1716 = 13 January 1795. Formerly prop¬ 
erty of Mohanaji Travadi, the son of Kesavaji. 

RORI (Udaipur) 3678. 32ff. Copied by Cirahjiva 
Harikaranaccha Brahmana Ami§ta at Javalapura 
in Sarn. 1862 = A.D. 1805. No author mentioned. 

*WHMRL F.39.C. Ff. 8-25. Copied by Si.tarama at 
Kasi on Friday 5 suklapaksa of Caitra in Sam. 
1868 = 29 March 1811. Incomplete (begins in I 
20 ). 

RORI (Bikaner) 14662. 29ff. Copied by Devavijaya 
at Vikramapura in Sarn. 1869 = a.d. 1812. 

RORI Cat. XVI 37139. 19ff. Copied in Sam. 1870 = 
A.D. 1813. Incomplete (tantra I). 

RORI Cat. Ill 17057. 17ff. Copied by Lichamana- 
rama Jyoti§i in Sam. 1891 = a.d. 1834. No 
author mentioned. 

Oxford CSS I 220 (*c. 329). Ff. 1-20; and ff. 1-18. 
The first part was copied by Matadina on Sunday 
5 kr§napaksa of Pau§a in Sarn. 1898, Saka 1763, 
Sana 1249 = 30 January 1842, the second part 
by Matadina on Thursday 3 krsnapak§a of Pau§a 
in Sam. 1898, Saka 1763, Sana 1249 = 27 Janu¬ 
ary 1842. 

RORI Cat. IX 29345. 29ff. (f. 4 missing). Copied by 
Sivabakasa R§i in Sarn. 1909 = a.d. 1852. 
Incomplete. 

RORI (Alwar) 2872. 50ff. Copied in Sarp. 1912 = 
A.D. 1855. 

RORI (Alwar) 2883. 37ff. Copied in Sam. 1912 = 
A.D. 1855. 

GJRI 8522/747. Ff. 1-25. Copied in Sal. San. 1268 
= A.D. 1860. Incomplete (prasnatantra). 

Anandasrama 2147. 

AS Bengal I.G.46. 

BHU C.2635. 20ff. 


BHU C.4508. 22ff. 

GJRI 8626/851. Ff. 2-23. Incomplete. 

GJRI 8631/856. Ff. 1-19. Incomplete (prasnatantra). 
Mysore ORI C.4468. Ff. 1-15. Incomplete. 

Mysore ORI P.833. Ff. 1-45. Telugu. 

Mysore ORI P.1933/1. Ff. 1-15. Nandinagari. 

Mysore ORI P.7065. Ff. 1-5. Kannada. Incomplete 
(end of sakaladigbala). 

Mysore ORI P.7066. Ff. 1-11. Telugu. 

Nagaur 1025. 14ff. In Hindi. 

Nagaur 1026. 15ff. In Hindi. 

N-W P V (1880) B 1. 25ff. No author mentioned. 

Property of Mian Manasirnha of Mandi. 

Oxford CSS I 221 (d. 751 (7)). Ff. 3-35. Incomplete 
(begins with samjha 24). 

PrSB 2947 (Gottingen Sanscr. Madh 44). Ff. 29-49v. 

Incomplete (begins with verse 56). 

RORI Cat. I 38. 16ff. Incomplete (prasnatantra). No 
author mentioned. 

RORI Cat. VII 26132. 12ff. (f. 9 missing). Incom¬ 
plete. No author mentioned. 

RORI Cat. VIII 27684. 3ff. No author mentioned. 
RORI Cat. VIII 28119. 36ff. 

RORI Cat. IX 28835. 18ff. No author mentioned. 
RORI (Alwar) 2869. 18ff. (Prasnatattva). 

RORI (Alwar) 2871. 24ff. Incomplete (prasnatan¬ 
tra). 

RORI (Alwar) 2873 = *Alwar 1928. lOff. With the 
tika of Paramasukha. Incomplete (var§aphala). 
RORI (Jaipur) 8020. 15ff. Incomplete (prasna).' 
RORI (Jaipur) 10471. 13ff. Incomplete (prasna). No 
author mentioned. 

RORI (Jaipur) 11777. 30ff. Incomplete (prasna). 
Udaipur RVSS 1285. 23ff. (ff. 1 and 3 missing). 

Incomplete. 

Vrndavana 197. 13ff. 

Vrndavana 8439. 3Iff. 

WHMRL a 931. Ff. 1-24. Incomplete (ends in II 
150). 

The Ramalotkarsa with the Hindi fika of 
Budhavasati Rama was published at Murnbai in 
Sarn. 1983, Saka 1848 = a.d. 1926. 

^CINTAMANI NYAYAVAGISA BHATTACARYA 

Additional manuscript of his Smrtivyavastha (see 
CESS A 4, 93b-94a): 

GJRI 5536/567. Ff. 1-58. Maithili. Incomplete (ends 
in prayascittavyavastha). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


111 


KAVIRAJA CINTAMANI BHATTA 

Author of a Prasnacintamani. Manuscript: 

Oxford (Vyasa) 144. Ff. 2 and 4-6. Copied by Hari- 
deva, the son of MahMeva Pandya of the 
Udicyajhati, a resident of Hamsapura, on Mon¬ 
day 6 kr§napak§a of Margasir§a in Sam. 1728, 
Saka 1593 = 11 December 1671. Incomplete 
(misradhyaya 5-12 and 21-end). 

The colophon begins: iti srikavirajacintamani- 
bhal taviracitah. 

^CINTAMANI ifl. 1661) 

Additional manuscripts of his Sammaticintamani 
(see CESS A 3, 49b-50a, and A 4, 94a): 

Anandasrama 7912. 

Vrndavana 8810. 47ff. 

^CINTAMANI DlKSITA (1736/1811) 

Additional manuscripts of his Golananda (see 
CESS A 3, 50a-50b, and A 4, 94a): 

*BORI 41 of 1907/15. Ff. 1-7. Copied by Dinakara, 
the son of Ananta Jyotisa, on Friday 5 kr§na- 
paksa of Sravana in Saka 1737 = 25 August 
1815. 

*BORI 40 of 1907/15. Ff. 1-12. Copied for < Dina¬ 
kara >, the son of Ananta Jyoti§a, on Thursday 
11 kr§napaksa of Pau§a in Saka 1737 = 25 Janu¬ 
ary 1816. 

*BORI 43 of 1907/15. Ff. 1-30. Copied by Visvana- 
tha DIk§ita Kale on Sunday 4 kr^napaksa of Cai- 
tra in Saka 1742 = 3 April 1820. With the tika 
of Yajhesvara and the ak§ak§etrani with the 
bhahgiprakarana. Formerly property of Dinakara 
Joti§i. 

Anandasrama 2146; and 3450 (with the tika of 
Yajhesvara). 

CIMANALALA PANDITA 

Author of a Hindi tika on a Sahkrantyudya- 
pana. Manuscript: 

Jaipur (Dharma) 699. 18ff. Copied by Ramakumara 
Misra. 


CIMANl BAIKA 

Author of a Var^aphala. Manuscript: 

Jaipur (Khasmohor) 3006. 

^CIRANJIVA BHATTA 

The date of the author of the Jyoti^akeddrapika, 
the middle of the seventeenth century (see CESS A 
3, 51a), is impossible given the new date, a.d. 1766, 
of Krpasahkara. 

^CIRANJ'IVA BHATTACARYA {fl. ca. 1650/1675) 

The important article by D. C. Bhattacharyya 
[A5. 1941] establishes that Cirahjiva, the son of 
Raghavendra Satavadhana and the pupil of Bhava- 
nanda Siddhantavagisa, was born at Guptapalli or 
Guptipara in Navadvipa and taught at Kasi. His 
patron, Yasavanta Sirnha, a Gauda prince, was the 
son of Govardhana and the grandson of Krparama. 
Krparama was the patron of Cirahjiva’s father, 
Raghavendra (/?. 1647), who wrote the Rdmaprakasa 
(nos. 2 and 3 in CESS A 3, 5 la-5 lb, which are 
really one work) at Indurakhi; and Yasavanta was 
the patron of Cirahjiva, who wrote the Tdjikarat- 
ndkara (see CESS A 3, 51b, and A 4, 94a). Addi¬ 
tional manuscripts of the Tajikaratnakara: 

BHU B.3721. 47ff. Copied in Sarn. 1790 = a.d. 
1733. 

Kathmandu (1965) 67 (6681). 73ff. Copied on Fri¬ 
day 13 krsnapak§a of Sravana in Sarn. 1875 = 
28 August 1818. 

RORI (Alwar) 2792 = *Alwar 1805. 42ff. Copied in 
Sarn. 1909 = A.D. 1852. Incomplete (10 of 18 
prabhas). 

BHU B.3792. 60ff. {Jatakamtna of Ratnakara). 
Incomplete. 

GJRI 9701/1011. Ff. 1-46. Incomplete. 

Kathmandu (1965) 68 (6680). 27ff. Incomplete. 

CENNA B HUP ATI 

Author of a Jatakakalaratnakara. Manuscript: 

Mysore ORI P.3184/3. Ff. 1-69. Grantha. Copied by 
Kausika Srinivasa. 


112 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*CAITANYA RAJAGURU 

Additional manuscript of his Laghusiddhanta (see 
CESS A 4, 94b), which is based on the Suryasid- 
dhdnta: 

Bhubaneswar IV 143 (Jy/4). 53ff. Oriya. With an 
Oriya translation. From Puri. 

The colophon begins: iti sricaitanyarajaguruna 
viracite. 

*COLA VIPASCn 

Additional manuscripts of his Ganakopakdrini 
(see CESS A 3, 52b-53a, and A 4, 94b): 

Mysore ORI *B.572 (b). Ff. 1-108. Kannada. Incom¬ 
plete. 

Mysore ORI *P.2084/1. Ff. 1-95. Telugu. Incom¬ 
plete. 

Mysore ORI *P.2598/2. Ff. 1-82. Grantha. Incom¬ 
plete. 

Mysore ORI P.6716. Ff. 2-37. Grantha. Incomplete. 
New Delhi, H. B. Tail 78. 50ff. Incomplete. 
Visvabharati (Adyar) 1061. 115ff. Grantha. Incom¬ 
plete (adhyayas 1-13). 

The tag verse at the end of each adhyaya begins: 
colakhyena vipascita viracite. 

^CAUNDAPAYANA = CAUNDAPACARYA (fl. ca. 
1425) 

The son of Kamamba and of Cinnayarya of the 
Vasi§tha gotra, Caundapayana, who was either 
named Vi§nu Bhatfa or the pupil of Visnu Bhatta, 
studied under Bharatitirtha, Kriyasaktiguru, and 
Vidyatirtha. He was the minister of Virabhupati (/?. 
ca. 1425), the great-grandson of Bukka I of 
Vijayanagara (1343-1379). Additional manuscripts 
of his Yagakdlanirnaya (see CESS A 3, 53a): 

GOME Madras R.3529. 37ff. Telugu. Copied by 
Subbayya. Presented in 1920/21 by Durbha 
Kr§na Sastrigaru of Gangadevipeta, Indukurpeta 
Post, Nellore District. 

GOME Madras R.4061. 18ff. Telugu. Presented in 
1921/22 by Kesari Subbayyagaru of Brahmana- 
kraka Agraharam, Kavali Taluk, Nellore District. 
Hultzsch I 428. 21ff. Telugu. Property of Kesari 


Yajhayya of Brahmanakraka. 

Kerala - (2911 A). See NCC, vol. 7, p. 87. 
WRI 6010. 36ff. Tamil. 


CYAVANA 

Assumed author of a Cyavanajyotisa. Manuscript: 

Osmania University 786/B. 15ff. Telugu. With notes 
in Telugu. Incomplete. No author mentioned. 


CHAKAUPI NAN DA 

See Mahamahopadhyaya Safkaudyananda. 


CHATRAMANI 

Author of a Yogavall for the Nrpati, Balavanta- 
sirnha, the son of the Nrpa, Vakhatesa, of the Sur- 
yanvaya. Manuscript: 

RORI (Alwar) 3020. 30ff. 

At the beginning are the verses: 

vanim adhyagamat kanadaracitarn samyag jagau 
gautamirn 

yo buddhya samajigamat phanipater vacam raha- 
syamrtam // 

mimarnsarn prathamottaram adhijage sadbharatirn 
bharatim 

ajhasid vibudhastuto vijayate srijivanathaprabhuh 

II3II 

suryanvaye samutpannah ksitijha vedavargadah // 
tesarn madhye mahaviro vakhateso nrpo ’bhavat 

II4II 

tatputro balavantasimhadharanipalo ’grani dhanvi- 
nam 

dinanarn surabhuruhah sukrtinarn jhatih kalajan- 
mabhuh // 

sastranarn mukurarp dvi§am api yamah strinarn 
prasunayudho 

viranarn prathamo narendrapadavim adhyasya 
sarvadhikah HIH 

vedacak§uratarn srutva balavantarn naradhipam // 
bruve yogavalirn tasya mude purvanusaratah //ll// 

The colophon begins: iti srimacchatramanikrta. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


II3 


*CHADURAMA = CHIDDURAMA {fl. 1813?) 

Additional manuscript of his Lagnasundan (see 
CESS A 3, 53b), in which he is named Chindurama 
and is said to have composed the Lagnasundan in 
Sam. 1817 = a.d. 1760: 

Vrndavana (Hindi) 9874. 41ff. Copied by Kanhaiya- 
lala in Sarn. 1925 = a.d. 1868. Incomplete. 


VAGAJIVANA DASA GUPTA (fl. 1968/1973) 

The fourth edition of his Dasdphala vicara (see 
CESS A 3, 53b) was published at Dilli- Vara- 
nasi-Patana-Madrasa in 1986. 

JAGADlSA 

Author of a Kundamdld. Manuscript: 

Rajputana, p. 6. At Ujjain. 


VAGADDEVA (fl. ca. 1175) 

Additional manuscripts of his Svapnacintdmani 
(see CESS A 3, 54b-55a, and A 4, 94b-95a): 

RORI Cat. V 23464. 6ff. Copied by Muni Somo- 
padhyaya at Ucchapuri in Sarn. 1542 = a.d. 
1485. 

RORI Cat. IV 19891. 8ff. Copied by Karmasi, the 
pupil of Suryakalasa of the Dvivandanikagaccha, 
in Sam. 1660 = a.d. 1603. 

BHU B.698. 19ff. 

Jaipur (Khasmohor) 755 (2); 923; and 5038. 

Oxford CSS I 158 (*d. 765 (2)). Ff. 2-20. Incom¬ 
plete (1, 8- 2, 114). 

Oxford CSS I 159 (*d. 799 (7)). Ff. 1-20. 

RORI Cat. IX 28629. 22ff. 

RORI (Udaipur) 2617. 27ff. Incomplete. 

RORI (Udaipur) 3662. Ff. 2-32. Incomplete. 


JAG AN NATH A 

A member of the K§itivarnsa, Jagannatha wrote 
part of a Khadipdtha in Oriya. Manuscript: 

Bhubaneswar IV ganita 5 (G/34). 142ff. Oriya. From 
Haladia, P. S. Khurdha, Puri District. 


JAGANNATHA SARM AN 

Author of a tika, Vidvatpriya, on the Siirya- 
sataka of Mayura. Manuscripts: 

AS Bengal 5056 (G. 3890). 26ff. Bengali. Incom¬ 
plete (ends in verse 45). 

Sastri, Not. 1900. 412. 28ff. Bengali. Property of 
Pandita Candrakanta Nyayalahkara of Dhaka. 

Verse 2 is: 

yarn natva tv ajararn vapuh suraganah samprapur 
enahkulair 

mukta muktivirodhibhir muniganah samstuya 
divyaih stavaih // 

tarn natva kavitagrasuryasatakastotrasya tika jagan- 
nathenaiva sutanyate hitakari helirn ca vidvatpriya // 

JAGANNATHA PANDITARAJA (fl. ca. 1620/1660) 

The son of Lak§mi and of Peru (or Perama) 
Bhafta, a Tailihga of the Vehginadukula, Jagannatha 
wrote, among many other poems, a Sudhdlahan on 
sunrise. Manuscript: 

Mitra, Not. 2892. 6ff. Property of Pandita Syamalala 
Duve of Ajirngahj. 

The Sudhalahan was printed in Kdvyamala, Gu- 
ccha I, pp. 16-22. 

VAGANNATHA SAMRAT (fl. ca. 1720/1740) 

1. Additional manuscripts of his Rekhdganita (see 
CESS A 3, 56a-57a, and A 4, 95a): 

Jaipur (Khasmohor) 5373. Copied on purnima of 
Vaisakha in Sarn. 1785, Saka 1650 = ca. 12 May 

1728. 

RORI Cat. XVI 35253. 276ff. Copied on Tuesday 3 
suklapaksa of Magha in Sam. 1785 = 21 January 

1729. 

RORI Cat. IX 28623. 298ff. Copied for Bikharidasa 
Misra at Indraprastha on Tuesday 2 suklapaksa 
of Sravana in Sarn. 1800 = 12 July 1743. 

^Oxford 797 (Wilson 425). 172ff. (ff. 1-8 missing). 
Copied by Tokamaiii (Lokamaiii?) on Tuesday 12 
kr§iiapaksa of Magha in Sarn. 1877 = 27 Febru¬ 
ary 1821. 


114 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Allahabad Museum 90/96. Ff. 1-31. Incomplete 
(ends in 1, 24). Formerly property of 

Laksminarayana Vyasa. 

AS Bengal I.B.12. Bengali; and I.B.13. 

Jaipur (Khasmohor) 5372. 

NFS (Sanskrit) 6144. 34ff. Incomplete. 

2. Additional manuscripts of his Samraisiddhanta 
(see CESS A 3, 57a-58a, and A 4, 95a): 

RORI Cat. XVI 36323. Off. Copied by Nanurama in 
Sarn. 1886 = a.d. 1829. Incomplete (yantra- 
dhyaya). 

RORI Cat. IV 19747. 3ff. Incomplete (golayantra; 

incomplete). No author mentioned. 

RORI (Alwar) 2622 = *Alwar 1994. llOff. Incom¬ 
plete. 

The material following the translation of 
Ptolemy’s Almagest (yantradhyaya to triprasnadhi- 
kara) was edited as the Siddhmtasamrd( by 
Muralidhara Caturveda at Sagara in 1976. 

3. Jagannatha apparently also wrote, under Jaya- 
sirnha’s leadership, a Sliryasiddhantavyakhya. Manu¬ 
script; 

RORI Cat. IX 29498. 29ff. Incomplete. 

The second verse is; 

srimadbhih sarnradbhir 
jayasirnhanrpagranibhir atigudham // 
spa§tadhikrtau spa§tam 
vivecyate golavijhajanatustyai HIH 

4. Finally Jagannatha wrote a Yantrasdstra. Manu¬ 
script: 

RORI Cat. XVI 35964. 45ff. 


-^JAGANNATHA BHASINA (fl. 1969/1978) 

Author also (see CESS A 3, 58a, and A 4, 95a) of 
a Hindi vyakhya on the Bhdvdnharatndkara of 
Ramanuja, published at Nai Dilli in 1977; and of an 
Anisia graha kdrana aura nivdraria, published at 
Dill! in 1978. His Hordsataka in Samskrta was pub¬ 
lished posthumously with an English translation and 
commentary by G. S. Kapoor, New Delhi 1987. 


JAGANNATHA PARASURAMA DVIVEDIN (fl. 
1977?) 

The son of Parasurama and a resident of Surya- 
pura, Jagannatha wrote a Sdntikalpadruma of which 
the 7th edition was published at Surata in 1977. 

JAGP AT RAY 

Author of a Risdlah i siydq. See C. A. Storey, 
Persian Literature, vol. 2, part 3, London 1977, p. 
374. 


VATADHARA (fl. 1704) 

Additional information concerning the manu¬ 
script of his Phattesdhaprakdsa (see CESS A 3, 58a): 

BORI 195 of 1883/84. Ff. 6-24. Copied on Thursday 
9 kr§napak§a of Phalguna in Sarn. 1777 = 1 
March 1722. 

The last two verses are: 

asid uddhavasarnjhako nigamavid gargo kule 
bhaskarah 

srautasmartaparo ’tha tatsuta iti sridurgamisrah 
sudhih // 

tatsunur vanamalisarmavibudhah srisiharanda- 
bhidhe 

dese paiiditamaridite ’tividite variiasramair asrite 

//!// 

Jyotihsastravicarasaracaturah saujanyaratnakaras 
tatsunus ca jatadharo hi kuralajhatiprasiddhah 
sudhih // 

srimaccandrakulendrabhupamukutalafikariiiarn 

sriphate- 

sahanarn kutakarn grahabhramahararn cakre 
prakasarn param HIH 

The colophon begins: iti srimisrajatadharaviracite 
srimanmaharajadhirajavrndavanditapadaravindasri- 
matphattesahaprakase. 

VANARDANA BHATTA 

Additional manuscript of the Bdlaviveka (see 
CESS A 3, 58b) of Janardana, the son of Srinivasa 
Gosvamin: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


115 


Jaipur (Khasmohor) 5290. Copied in Sarn. 1749 = 
A.D. 1692. 


VANARDANA BHATTA YAJNOPAVITA (fl. 
1618/1639) 

Additional information concerning the manu¬ 
script of his Brahmaryopakaranasiddhi (see CESS A 
3, 59a, and A 4, 95b): 

Oxford CSS I 52 (*c. 319 (2)) 7 . If. Copied by Bha- 
gavatidasa, the adafi (?) of Mahadevabhaf ta, the 
son of Kr§nabhata, on 12 suklapak§a of Magha 
in Saka 1560 = ca. 5 February 1639. Formerly 
property of Bhaskara Jyotirvit. 

This was edited in D. Pingree [A5. 1989b] 79-80. 

JAYAKISANA MAN I (fl. 1709) 

Author of a Ramalasdstra in Hindi in 1121 a.h. 
= 13 March 1709-1 March 1710. Manuscript: 

Prayaga 4758. 73pp. Incomplete. Acquired from 
Surajaraja Dharivala of Gvaliyara. 


JAYAKIRTI (fl. 1812) 

The pupil of Amaracandra Gani, Jayakirti (also 
known as Jivaraja) composed a Caitrlpurnimd- 
vydkhydna at Jesalamera in Sarn. 1869 = A.D. 1812. 
Manuscripts: 

RORI (Bikaner) 16051. Ff. 12-15. Copied by Godhu 
in Sam. 1896 = A.D. 1839. 

RORI (Bikaner) 14850. Ff. 13-16. Copied by Lacha- 
mana Jati at Bikanera in Sarn. 1904 = A.D. 1847. 
RORI (Bikaner) 14840. Ff. 3-6. Copied at Desa- 
naka. 

RORI (Bikaner) 16046. Ff. 11-14. 


VAYAKR^NA 

Additional manuscripts of his Bdlabodhinl (see 
CESS A 3, 60a, and A 4, 96a): 

GJRI 8767/992. Ff. 1-6. Maithili. Copied in Saka 
1765, Sal. San. 1261 (read 1251) = A.D. 1843. 
Oxford CSS I 460 (b 98 (5)). Ff. 1-9. Bengali. 


JAYAKR^NA MISRA (fl. 1982) 

A pupil of Pandita Kulamani Misra, Jayakr§na 
wrote a tika, Ratnamahjarl, on the Nirnayakautuka 
of Visvesvara Bhatta, which was published at Puri 
in 1982. 


VAYAGOPALA PANDITA 

Additional manuscripts of his tika on the Jdtakd- 
lahkdra of Ganesa (fl. 1613) (see CESS A 3, 60b): 

NPS (Sanskrit) 8569. Ff. 1-39. Copied in Sarn. 1913, 
Saka 1778 = A.D. 1856. 

RORI (Udaipur) 4000. 18ff. 

Varendra 215. Ff. 1-40. 


VAYADEVA (fl. 1671/1675) 

Additional manuscript of his Prasnanidhi (see 
CESS A 3, 60b): 

RORI (Bikaner) 14660. 12ff. With a stabaka. 


VAYADEVA SARMAN (fl. 1750) 

The edition of his Jdtakacandrikd (see CESS A 3, 
61a) was reprinted at Kalyana-Bambai in 1986. The 
last verse is: 

srivakratundarn paricintya cetasa 
jyotirvideyarn jayadevasarmana // 
srimatpradipe dharinim prasasati 
sake dvisaila§tiyute nabhasyake // 

JAYAPRABHAVIJAYA SRAM AN A (fl. 1986) 

The pupil of Yatindra Suri (b. 1883), Jayapra- 
bhavijaya, who received his dik§a from Dhanacan- 
dra Suri, the pupil of Rajendra Suri, wrote a Hindi 
tika, Rajendra, on the Muhurtardja of Gulabavijaya 
(fl. 1919). published at Rajagadha in 1986; he also 
provided parisi§tas 2 (pp. 284-360) and 4 (pp. 
403-426). Verses 2 and 4-7 at the beginning of the 
Rajendra are: 

srimadvijayarajendramukhyan surisvarams tatha // 
vande sviyam gurum surim sriyatindram 
subodhadam HIH 

yo ’ntevasi sriya bhrajadrajendrasyabhavan munih // 


116 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


sridhanacandrasOres ca dik^am apa ca sadvidhi HAH 
jyauti§e bharavir yo ’mum grantham mauhurta- 
rajakam // 

samagrahid vacakasrigulabavijayam smare H5H 
sr i madyat i ndrabhidhasurivaryad 
guror avaptavrata etad iye // 
padaravinde pranidhaya citte 
jayaprabhakhyah sramano ’ham ukta- H6H 
granthasya bodham pratipadayantim 
ramyaih padair naikasutalikabhih // 
yuktam ca hindyam girl sarvayogyam 
rajendranamnim vidadhami tikam HIH 

JAYAMANGALA 

Author of a tika on the Suryasataka of Mayura. 
Manuscript: 

Mitra, Not. 1643. 42ff. Bengali. Copied in Saka 
1623 = A.D. 1701. Property of Vamacarana 
Bhattacarya of Bhimagada, Khayarasula, 
Virabhuma Zilla. 


VAYARATNA {fl. ca. 1725) 

Bhavaratna {fl. 1711), the guru of Jayaratna (see 
CESS A 3, 61a) lived at Tr<y>ambavati in 
Gujarat; presumably the pupil came from the same 
locality or its vicinity. Additional information 
concerning a manuscript of his Jhanaratnavall: 

RORI (Alwar) 2860 = *Alwar 1814. 8ff. 

The second verse is: 

srimadgurjaradesabhu^anamanis tr<y >ambavati- 
namake 

sripurne nagare babhuva sa guruh sribhavaratna- 
bhidhah // 

tacchi^yo jayaratna ity abhidhaya yah purnima- 
gacchavarps 

teneyarn kriyate janopakrtaye srijhanaratnavali // 

JAY ARAM A BHATTA 

Additional manuscripts of his Kamadhenupad- 
dhati (see CESS A 3, 61b-62a): 

RORI Cat. V 22674. 8ff. Copied by Ratirama in 
Sam. 1908 = a.d. 1851. 

*Alwar 1760. Copied in Sarn. 1912 = a.d. 1855. 


RORI Cat. VI 24040. 44ff. (ff. 27-28 missing). 
Incomplete. 

VAY ARAM A BHATTA 

Additional manuscript of his Khecarakaumudi 
(see CESS A 3, 62a-62b): 

BISM 45,243. Copied on Tuesday 7 suklapak§a of 
Karttika in Saka 1782 = 2 November 1725. 
Ascribed to Ramabhaffa. 


JAY AY ANT A (fl. 1593) 

Author of a tippana on the Brahmatulya = 
Karanakutuhala composed by Bhaskara in 1183; in it 
Jayavanta computes longitudes for Friday 1 sukla- 
pak§a of Caitra in Sarn. 1650, Saka 1515 = 23 
March 1593, and gives a desantara correction for 
Yodhapura. The unique manuscript contains the 
commentary on only adhikaras 1 and 2, which pre¬ 
sumably was the full extent of the text. See D. Pin- 
gree [A5. 1985] 168. Manuscript: 

WHMRL a 861. Ff. 1-8. Copied by Kusalasagara on 
5 suklapak§a of Sravana in Sarn. 1731 = ca. 27 
July 1674. Incomplete (adhikaras 1 and 2). 

The last verse is: 

etan madhyadhikarasya brahmatulyasya fippanam // 
vineyanam subodhaya jayavantena nirmitam // 

VAYAVIJAYA (fl. 1603) 

The pupil of Devavijaya, Jayavijaya wrote his 
Sakunadlpikd in Gujarati (see CESS A 3, 63a) at 
Giripura in Sam. 1660 = a.d. 1603. Manuscripts: 

EDI (Gujarati) 3707 (4868) = *LDI (MPC) P/4868, 
llff. (f. 1 missing). Copied in Sarn. 1680 = a.d. 
1623. 

EDI (Gujarati) 3708 (5201). 19ff. Copied by Muni 
Ratnavijaya in Sarn. 1715 = A.D. 1658. 

VAYASlLA MUNI (fl. 1663) 

Additional information concerning the manu¬ 
script of his stabaka on the Sahgrahanl of Sricandra 
(see CESS A 3, 63a): 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


117 


EDI (Gujarati) 254 (6078) = *LDI 6078. 58ff. Cop¬ 
ied in Sarn. 1740 = A.D. 1683. 

VAYASEKHARA SURl 

Manuscripts of his K^etrasamasa (see CESS A 3, 
63a): 

RORI Cat. IV 19203. 17ff. Copied by Jayatilaka 
Suri, the pupil of Bhavahar§a Suri, in Sam. 1636 
= A.D. 1579. 

RORI Cat. VI 23824. 17ff. (f. 9 repeated). Copied by 
Manna, the pupil of Jayasaubhajha Gani, in Sarn. 
1835 = A.D. 1778. 

Pattan II 6760. 6ff. 

RORI Cat. IX 30028 (19). Ff. 224-255. Copied by 
Lak^micanda and Megharaja, the pupil of 
Bhanulabdhi, at Vatapada. 

JAYASARA (fl. 1816) 

Author at Jesalamera of a Karttikapurnima- 
vyakhyana in Sarn. 1873 = a.d. 1816. Manuscripts: 

RORI (Bikaner) 16050. Ff. 8 and 10-12. Copied by 
Godhu Muni in Sarn. 1896 = A.D. 1839. 

RORI (Bikaner) 14811. Ff. 48-52. 

RORI (Bikaner) 16766. 4ff. 


JAYASIMHA 

Alleged author of a Vratarka\ this is perhaps a 
part of the Jayasimhakalpadruma of Ratnakara {fl. 
ca. 1725). Manuscript: 

Benares (1953) 8806. Ff. 1-72. 


* JAYASIMHA (fl. ca. 1400) 

Additional manuscripts of his Jayamddhavamdna- 
sollasa (see CESS A 4, 96a-97b): 

RORI Cat. IV 20584. 500ff. (ff. 1-157, 159-215, 
219-221, 278-282, 296-297, 303-306, 337-348, 
and 411-412 missing). Copied by Asadhara, the 
son of Jayakr§na Bhata of the Nagarajnati, for 
Mahantapidasa, the son of Bala, the son of Gaga, 
the son of Soma, the son of Narmada of the 
Disavalajnati, a resident of Rajanagara, on Sun¬ 


day 1 suklapak§a of Magha in Sam. 1616 = 28 
January 1560. 

*BORI 241 of A 1881/82 = BORI (Dharma) 458. 
203ff. Copied on Monday 14 suklapak§a of Jye§- 
tha in A§aglhadi Sarn. 1827, Saka 1673 (read 
1693) = 27 May 1771. 

Jaipur (Dharma) 90. Ff. 1-3 and 12-440. Incom¬ 
plete. 


^SAVAI JAYASIMHA (1686/1743) 

On this author see also W. A. Blanpied [A5. 
1974]; E. G. Forbes [A5. 1982]; F. D. Giordano [A5. 
1973]; S. A. Khan Gori [A5. 1980]; I. Habib [A5. 
1977]; L. Kumar [A5. 1981]; R. Mercier [A5. 1984]; 
G. P. Pilania [A5. 1981]; D. Pingree [A5. 1978]; and 
[A5. 1987a]; S. R. Sarma [A5. 1985]; M. L. Sharma 
[A5. 1982]; V. N. Sharma [A5. 1982a]; [A5. 1982b]; 
[A5. 1984]; and [A5. 1987]; and P. Singh [A5. 1978]. 

1. Additional manuscript of his Jayavinodasdrinl 
(see CESS A 3, 63a, and A 4, 97b): 

RORI Cat. IX 28484. 39ff. Copied by Jagannatha in 
Sarn. 1953 = a.d. 1896. 

2. Additional manuscripts of his Yantmrajaracana 
(see CESS A 3, 63b-64a, and A 4, 97b): 

RORI (Jaipur) IV 73. 13ff. Copied in Sarn. 1943 = 
A.D. 1886. No author mentioned. 

*Poleman 4715 (Columbia, Smith Indie 73). Ff. 
1-35. Alleged to have been copied by a priest in 
the court of the Maharaja of Jayapura. Purchased 
by D. E. Smith from a Pandita “Joshti” at Jaya¬ 
pura on Christmas 1907. 

*Poleman 4891 (Columbia, Smith Indie 168). Ff. 
1-3. Incomplete (ends on p. 5, line 3, of the RPG 
ed.). 

RORI Cat. VI 24837. 19ff. 

RORI (Udaipur) 6472. 13ff. 

Udaipur RVSS 535. llff. Incomplete. 

3. Jayasimha also wrote a Pahcdhgddhikara. Manu¬ 
script: 

RORI Cat. IX 28621. 27ff. Copied by Govindarama 
at Jayanagara on Thursday 2 suklapak§a of Vai- 
sakha in Sarn. 1848 = 5 May 1791 during the 
reign of Savai Pratapasirnha, who ruled Jayapura 
from 1778 till 1803. 


118 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The colophon begins: iti srisavaijayasimhadevp- 
viracite. 

4. There is ascribed to him a Savaijayasitnhanije^la- 
rahasyajhana (= Mije^ {arahasyajhanal). Manuscript: 

RORI Cat. VI 24800. Ff. 2-7. Incomplete. 

5. Finally, in his name was written a Yantraprakara\ 
see S. R. Sarma [A5. 1985]. Manuscripts: 

Jaipur Museum 31. Pp. 1-53. 

RORI (Udaipur) 3156. 31ff. Incomplete. 

This was edited from these two manuscripts with 
an English translation and commentary by S. R. 
Sarma, New Delhi 1986/87. 

JASAVANTASAGARA (?) 

Author of a Bhramanabljagrantha. Manuscript: 

RORI (Chittorgarh) 5215. If. Copied in Sarn. 1752 
= A.D. 1695. Said possibly to be the autograph of 
the author. 


VASAVIJAYA 

Additional manuscript of his Rajasthani 
Balavabodha on Dharmagho^a’s Lokandlikddvd- 
trimsikd (see CESS A 4, 97b): 

RORI (Jaipur) 5680. 9ff. Copied in Sam. 1879 = 
A.D. 1822. 


JAN MUHAMMAD IBN MAHMUD KHAN (Ji. ca. 
1830) 

Author of a Majma al-fawd’id under Ranjit 
Singh, who ruled in the Panjab from 1792 till 1839. 
See C. A. Storey, Persian Literature, vol. 2, part 3, 
London 1977, p. 373. 

VINADASA 

Additional manuscript of his tika—here called 
paryaya—on the Ksetrasamdsa of Ratnasekhara (see 
CESS A 3, 65a): 

RORI (Bikaner) 13295. 38ff. Copied at Nagora in 


Sam. 1928 = A.D. 1871. 


VINAPRABHA SURI 

Additional manuscripts of his Navagrahagar- 
bhitapdrsvandthastotra (see CESS A 3, 65b, and A 4, 
98a): 

Pattan II 9741 (7). F. 3. Copied in Sam. 1499 = A.D. 

1442. No author mentioned. 

RORI (Jaipur) 6507. If. Copied by Sukhanidhana 
Gani at Amarasara in Sarn. 1652 = A.D. 1595. 
With a curni. 

Pattan II 12176. If. Copied in Sarn. 1671 = A.D. 
1614. With an avacuri. 

Pattan II 14074. 2ff. Copied in Sarn. 1860 = A.D. 
1803. With a Gujarati Bdldvabodha. No author 
mentioned. 

Panjab JB I 1388 (Zira 573). 2ff. Copied in Sarn. 

1939 = A.D. 1882. (Navagrahastotra(lkd). 

Panjab JB I 1386 (Nakodar 211). 33ff. No author 
mentioned. 

Pattan II 12174. If. With an avacuri. 

Pattan II 12175. If. With an avacuri. 

Pattan II 12177. If. With a Gujarati stabaka. 

RORI Cat. IX 29063 (33). F. 145. 

RORI (Jaipur) 5831 (6). F. 18. 

RORI (Jaipur) 6078 (2). If. 

RORI (Jaipur) 7009 (20). Ff. 60-61. Copied by 
Paridita Sadananda. 


VINABHADRA GANI (fl. 609) 

Additional manuscripts of his Ksetrasamdsa (see 
CESS A 3, 65b-66b, and A 4, 98a-98b; see also R. 
C. Gupta [A5. 1985]): 

Cambay II 150. Ff. 2-245. Copied at the 
Bijapuriyasravakapau§adhasala on Thursday 3 
suklapak§a of Vaisakha in Sarn. 1287 = 18 April 
1230. With the tika of Malayagiri. 

Cambay I 88 (4). Ff. 60-93. Copied by Amala at 
Vijapura on Thursday 1 kr§napak§a of Magha in 
Sarn. 1290 (the date is irregular). 

Pattan II 6961. llff. Copied in Sarn. 1478 = A.D. 

1421. 

Pattan II 10438. 12ff. Copied in Sarn. 1479 = A.D. 

1422. (Brhatsahgrahanl). 

RORI (Bikaner) 13265. 86ff. Copied by Kolha, the 
son of Detha, a r esident of Talapatakapura and a 
member of the Ukesavarnsa, for Santiratna, the 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


119 


pupil of Kirtiratna, in Sam. 1484 = a.d. 1427. 
With the fika of Malayagiri. 

Leningrad (1918) 186. 57ff. Copied for Jnanaharnsa 
Gani, the pupil of Jinavardhana Suri of the Kha- 
rataragaccha, at Devakulapafakanagara on Tues¬ 
day 14 suklapak§a of Magha in Sam. 1486 = 7 
February 1430. With the fika of Malayagiri. 

Rattan II 4272. 142ff. Copied in Sam. 1506 = a.d. 
1449. With the tika of Malayagiri. 

Rattan II 7380. 45ff. Copied in Sarn. 1599 = a.d. 
1542. 

AS Bengal XIII 274 (G. 2541). 129ff. Copied on 
Monday 16 kr§napak§a of Rau§a in Sarn. 1679 = 
20 January 1623. With the fika of Malayagiri. 

WHMRL 178. Ff. 1-13. Copied on Sunday 6 
kr§napak§a of Bhadrapada in Sam. 1760 = 5 
September 1703. Incomplete (190 verses). 

Gottingen I 134. 139ff. Copied at Udayapura on Fri¬ 
day 13 kr§napak§a of Vaisakha in Sarn. 1855 = 
31 May 1799. With the tIka of Malayagiri. 
(Brhatsahgrahanl). Rresented by R. G. Bhandar- 
kar in 1887. 

RORI Cat. V 23334. 215ff. (ff. 1-3 missing). Copied 
by Ratoni Vyasa in Sam. 1900 = A.D. 1843. With 
the tika of Malayagiri. Incomplete. 

Rattan II 1386. 182ff. Copied in Sam. 1956 = a.d. 
1899. With the tika of Malayagiri. 

Rattan II 3342. 70ff. Copied in Sarn. 1958 = a.d. 
1901. With the tika of Siddha Suri. 

BORI 336 of A 1882/83. 102ff. (Brhatsahgrahanl). 
With the tika of Malayagiri. 

Cambay II 129 (4). Ff. 159-190. (Brhatsahgrahanl). 

Cambay II 141 (1). 65ff. (Brhatsahgrahanl). 

LDI (KS) 510 (11044). 13ff. (Brhatsahgrahanl). 
With an avacuri. 

Rattan II 1113. 17ff. (Brhatsahgrahanl). 

Rattan II 1114. 102ff. With the tika of Malayagiri. 

Rattan II 1115. 62ff. With the vrtti of Salibhadra. 

Rattan II 1153. 19ff. 

Rattan II 1154. 2Iff. 

Rattan II 3349. 33ff. With the vrtti of Ananda Suri. 

Rattan II 3579. 26ff. 

Rattan II 4004. 38ff. 

Rattan II 6730. 60ff. With the vrtti of Siddha Suri. 

Rattan II 7615. 14ff. 

Rattan II 10356. 75ff. (Brhatsahgrahanl). With the 
tika of Malayagiri. 

RORI (Chittorgarh) 3611. 164ff. (ff. 55 and 155 
missing). Copied by Punyapradhana at Vikrama- 
mahanagara. With the tika of Malayagiri. Incom¬ 
plete. 

RORI (Jaipur) 7867. 2ff. With a tika. Incomplete. 

WHMRL G.lO.e. Ff. 1-8. Incomplete (185 verses). 


WHMRL G.lO.i. Ff. 1-9. With a bha^atika. Incom¬ 
plete (189 verses). 

WHMRL G. 15.a.II. Ff. 5v-10. Incomplete (109 
verses). 

WHMRL G.27.C. Ff. 1-4. Copied for Sravika$asi. 
Incomplete (109 verses). 

WHMRL G.32.a. Ff. 1-10. With a vernacular gloss. 
Incomplete (ends in verse 129). 

The Brhatsahghayatil or Trailokyadlpika in 500 
gathas was edited by Manacanda Velacanda Jha at 
Surata in Vira Sarn. 2432, Vikrama Sarn. 1972 = 
A.D. 1915. 


JINAVALLABHA SURI 

Author of a Prasnavall. Manuscript: 
Nagaur 1009. 14ff. 


VINAVIJAYA (/?. 1715) 

Additional manuscript of his Gujarati tika on 
the Jlvabhigamasutra (see CESS A 4, 98b): 

Rattan II 12916. 340ff. Copied in Sam. 1894 = a.d. 
1837. 


JINENDRASAGARA 

Author of a Pausadasamlvyakhyana. Manu¬ 
scripts: 

RORI (Bikaner) 14843. Ff. 3-6. Copied by Madana- 
canda Muni at Balucara in Sarn. 1909 = a.d. 
1852. 

RORI (Bikaner) 16761. 6ff. 


VIVA 

Additional information concerning a manuscript 
of his Prasnasara (see CESS A 3, 67a, and A 4, 
98b): 

RORI (Alwar) 2839 = *Alwar 1862. 5ff. Copied in 
Sam. 1912 = a.d. 1855. 


120 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


JIVADEVA (fl. ca. 1700) 

The son of Apadeva, Jivadeva is sometimes 
called the author of the Asaucadldhiti of his 
brother, Anantadeva (fl. ca. 1675). 

VIVANATHA 

Additional manuscripts of his Pavanavijaya (see 
CESS A 3, 67b) or Svarodaya (see CESS A 3, 68a, 
and A 4, 98b-99a): 

*Oxford 793 (Walker 213b). Ff. 6-15. Copied by 
Pitambara, the son of Sivadasa Bhata, for Hari- 
srama Bhafa on Monday 8 kr^napaksa of A§a- 
dha in Sarn. 1697, Saka 1562 = 19 July 1641. 
Jaipur (Khasmohor) 2546. 

LDI (VDS) 1325 (9448) = *LDI (DSC) 9448. 4ff. 
Pattan II 12799. 8ff. 

RORI (Jaipur) 7188 (2). Ff. 2-5. 

VlVANATHA SARMAN JHA (fl. ca. 1844/1900) 

Jivanatha Sarman, the author of a Janma- 
patrikavidhana (see CESS A 3, 68a-68b), is identical 
with Jivanatha Jha (fl. ca. 1844/1900). 

1. Additional information concerning a manuscript 
of his Tajikadarpana (see CESS A 3, 68b, and A 4, 
99a): 

Oxford CSS I 376 (*d. 852 (6)). Ff. 2-16, 1-7, and 
17-43. Copied in Sarn. 1933 = a.d. 1876. Incom¬ 
plete (begins in 1, 5). 

2. Additional manuscripts of his Bhavakutiihala (see 
CESS A 3, 68b-69a, and A 4, 99a): 

GJRI 8556/781. Ff. 1-61. Copied in Saka 1799 = 
A.D. 1877. 

GJRI 8557/782. Ff. 1-15. Maithili. Copied on 13 
suklapaksa of Pau$a in Saka 1810 = ca. 14 Janu¬ 
ary 1889. 

The Bhavakutiihala was published with the Hindi 
tika of Mahidhara Sarman at Kalyana-Bambai in 
Sam. 1987, Saka 1852 = a.d. 1930. 

4. The Prasnabhusana (see CESS A 3, 69a) was pub¬ 
lished with his own Sarpskrta, Jyotih, and Hindi, 
Uttara, tikas by Ramacandra Pathaka as KSS 258, 
Varanasi 1988. 


5. Additional manuscript of his Vanamdla (see CESS 
A 3, 69a): 

GJRI 8662/887. Ff. 1-8. Maithili. Copied in Saka 
1778 = A.D. 1856. 

6 . Additional manuscript of his Bhdvaprakasa (see 
CESS A 3, 69b-70a): 

RORI (Udaipur) 5535. 14ff. Incomplete. 

The Bhdvaprakasa was edited by Sitarama Jha 
with his Hindi fika, Sarala, as MM 36, Banarasa 
1953. From the granthakaraparicaya printed on p. 
92 it is clear that Jivanatha completed the Bhdvapra- 
kdsa on 17 February 1845 after he had written: (1) 
the Tajikadarpana’, (3) the Paras art vdsand’, (2) the 
Bhavakutiihala’, a Klldlayogdvali; (9) the udaharana 
on the Bijaganita’, the Janmapatrlvidhdna previ¬ 
ously ascribed to Jivanatha Sarman; a Dlk^dvidhi’, 
and (8) the Vdsturatndvali (the date given in CESS 
A 3 is evidently incorrect). The granthakaraparicaya 
is: 

gandakya api pascime suranaditirottare sarvatah 
srimatsvarnapure vararn hariharak§etrarn cakasti 
k§itau // 

vartete jagatarn pati hariharau yatraiva muktipradau 
turnarn yatra matangapuhgavasamuddharo ’pi jatah 
pura //I// 

tasmat pataliputranamanagararn krosatrayabhyan- 
tare 

cancatsaudhakadambakovidadharadh i savrtarn 
sarvatah // 

tatrastho ’labaraksitisavibudho nilambaro golavit 
tajjye§thah pitrlabdhabodhanikarah srijivanathah 
krti HIH 

krtva tajikadarpanarn prathamatah parasariva- 
sanarn 

ramyarn bhavakutuhalarn ca paratah kilalayoga- 
valim // 

bijodaharanam tato ’pi janu§ah patrividhanarn tato 
dik§ayas ca vidhirn manor api tatah srivasturatna- 
valim 112)11 

sake tarkanandagavisvambharabhi- 
mite maghamase valak§e dasamyam // 
vidhor vasare so ’pi bhavaprakasarn 
mude kovidanam imarn samcakara //4// 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


121 


VlVAVlJAYA GAN I (/?. 1713) 

Additional manuscripts of his Jambudvtpa- 
prajnaptiiabd (see CESS A 3, 70a, and A 4, 
99a-99b): 

Rattan II 256. 343ff. Copied in Sam. 1784 = a.d. 
1727. 

BM Or. 13609. Copied at Surat in Sarn. 1850 = a.d. 
1793. Incomplete. 

Rattan II 13044. 312ff. Copied in Sarn. 1890 = a.d. 
1833. 

BORI 726 of 1899/1915 = BORI (Agama) 242. 
140ff. Ascribed to Jivavi. 

Jivavijaya also wrote a Gujarati stabaka on the 
Sahgrahanl of Sricandra (/?. ca. 1150). Manuscript: 

Rattan II 5135. 55ff. Copied in Sarn. 1927 = a.d. 
1870. 


JIVANANDA 

Alleged author of a Nirnaydmrta, perhaps identi¬ 
cal with Alladanatha. Manuscript: 

BHU C.4761. 186ff. Sarada. 


JETASI 

Author of a Llldvanbhdsa in Vrajabha§a. Manu¬ 
script: 

Rattan II 14437. 17ff. Copied in Sarn. 1872 = a.d. 
1815. 


JAINACANDRA 

The pupil of Sagaracandra, Jainacandra wrote a 
Jdtakaratnakosa. Manuscripts: 

RORI Cat. IV 19625. 13ff. Copied in Sam. 1874 = 
A.D. 1817. 

RORI Cat. VIII 28044. 12ff. Copied by Runyabhakti 
at Amarasara in Sam. 1893 = a.d. 1836. 

RORI Cat. IV 20985. 13ff. 


VAIMINI 

Additional manuscripts of his Upadesasutra (see 

CESS A 3, 71a-74a, and A 4, 99b): 

RORI Cat. XVI 36087. 11 Off. Copied at Jayapura in 
Sarn. 1820 = a.d. 1763. With the tika of Bala- 
kr^nananda Sarasvati. 

Oxford CSS I 305 (d. 779 (4)). Ff. 1-63. Copied in 
Sam. 1869 = a.d. 1812. With the tika of 
Nilakantha. Incomplete (adhyayas 1-2). 

RORI (Alwar) 5716. 53ff. Copied by Devadatta in 
Sarn. 1906 = a.d. 1849. With the tika of Veh- 
katesa. Incomplete (adhyayas 1-2). 

RORI Cat. IV 18962. 32ff. Copied in Sam. 1912 = 
A.D. 1855. With the tika of Nilakantha. 

RORI Cat. IV 21959. 9ff. Copied by Balananda, the 
son of Narayana, at Tonka in Sarn. 1912 = a.d. 
1855. With a chaya. Incomplete (adhyayas 1-2). 
Continued in RORI 21960. 

RORI (Alwar) 2718. 231ff. Copied in Sam. 1912 = 
A.D. 1855. With the tika of Kr^nananda Saras¬ 
vati. 

RORI (Alwar) 2720. 12ff. Copied in Sam. 1912 = 
A.D. 1855. Incomplete (adhyayas 3-4). 

RORI Cat. VII 26096. lOff. Copied by Ratirama in 
Sam. 1932 = a.d. 1875. 

WHMRL ^ 629. Ff. 1-24. Copied at Sitalasthana on 
11 suklapaksa of Jyestha in Sarn. 1946 = ca. 10 
June 1889. With an anonymous tika. Incomplete 
(adhyayas 3-4). 

AS Bengal III.E.259. 

Bhubaneswar IV 12 (Jy/19c). 18ff."Oriya. Incomplete 
(to adhyaya 4). From Ranapur, Ruri District. 

Kathmandu (1965) 21 (2825). 8ff. Incomplete. 

Kathmandu (1965) 22 (2827). 63ff. With the tika of 
Nilakantha. Incomplete (ends with 2, 4). 

Kathmandu (1965) 23 (2826). 123ff. With the tika 
of Kr§nananda Sarasvati. Incomplete (ends with 
3, 2).' 

Kathmandu (1965) 24 (7162). 9ff. With the tika of 
Krsnananda Sarasvati. Incomplete. 

Kathmandu (1965) 25 (2822). 51ff. With a tika. 
Incomplete. 

Kathmandu (1965) 26 (2824). 6ff. With the tika of 
Malayavarman. Incomplete. 

Kathmandu (1965) 27 (2833). 42ff. With the tika of 
Krsnananda Sarasvati. Incomplete. 

Mysore (1905) 606. Rp. 108-123. Telugu. 

Mysore ORI B. 144/1. Ff. 1-6. Telugu. 

Mysore ORI B.573/1. Ff. 1-44; and 1-13. Telugu. 

Mysore ORI B.594/1. Ff. 1-46. Kannada. Incom¬ 
plete. 

Mysore ORI B.994. Ff. 1-104. Kannada. Incomplete. 


122 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI C.3862/1. Ff. 1-36. Incomplete (adhya- 
yas 1-2). 

Mysore ORI P.1821/2. Ff. 15-16. Nandinagari. 
Incomplete (to 1, 4). 

Mysore ORI P.2606/1. Ff. 1-48. Grantha. 

Mysore ORI P.2621. Ff. 1-39. Telugu. Incomplete. 

Mysore ORI *P.2688/1. Ff. 1-4. Telugu. 

Mysore ORI *P.3738/3. Ff. 30-33. Telugu. Incom¬ 
plete (to ayurdaya). 

Mysore ORI P.3745/1. Ff. 1-37. Telugu. Incomplete 
(adhyayas 1-2). 

Mysore ORI P.3771/8. Ff. 83-91. Grantha. 

Mysore ORI P.4480/36. Ff. 84-96. Nandinagari. 
Incomplete (to pMa 2 of ayurdaya). 

Mysore ORI *P.4542/7. Ff. 1-7. Telugu. 

Mysore ORI P.4542/13. Ff. 13-32. Telugu. 

Mysore ORI P.4639/1. Ff. 1-25. Nandinagari. 

Mysore ORI P.5651/2. Ff. 31-35. Nandinagari. 

Mysore ORI P.5654/9a. Ff. 1-79. Nandinagari. 

Mysore ORI P.5654/10. Ff. 1-10. Nandinagari. 

Mysore ORI P.6761/34. Ff. 226-227. Kannada. 

Mysore ORI P.7463/2. 68ff. Grantha. Incomplete 
(sutras 1-31). 

Mysore ORI P.7463/4. 40ff. Grantha. Incomplete 
(padas 1-2). 

Mysore ORI P.8001. Ff. 1-49. Nandinagari. Incom¬ 
plete (padas 1-2). 

Mysore ORI P.8860/3. Ff.1-30. Kannada. Incomplete 
(padas 1-3). 

Mysore ORI P.9526/2. Ff. 1-55. Grantha. 

PrSB 2918 (Gottingen, Sanscr. Madh. 2). 48ff. With 
the tika of Nilakanfha. 

PrSB 2919 (Berlin or. 6315). Ff. 79-80v. Grantha. 
Incomplete (1, 1-2). 

PrSB 3580 (Berlin or. fol. 2707). 53ff. With the tika 
of Balakr^nananda Sarasvati. Incomplete (1, 3, 
1-2, 4, 28). 

RORI Cat. IV 18611. llff. 

RORI Cat. IV 18612. 30ff. With the tika of 
Nilakantha. 

RORI Cat. IV 21960. 7ff. Copied by Balananda, the 
son of Narayana. Incomplete (adhyayas 3-4). A 
continuation of RORI 21959. 

RORI Cat. XVI 36638. 21ff. With the Oka of 
Nilakantha. 

RORI (Alwar) 2719. 56ff. With the tika of Veii- 
katesa. 

RORI (Alwar) 2721. 12ff. 

RORI (Alwar) 2722. 14ff. With a fika. Incomplete. 

RORI (Alwar) 2723. 39ff. With the tika of 
Nilakantha. Incomplete. 

RORI (Jaipur) 2644. 37ff. (f. 1 missing). With a 
tika. Incomplete (adhyaya 2). 


RORI (Jaipur) 9235. 7ff. With the tika of Bala- 
kr§nananda Sarasvati. Incomplete. 

RORI (Jaipur) 10821. 3ff. Incomplete. 

RORI (Jaipur) 10868. 90ff. (ff. 1-30 missing). With 
the tika of Balakr§nananda Sarasvati. Incom¬ 
plete (ends in adhyaya 3). 

RORI (Jaipur) 11142. lOff. Incomplete. 

Udaipur RVSS 1712. 2ff. Incomplete. 

Visvabharati (Adyar) 1057 (a). 28ff. Nandinagari. 
With a Kannada tika. 

Visvabharati (Adyar) 1057 (b). llff. Nandinagari. 

Incomplete (adhyayas 1-2). 

WHMRL a 1388. 2ff. With a tika. Incomplete (1, 5, 
1-1, 5, 6). 

WHMRL /3 640 = *WHMRL 1.68. Ff. 1-4 and 6 
(text continuous). With a tika. Incomplete (3, 1, 
1-3, 2, 5). 

The edition published as HSS 159 appeared in a 
4th ed., Varanasi 1986; the edition with the Hindi 
tika of Kasirama Pathaka was reprinted at Bambai 
in 1987; and it was published with the Sarnskrta and 
Hindi tika of La§analala Jha as Harajivanadasa SG 
37, Varanasi 1986. 


JAIMINI 

Alleged author of a Jhdnapradipika on prasna in 
27 adhyayas. This was translated into English with 
notes by S. Kannan, Jaimini’s Gnanapradeepika, 
reprinted New Delhi 1986. 

VNANADEVA 

Additional manuscript of his Ndrayanasakuna- 
vali (see CESS A 3, 74b): 

Vrndavana 9282. 6ff. 


VNANARAJA (fl. 1503) 

Additional manuscripts of his Sidddntasundara 
(see CESS A 3, 75a-76b, and A 4, 100a): 

RORI Cat. XVI 37247. 24ff. Copied in Sam. 1843 = 
A.D. 1786. 

RORI (Alwar) 2620. 66ff. Copied in Sam. 1902 = 
A.D. 1845. 

GJRI 8745/970. Ff. 1-12. Maithili. 

Jaipur (Khasmohor) 5591. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


123 


Oxford CSS I 21 (*d. 805 (5)). Ff. < 1> and 2-18. 

Incomplete (gola, ending in 6, 26). 

RORI (Alwar) 2621. 25ff. Incomplete. 


VNANAVIMALA SURI 

Additional manuscripts of his Pandara Tithini 
Thoyo (see CESS A 3, 76b): 

Rattan II 5372. 9ff. Copied in Sam. 1945 = a.D. 

1888. (Bdratithiyomsajjhaya). 

Rattan II 6050. 8ff. Copied in Sarn. 1945 = a.d. 
1888. 

Rattan II 6051. 7ff. Copied in Sarn. 1946 = a.d. 

1889. 

Rattan II 5836. 6ff. 

Rattan II 5837. 6ff. 

Rattan II 6052. 8ff. 


JNANASAGARA SURI 

Author of an avacuri on the Lokanalika- 
dvdtrimsikd of Dharmagho§a. Manuscript: 

RORI (Bikaner) 13600. 4ff. Copied by Vivekacan- 
dra. 


^'JNANASAGARA {fl. 1408) 

Additional manuscript of his K^etrasamdsavacurni 
(see CESS A 3, 76b, and A 4, 100a): 

RORI Cat. IV 19394. 37ff. (ff. 1-14 missing). Cop¬ 
ied at Mafigalapura in Saura§tra in Sarn. 1666 = 
A.D. 1609. 

VYOTIRAJA (fl. 1382) 

Additional manuscripts of his Jyotirdjakarana (see 
CESS A 3, 77a): 

Kathmandu (1965) 30 (699). 27ff. Copied by Malla- 
varman on Tuesday 10/11 suklapak^a of Bhadra- 
pada in NS 543 = 17 August 1423 during the 
reign of Jayajyotirmalladeva (ca. 1409/1428). 
Kathmandu (1965) 29 (524). No ff. given. Follows 
the Jyotirnibandha of Sivaraja. Incomplete (surya- 
candragrahaiia). 


VVALAPRASADA MISRA (fl. 1953/1987) 

A resident of Muradabada near Ramagafiga, Jva- 
laprasada (see CESS A 3, 77b; see also A 4, 
100a-100b) wrote a Hindi fika on the Svapnakama- 
Idkara of Srldhara. This was published as an appen¬ 
dix to the Vasantardjasdkuna, Mumbayi 1987, pp. 
521-560. 


*TOPARAMALLA (fl. 1565/1589) 

5. Manuscript of his Vdstusaukhya (see CESS A 4, 
100b): 

N-W R IX (1885) Vastusastra 1. 33ff. Rroperty of 
Randita Syamacarana of Benares. 

18. Additional manuscript of his Vyavahdrasaukhya 
(see CESS A 4, lOla-lOlb): 

Benares (1956) 13966. Ff. 1-89. 

22. Additional manuscripts of his Ayurvedasaukhya 
(see CESS A 4, 101b): 

RORI (Alwar) 2527 = *Alwar 1633. 139ff. Copied 
in Sarn. 1913 = a.d. 1856. 

BHU (ayurveda) 21 (C 4513). 95ff. Incomplete. 

Some chapters of the Ayurvedasaukhya have been 
published and translated into English by Bhagwan 
Dash and Lalitesh Kashyap: vol. 1, New Delhi 1980 
(adhyayas 90-97); vol 2, New Delhi 1980 (adhyayas 
1-6); vol. 3, New Delhi 1981 (adhyayas 13-16); vol. 
4, New Delhi 1982 (adhyayas 17a-18a, <19>, 
17b-18b, 20a, 20b, and 21-22); vol. 5, New Delhi 
1984 (adhyayas 23-35a and 35b); and vol. 6, New 
Delhi 1987 (adhyayas 36, 38-39a, and 39b-53). The 
editors mention the following manuscripts: 

AS Bengal. 416ff. Incomplete (adhyayas 8-11, 
16-21, 23, 25-32, 34-74, and 76-89). 

Calcutta Sanskrit College. 78ff. Incomplete (adhya¬ 
yas 13-18). 

Copy of Kathmandu. No ff. given. Incomplete (adh¬ 
yayas 1-8, 13-57, 68-75, 77-79, 81-90, and 
92-96). 

Varaiiasi. No ff. given. Incomplete (adhyayas 1-10, 
12-14, 16-20, 22-43, 45-74, 76-79, and 81-97). 
Raiidita Siva Sarman. 545ff. Copied by Dayaludasa, 
the son of Harivamsa, a Kayastha. Incomplete 
(adhyayas 76, 86, and 90 missing). Formerly 


124 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


property of Pandita Ramaprasada Sarman of 
Patiala. 

Pant^ita Siva Sarman. No ff. given. Incomplete (adh- 
yayas 1-40). 

Additional manuscripts containing unspecified 
portions of his Todarananda (see CESS A 3, 
179b-180a, and A 4, 102a): 

*Jammu 2572. 17ff. Copied in Sarn. 1864 = a.d. 
1807. 

Jaipur (Khasmohor) 2330; 5363 (copied in Sam. 
1728 = A.D. 1671); and 6367. 


*mAKKURA PHERU (fl. 1315/1318) 

Concerning this author (see CESS A 3, 78a-78b, 
and A 4, 102a) see also S. R. Sarma [A5. 1986/87]: 

1. His Ratnapanksd (see CESS A 3, 78a) was edited 
with Sanskrit and English translations and a com¬ 
mentary by S. R. Sarma [A5. 1984]. 

6. Manuscripts of his Vdstusdra (see CESS A 3, 78b): 

RORI Cat. IV 19901 (1). Ff. 1-8. Copied in Sam. 
1829 = A.D. 1772. 

Baroda 3021 (a). 7ff. Copied in Sam. 1940 = a.d. 
1883. 

LDI 6391 (2244). 2ff. Copied in Sam. 1970 = a.d. 

1913. Incomplete (bimbaparik§a). 

LDI 6390 (8392/1). Ff. lv-2v. Copied in Sam. 1992 
= A.D. 1935. Incomplete (bimbaparik§a). 
Rajputana, p. 38. At Udaipur. 

RORI Cat. Ill 17307. 2ff. 

RORI Cat. IX 29040. 7ff. Copied at CitrakOfa. 

RORI Cat. XVI 34053 (1). If. Incomplete (prasada- 
sthapana). 


^DHVNDHIRAJA 

Additional manuscript of his Vyavahdraprakdsikd 
(see CESS A 3, 79a, and A 4, 102a): 

Vrndavana 8735. 23ff. Copied in Sarn. 1825 = a.d. 
1768. 


*DHUNDIRAJA {fl. ca. 1525) 

Additional manuscripts of his Jdtakdbharana (see 

CESS A 3, 79b-84b, and A 4, 102a-103a): 

RORI Cat. IV 20733. 81ff. (ff. 35-38 and 53-59 
missing). Copied at Ahamadabada in Sarn. 1701 
= A.D. 1644. 

Jaipur (Khasmohor) 5470. Copied in Sarn. 1725 = 
A.D. 1668. 

Oxford (Vyasa) 136. Ff. 1-78. Copied by Ranachoda, 
the son of Vasudeva, the son of Sripatamegha, 
the son of Maka, the son of Vena Vyasa of the 
Udicyajnati, a resident of Lagatera, on Tuesday 6 
suklapak^a of Phalguna in Sam. 1733, Saka 1598 
= 27 February 1677. Formerly property of 
Mulaji Sankara Vyasa. 

RORI (Udaipur) 520. 90ff. (ff. 21/22 one leaf). Cop¬ 
ied by Gahgarama Kasidasa Dube in Sam. 1740 
= A.D. 1683. 

Rattan II 13281. 11 Iff. Copied in Sam. 1742 = a.d. 
1685. 

RORI (Bikaner) 15916. 60ff. Copied by Ramacandra 
at Navahara in Sam. 1744 = a.d. 1687. 

RORI (Bikaner) 14668. 53ff. Copied by Nemamurti 
at Sojata in Sarn. 1764 = a.d. 1707. 

BM Or. 13779. Copied at Medata in Sam. 1766 = 
A.D. 1709. 

Florence (Add.) 819. Ff. 6-71. Copied by Pandita 
Rupabhadra Muni on 13 kr§napaksa of A§adha 
in Sarn. 1768 = ca. 2 July 1711. Incomplete. 

RORI Cat. IV 21550. 51ff. (ff. 27-28 missing). Cop¬ 
ied at Rabadiyakhagrama in Sam. 1774 = a.d. 
1717. 

RORI Cat. IV 20613. 112ff. (ff. 1-26, 30, and 40 
missing). Copied by Hemacanda, the pupil of 
Mayacanda, in Sarn. 1788 = a.d. 1731. (Janma- 
pampaddhati; perhaps this is the Sujdtaka [see 
CESS A 3, 79b]). 

PrSB 3642 (Berlin or. fol. 2149). Ff. 1-27, 35-109, 
and 111-121. Copied on 10 Karttika in Sarn. 
1791, Saka 1657 = ca. 15 October 1735. For¬ 
merly property of Sukharama. 

RORI Cat. VI 23881. 97ff. (f. 47 repeated). Copied 
by Jayasagara in Sam. 1798 = a.d. 1741. 

RORI Cat. IV 20808. 14ff. Copied in Sam. 1809 = 
A.D. 1752. 

AS Bengal 7018 (G. 7521) IV. Ff. 18-? Copied at 
Makasudavada on 4 kr§napak§a of Pau§a in Sarn. 
1821 = ca. 11 January 1765. Incomplete (stri 
jataka). 

RORI (Jaipur) 8234. 73ff. (ff. 8-21 missing). Copied 
at Jayanagara in Sarn. 1826 = a.d. 1769. Incom¬ 
plete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


125 


RORI Cat. XVI 35458. 46ff. Copied at Badamera in 
Sam. 1827 = a.d. 1770. 

RORI Cat. VII 25498. 83ff. (ff. 9, 11, 41, and 69 
missing; ff. 46 and 56 repeated). Copied in Sarn. 
1840 = A.D. 1783. 

RORI (Alwar) 2727. 97ff. Copied in Sam. 1847 = 
A.D. 1790. Incomplete. 

PrSB 2932 (Gottingen, Sanscr. Sham 44). 62ff. Cop¬ 
ied on Thursday 15 suklapak§a of Margasirsa in 
Sarn. 1856 = 12 December 1799. 

Kathmandu (1965) 13 (5662). 106ff. Copied on 
Thursday 7 suklapak§a of Magha in Sarn. 1874 
= 12 February 1818. 

Kathmandu (1965) 9 (5666). 132ff. Copied on Mon¬ 
day 7 suklapak§a of Pau§a in Sarn. 1884, Saka 
1749 = 24 December 1827. 

RORI (Chittorgarh) 977. 52ff. Copied by Narayaria 
Josi at Toiika in Sarn. 1888 = a.d. 1831. 

RORI Cat. XVI 34724. 105ff. Copied in Sarn. 1891 
= A.D. 1834. 

RORI (Alwar) 6162. 72ff. (f. 1 missing). Copied in 
Sarn. 1897 = A.D. 1840. Incomplete. 

RORI Cat. IV 19707. 149ff. Copied by Balacandra at 
Haridurga in Sarn. 1902 = A.D. 1845. 

RORI (Chittorgarh) 354. 70ff (f. 1 missing). Copied 
by Srinivasa at Bhadravati in Sarn. 1905 = a.d. 
1848. Incomplete. 

RORI Cat. IX 28687. 65ff. Copied by Ramanarayana 
Audicya in Sarn. 1907 = a.d. 1850. 

RORI (Alwar) 2726. 161ff. Copied in Sarn. 1910 = 
A.D. 1853. 

BHU B.469. 51ff. Copied in Sarn. 1917 = A.D. 1860. 
Incomplete. 

Oxford (Vyasa) 135. Ff. 1-12; and ff. 1-11. Copied 
by Ramacandra, the son of Madhavaji, the son of 
Visvanatha Vyasa of the Audicyajnati, at Hala- 
vada on Monday 10 suklapaksa of Pausa in Sarn. 
1920 = 18 January 1864; and on Saturday 4 
kr^riapaksa of Phalguna in Sarn. 1920, Saka 1785 
= 26 March 1864. Variant version; incomplete. 

GJRI 8356/581. Ff. 1-74. Maithili. Copied in Saka 
1793 = A.D. 1871. 

Jammu 61 Ga-1. 6ff. Copied in Sarn. 1990 = a.d. 
1933. No author mentioned. 

AS Bengal I.B.9. Bengali. 

Benares (1963) 34599. Ff. 1-8. Incomplete (panca- 
mahapurusayoganirOpaiia). No author men¬ 
tioned. 

Benares (1963) 34799. Ff. 87-89. Incomplete. No 
author mentioned. 

Benares (1963) 35028. Ff. 1-2, 4-17, 17b-30, 32-34, 
36-43, 52-57, and 59-95. Incomplete. No author 
mentioned. 

Benares (1963) 36788. Ff. 1-12. Incomplete (nirya- 


iiadhyaya). No author mentioned. 

BHU B.37I4. 31ff. Incomplete. 

BHU C.27I. 38ff. Sarada. Incomplete. 

BHU C.2523. 70ff. Incomplete. 

BHU C.2807. 22ff. Incomplete. 

BHU C.3362. 86ff. With a fika. Incomplete. 

BHU C.3407. 14ff. Incomplete. 

BHU C.3565. 141ff. 

BHU C.4538. 79ff. Sarada. 

BHU C.4584. 76ff. Sarada. Alleged to have been 
copied in Sarn. 1553 = a.d. 1496. 

BHU C.4627. 5ff. Sarada. Incomplete. No author 
mentioned. 

Bhubaneswar IV 52 (Jy/22b). 22ff. Oriya. Incom¬ 
plete. From Raiiapur, Puri District. 

Bhubaneswar IV 53 (Jy/59c). 26ff. Oriya. Incom¬ 
plete. From Jagatsirnhapur, Cuttack District. 

GJRI 8355/580. Ff. 1-19. Incomplete (to end of 
bhava 4). 

GJRI 8357/582. Ff. 1-5. Maithili. Incomplete (nir- 
nayadhyaya). 

GJRI 8358/583. Ff. 69-77. Incomplete. 

Jaipur (Khasmohor) 5387. 

Jodhpur 796 (C). 8ff. Incomplete. No author men¬ 
tioned. 

Kathmandu (1965) 8 (5667). 175ff. Nevari. 

Kathmandu (1965) 10 (5665). 56ff. Incomplete. 

Kathmandu (1965) 11 (5664). 36ff. Incomplete. 

Kathmandu (1965) 12 (5663). 134ff. Incomplete. 

Mysore ORI *P.1I10/1. Ff. 1-57. Telugu. 

Mysore ORI P.5535. Ff. 1-243. Telugu. 

Nagaur 975. 46ff. 

NPS (Sanskrit) 7986. 43ff. Incomplete. 

Oxford CSS I 263 (*d. 800 (3)). Ff. 1-28 and 33-96. 
Incomplete (1, 1-15, 49 and 15, 94-24, 62). 

Oxford CSS I 264 (*e. 145 (3)). Ff. 1-5. Incomplete 
(adhyaya 45). 

Oxford CSS I 337 (*d. 770). If., f. 4<8?>, and ff. 
185 and 202-288. Scattered excerpts. 

Pattan II 8854. 30ff. 

Pattan II 10124. 4ff. No author mentioned. 

Pattan II 13144. 68ff. (ff. 34-36 missing). 

*Poona, Mandlik Jyotisha 23. 108ff. 

PrSB 2931 (Gottingen Mu I 84). Ff. 64v-206v. 
Sarada. 

PrSB 2970 (Berlin or. 6349). Ff. 80-85. Grantha. 
Incomplete (sarnvatsaraphala). No author 
mentioned. 

RORI Cat. IV 19100. 58ff. Incomplete. 

RORI Cat. IV 20695. 114ff. (ff. 1-9 and 11-19 miss¬ 
ing). Incomplete. 

RORI Cat. VI 23776. 17ff. Incomplete. 

RORI (Bikaner) 14687. llff.; and 76ff. 

RORI (Chittorgarh) 5046 (b). 9ff. Incomplete. 


126 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 5816. 6ff. Incomplete (rajayoga- 
bhanga; with the rajayoga from Kalyana- var- 
man’s Saravail. 

RORI (Jaipur) 7609. 7ff. (f. 1 missing). Incomplete. 
RORI (Jaipur) 10125. 94ff. (ff. 1-2, 81, and 86 miss¬ 
ing). Incomplete. 

RORI (Jaipur) 11028. 6ff. Incomplete. 

Udaipur RVSS 1710. 20ff. (f. 5 missing). Incom¬ 
plete. No author mentioned. 

Vrndavana 2383. 129ff. Incomplete. 

Vrndavana 2390. 22ff. 

Vrndavana 2405. 35ff. Incomplete. 

Vrndavana 3556. 107ff. Incomplete. 

Vrndavana 7434. 15ff. Incomplete. No author men¬ 
tioned. 

Vrndavana 8444 A. 9ff. Incomplete (grahabhava- 
phalani; incomplete). 

Vrndavana 10276. If. Incomplete (grahadana). 
*WHMRL G.llO.a. Ff. 1-89. 

WHMRL a 808. Ff. 6-10 and 13-26. Incomplete 
(sarnvatsara 29-masa 11 and vara 5-dimba 12). 
WHMRL (3 587 (i). Ff. 1-24. Sarada. Incomplete 
(ends in gurau dr^tiphala 5). 

Wien UB 288 (I 67119). Ff. 1-32 and 34-38. 
Acquired in 1891. 

The Jatakabharana was published at Murnbai in 
1872; with the Hindi fika, Syamasundari, of Sya- 
malala at Bambai in Sarn. 2008, Saka 1873 = a.d. 
1951, repr. at Bambai in 1986; with the Hindi anu- 
vada of Bharatiya Yogi at Bareli in 1981; and with 
the Hindi tika, Tattvarthabodhinl, of Sitarama Jha 
at Varanasi [N. D.]. 

DHUNDHIRAJA SAIVA (fl. ca. 1575) 

The son of Puru§ottama, the son of Ramakr^na, 
and the pupil of Ramapandita, the father of Nanda- 
pandita (fl. ca. 1580/1630), Dhundiraja wrote a 
Kundakalpalata. Manuscripts: 

lO 3167 (2720). Ff. 1-33, 33b-95, and 97-123. Cop¬ 
ied by Sankara Sukla on Monday 6 kr§napak§a of 
Karttika in Sarn. 1818 = 8 November 1762. 
From Colin Mackenzie. 

Benares (1953) 4289. Ff. 1-18 and 22-134. Copied 
in Sarn. 1852 = a.d. 1795. Incomplete. 

CP, Kielhorn XIX 54. 66ff. Copied in Saka 1751 = 
A.D. 1829. Property of Baba Sh. Bhake of Canda. 
Benares (1953) 4288. Ff. 2-60. Copied in Sarn. 1889 
= A.D. 1832. Incomplete. 

AS Bengal I.E.84. 


Kerala 3791 (10193). 125 granthas. Incomplete. 

PUL I Dharma 157. Ff. 1-82, 87-88, and 93-98. 
Incomplete. 

Rajapur 292 and 336. See NCC, vol. 4, p. 177. 

Verses 6-10 at the beginning are: 

a§tadasapi nrtyanti vidya yadradanagratah // 
dharmadhikarinarn ramapanditarn tarn gurum bhaje 

// 6 // 

tattanayarn viditanayam gurukrtavinayarn gunaika- 
sannilayam // 

satruvisr^fapanayam vande srinandapanditarn 
sadayam HIH 

saivanvaye ’bhut sukrtaikasindhuh 
paropakare jagadekabandhah // 
sriramakr§nas tripuraribhakto 
yah sarvada vaidikamargasaktah //8// 
tatputrah puru§ottamah samabhavat 
kavyaprabandhadikrt 

tarkodarkamatih srutismrtivacovici§u vacaspatih // 
srikan thahghrisarojasaktahrdayah saivanvaya- 
mbhoruho- 

dbodhoktesur atita< vak>pathamatir vidvadvare§v 
agranih //9// 

vicarya vividhan granthan dhundhirajas tadatmajah // 
kundakalpalatam etam kurute gunitustaye //lO// 

The next to the last verse is: 

saivena dhundhirajena puru§ottamasununa // 
to§aya vidu§am e§a kundakalpalata krta // 

'^TAMMAYAJVAN 

Tammayajvan is identical with Tammayarya, the 
author of the Grahaganitabhaskara. 

Additional manuscripts of his Kamadogdhrl (see 
CESS A 3, 85a-86a): 

Mysore ORI *P. 1801/1B. Ff. 1-293. Telugu. Copied 
on Wednesday 8 suklapak§a of Pau§a in Saka 
1627 = 12 December 1705. 

Mysore ORI C.4142/2. Ff. 1-145. Nandinagari. 
Mysore ORI *P.3240. Ff. 1-184. Nandinagari. 
Mysore ORI *P.3523/B. Ff. 102-200. Grantha. 
Incomplete. 

Mysore ORI *P.3524/3b. Ff. 1-145. Grantha. Incom¬ 
plete. 

Mysore ORI *P.5267/1. Ff. 1-204. Grantha. 

Mysore ORI P.5900/b. Ff. 1-187. Nandinagari. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


127 


Mysore ORI P.6845/2. Ff. 64-99. Grantha. Incom¬ 
plete. 

Mysore ORI P.6937/b. Ff. 1-152. Grantha. Incom¬ 
plete. 

Mysore ORI P.7381/2. Ff. 1-90; and ff. 1-26. 

Telugu. Incomplete (manadhyaya). 

Paris BN Sans. 1792. 215ff. Grantha. 

Paris BN Sans. 1793. 122ff. Grantha. Incomplete. 
Visvabharati (Adyar) 387 (c). lOff. Grantha. Incom¬ 
plete. Attributed to Timmayajvan. 

Additional manuscripts of his Grahaganita- 
bhaskara (see CESS A 3, 86a): 

Mysore (1905) 774. Pp. 113-120. 

Mysore ORI P.2057/4. Ff. 88-95. Telugu. 

Mysore ORI *P.5165. Ff. 1-6. Grantha. 

Mysore ORI *P.5260. Ff. 1-9. Telugu. 

The second verse is: 

gotre radhitarakhye jananam upagato ponnayaryah 
prasiddhas 

tatputro mallayajva sakalagunaganah sarvasiddha- 
ntavetta // 

tatsunur mallayajva karavimatasadrg granthakarta 
susilas 

tatputras tammayaryo grahaganitam aharn bhaskara- 
khyarn karomi // 

The last verse is: 

sakinipuravastavyamallayajvendusununa // 
vehkatambatanujena tammayaryena dhimata // 
bhaskarakhyah krto grantho dharanyarn 
ciramedhatam // 


^TARKATILAKA {fi. 1613) 

Additional manuscripts of his KalamMhava{ika 
(see CESS A 3, 86a, and A 4, 103b): 

*BORI 264 of 1886/92 = BORI (Dharma) 256. Ff. 
15-69 and 90-92. Copied by Mohana in Sam. 
1677 = A.D. 1620. Incomplete. 

Jaipur (Dharma) 100. Ff. 5-91. Of these, ff. 5-68 
and 80-91 copied by Nandarama at Banahafa on 
Friday 11 suklapak§a of Magha in Sam. 1730 = 
6 February 1674. Incomplete. 

Jaipur (Dharma) 99. 74ff. Copied by Lalacandra 
Misra, the son of Gahgarama Misra, of the Brah- 
manavamsa and the Lalladijhati, on Monday 12 
kr§napak§a of Phalguna in Sam. 1756 = 24 


March 1701. 

RORI Cat. IV 19038. 65ff. Copied by Narayana 
Sevaka at Toiika in Sarp. 1889 = A.D. 1832. 
Rajputana, p. 44. At Bikaner. 

RORI (Udaipur) 5883. Ff. 1-23 and 25-79. Incom¬ 
plete. 


^TARKAVACASPATl BHATTACARYA 

Additional manuscript of his Jyotihsara (see 
CESS A 3, 86a, and A 4, 103b): 

GJRI 8414/639. Ff. 1-18. Maithili. 


* TAN DA VA KA VIRAJ A 

Additional information concerning the manu¬ 
script of his Mitahkavivarana (see CESS A 3, 86b): 

RORI (Alwar) 2679 = *Alwar 1895. 38ff. Copied 
on Wednesday 3 suklapak§a of Phalguna in Sam. 
1879, Saka 1744 = 12 February 1823. 

The first verse is: 

surih srivisvanatho jagadupakrtaye suryasiddhanta- 
sararn 

sahgrhyatiprayatnad akuruta karanarn yan mitahka- 
bhidhanam // 

spa§tikarturn tad etadvivaranasahitam tandavah 
sarnvidhatte 

tal labdhva cankavidyajaladhim iha budha gospadarn 
kalpayantu //!// 


* YELL ALA TIM MAYYA 

His Pahcmgasiromani (see CESS A 3, 87a) is 
based on that of Tripurari {fi. 1627). Additional 
manuscripts: 

Mysore ORI *P.2559/14. Ff. 184-187. Telugu. 

Mysore ORI *P.2575/1. Ff. 1-26. Nandinagari. 
Incomplete. 

Mysore ORI P.5899/la. Ff. 1-12. Nandinagari. 

Incomplete (end of grahakranti). 

Mysore ORI P.8017. Ff. 18-112. Nandinagari and 
Telugu. Incomplete. 

Mysore ORI P.8399/1. Ff. 1-25. Nandinagari. 

Mysore ORI P.8399/3. Ff. 1-4. Nandinagari. Incom¬ 
plete. 


128 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The first three verses are: 

yaccak^uh sarvalokanarn sr^fisthitilayaprabhuh // 
tarn natva bhaskararn vak§ye pahcahganarn 
siromanim //!// 

tripuraribudhenokto yah pancaiigasiromanih // 
kaladhikyat samo na < sti si > ddhantasya vivasvatah 

niH 

tatsadrsyaya vellalatimmayyakhyena yajvana // 
e§a eva sphutataram kathyate surisammatah 11311 

*PAPA TIMMAYYA 

Timmayya was the son of Appayya of the Bhara- 
dvajagotra. His Lak^minrsimhiyaganita (see CESS 
A3, 87a) has 8 adhikaras: madhyagraha, suddha, 
suryagrahana, chayalagna, pata, lipta, bhedya, 
srhgonnati. Additional manuscripts: 

Mysore ORI *P.2568/3. Ff. 1-14. Kannada. 
Visvabharati (Adyar) 733 (a). 16ff. Telugu. 

Verses 3-5 at the beginning are: 

daivajfiesarcitasriman dvijarajasikhamanih // 
bharadvajottamasyasya sarvajno jani sarn x x //3// 
Iak§mi x satkulodarah sarvasiddhantaparagah // 
saumyaseyyah samudabhud x x appayyavid budhah 

//4// 

tatputrah papatimmaryah sarvasiddhantasaravit // 
srimallak§minrsirnhiyagrahatantram karomy aham 

//5// 


^TIMMARAYA 

Additional information concerning the manu¬ 
script of his As (akavarga (see CESS A 4, 103b): 

^Mysore (1905) 549. Pp. 20-32. Telugu. With Kar- 
nataki notes. 

Additional information concerning the manu¬ 
script of his Karnataki tippani on the $a(pancasika 
of Prthuyasas {fl. ca. 575) (see CESS A 4, 103b): 

^Mysore (1905) 549. Pp. 1-19. Telugu. 

Timmaraya also wrote a vyakhya on the Jataka- 
paddhati of §ripati (fl. 1039/1056). Manuscript: 

Mysore ORI P.7368/2. Ff. 1-23. Telugu. Incomplete. 


^TIMMARAYA 

Additional information concerning the manu¬ 
script of his Divdkarapaddhativydkhyd (see CESS A 
3, 87a): 

Mysore ORI *P.2336/2. Ff. 33-76. Grantha. 

The first two verses are: 

adhitya jyauti§am sastram aprameyan mahaguroh // 
tasmad dhoravidarn sre^fhad bharadvajakulod- 
b ha vat // 

triskandhasastrakalasambudhimantharena 
daivajnamattagajakesarina ca fika // 
sritimmarayavidu§a krpaya hares tu 
santanyate mrdudivakarapaddhateh sa // 

TILAKARAJA (fl. 1164) 

A jyoti§ika who witnessed a eulogy composed by 
Sripati for the Cahamana Vigraharaja IV on Thurs¬ 
day 15 suklapak§a of Vaisakha in Sam. 1220 = 9 
April 1164; the inscription was inscribed on the 
Asokan pillar at Khizrabad, whence it was brought 
to Delhi by Firuz Shah (1351-1388). It was most 
recently published by D. C. Sircar, Select Inscrip¬ 
tions, vol. 2, Delhi 1983, pp. 409-411. 

TUPHANI SARM AN (fl. 1879) 

The son of Bhavadeva, the son of Jagannatha, the 
son of Damodara, and the younger brother of 
Govindalala, Mathuranatha Sarman, and Rahgalala, 
Tuphani wrote a Krtyasiromani for Narendra- 
narayanasimha Bahadura, the raja of Baruari in 
Janakapura; he completed it on Wednesday 10 Cai- 
tra of ^aka 1801 = 2 April 1879. This was edited by 
Jayananda Misra as MM 243, Banarasa 1954. At the 
end are the verses: 

Janakapuraputabhedane vare bauariti puro ’tra 
vartate // 

tadadhipanrpavarajhaya tv ayarn krta iti 
krtyasiromanir maya // 
narendranarayanasirnharaya- 
bahadurah srisahitah sa bhupah // 
tasyajnayamum krtavan aharn vai 
sadvikramadityakule sa Jatah // 
damodaramahidevaj jagannathas tu tatsutah // 
bhavadevas tu tatputro lalitas tatsutas ca ye // 
govindalalah prathamah sabdavidyavisaradah // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


129 


mathuranathasarma tatkani§tho daivavidvarah // 
raiigalalas tatkaniyan mohanagramavasinah // 
tatrai§am anujenayam srituphanikasarmana // 


avanikhavasubhumite sake 
madhusitadiktithisaumyavasare // 
vibudhajanasukhaya bhutale 
’racayata krtyasiromanim dvijah // 

TV LAS I BHATTA 

Apparently the name of the author of a Dyucaro- 
daya of which one leaf, numbered 2, is preserved 
between ff. 43 and 44 of a copy of the Aryasapta- 
saTi of Govardhana. The verses in this fragment are 
in part modeled on those of the Karanakutuhala 
composed by Bhaskara (b. 1115) in 1183; and verse 
II 9 refers to Bhaskara’s (Siddhdnia)siromani. The 
Dyucarodaya, then, may have emanated from the 
matha for studying Bhaskara’s works set up at 
Patana in Khandesa. Manuscript: 

lO 4017 (2425). F. 2 (between ff. 43 and 44). 
Incomplete (I 15a-II 12b). From Gaikawar. 

The colophon of I begins: iti sri 5 bhatatulasi- 
krtau. 

^TULASI SADHU 

Additional manuscript of his Tithisodasikd (see 
CESS A 3, 88b): 

Rattan II 9128 (6). Ff. 20-21. (Tithiso4asi of Tula- 
sidasa). 

TRIPURARI DASA 

Author of several astrological works in Oriya. 

1. Keralasutra. Manuscript: 

Bhubaneswar IV 23 (Jy/15b). 21ff. Oriya. Copied in 
Sal San 1311, the 28th aiika of Mukunda III of 
Khurdha = a.d. 1904. Incomplete. From Khur- 
dha, Puri District. 

2. A tika on a Kerallyadasd. Manuscript: 

Bhubaneswar IV 27 (Jy/125). 57ff. Oriya. Incom¬ 
plete. From Midnapur, West Bengal. 


Verse 3 at the beginning is: 

yad bijarn kairale sastre tattikam desabha§aya // 

balakanarn vinodaya tripurarih karomy aham // 

3. Prakrtakerala. Manuscripts: 

Bhubaneswar IV 120 (Jy/104). 45ff. Oriya. Copied 
by Dinabandhu Tiadi Mahajana at Prataparama- 
candrapura on Friday 9 suklapak§a of Phalguna, 
4 Mina, in Sal San 1263, the 3rd ahka of 
Virakesari = 14 March 1856. From Bhubanes¬ 
war, Puri District. 

Bhubaneswar IV 80 (Jy/68). lOff. Oriya. Incomplete. 
With other works. From Turintra, Balipatana, 
Puri District. 

Bhubaneswar IV 119 (Jy/88). 86ff. Oriya. Incom¬ 
plete. From Turintra, Balipatana, Puri District. 

Bhubaneswar IV 192 (Jy/74b). 16ff. Oriya. At the 
end of the manuscript. From Bhubaneswar, Puri 
District. 


CATURAGANAPATI TRIPURARI (fl. 1312) 

The epoch of his Tithicakra (see CESS A 3, 89b) 
is Saka 1234 = a.d. 1312. Additional information 
concerning a manuscript: 

Mysore ORI *P.2559/6. Ff. 59-62. Telugu. 

The last verse is: 

srimannavatithicakrarn 
krtam iti nipunena daivavida // 
tripurarinasya mularn 
yo janati janatarn trikaloke // 

TRIBHUVANAPALA 

The son of Udasina Bhatfa, the son of 
Ujjayinisamanya (the samanta of Ujjayini?), Tribhu- 
vanapala wrote a tika on the Suryasataka of Mayura 
{fl. ca. 600/650). Manuscripts: 

Bombay, Pandita Jye§tharama Mukundaji Sarman. 
29ff. Copied in §aka 1685 = a.d. 1763. See p. 1, 
fn. 1, of Bombay 1954 ed. 

BORI 176 of 1882/83. 74ff. (ff. 23-41 missing). 

Incomplete. From Gurjaradesa. 

Jayapura, UdumbarabhaUa Kr§nakumara Sarman. 
63ff. See p. 1, fn. 1, of Bombay 1954 ed. 



130 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The Siiryasatakaflka was published by Dur- 
gaprasada and K. P. Parab as Kavyamala 19, Bombay 
1889, 2nd ed. Bombay 1900; and by Narayana Rama 
Acarya, 4th ed., Mumbai 1954. The colophon 
begins: iti srimadujjayinisamanyaputrodasinabhaU 
tasadharanasununa tribhuvanapalena viracita. 


TRILOCANA BHATJA 

Author of a Vastupaddhati in 56 slokas. Manu¬ 
script: 

Baroda 12061. 2ff. 


*TRIV1KRAMA 

Additional manuscripts of his Kalavidhana- 
paddhad (see CESS A 3, 90a-91b): 

Mysore (1905) 774. Pp. 237-252. 

Mysore ORI C.2891. Ff. 1-35 and 2ff. Incomplete 
(to bhuvananandayoga). 

Mysore ORI P.12/6. Ff. 14-15. Nandinagari. Incom¬ 
plete. 

Mysore ORI *P.66/2. Ff. 1-20. Nandinagari. Incom¬ 
plete. 

Mysore ORI *P.69. Ff. 1-14. Nandinagari. Incom¬ 
plete. 

Mysore ORI *P.222/13. Ff. 49-57. Telugu. 

Mysore ORI *P.465/2. Ff. 2-194. Grantha. 

Mysore ORI *P.1818/1. Ff. 1-13. Nandinagari. 

Incomplete (slokas 1-180). 

Mysore ORI P.3984/1. Ff. 1-212. 

Mysore ORI *P.4387/1. Ff. 121-184. Telugu. Incom¬ 
plete (bhupravesavidhi to k§anikapancahga). 
Mysore ORI P.5666/16a. Ff. 1-33. Nandinagari. 
Incomplete. 

Mysore ORI P.6112/3. Ff. 1-19. Telugu. 

Mysore ORI P.6176. Ff. 159-172. Telugu. Incom¬ 
plete. 

Mysore ORI P.6706. Ff. 11-37. Grantha. Incomplete 
(slokas 1-100). 

Mysore ORI P.6849/1. Ff. 1-180. Grantha. Incom¬ 
plete (to bhuparik§a). 

Mysore ORI P.7415/5. Ff. 1-10. Telugu. Incomplete 
(to pattabhi§eka). 

Mysore ORI P.7520/1. Ff. 1-155. Telugu. 

Mysore ORI P.8078/3a. Ff. 54-81. Nandinagari. 
Incomplete. 

Mysore ORI P.8764/3. 4ff. Nandinagari. Incomplete. 
Mysore ORI P.8846/4. Ff. 127-170. Telugu. Incom¬ 
plete. 


Mysore ORI P.8847/1. Ff. 1-171. Nandinagari. 
Mysore ORI P.9 a: 53/30. Ff. 161-173. Grantha. 

Mysore ORI P.9657/5a. Ff. 181-182. Nandinagari. 

Incomplete (end of karnavedha). 

Mysore ORI P.9942/1. Ff. 1-13. Telugu. Incomplete. 
Mysore ORI P.10000/5. Ff. 88-101. Nandinagari. 
Mysore ORI P.10022/16. Ff. 2-10. Nandinagari. 

Incomplete (slokas 1-110). 

Poleman 4811 (Harvard Indie 899). Ff. 1-6. From 
Jeypore. Purchased by Lanman in 1889. 


^TRIVIKRAMA 

Additional manuscripts of his Trivikramasataka 
(see CESS A 3, 91b-92b, and A 4, 104a): 

*RORI (Udaipur) 567. 16ff. Copied by Kr§nadasa in 
Sam. 1631 = a.d. 1574. 

*Jaipur (Khasmohor) 5313. Copied in Sam. 1646 = 
A.D. 1589. 

RORI (Jaipur) 4487. 6ff. Copied by Sugandharama 
in Sarn. 1717 = A.D. 1660. 

RORI Cat. XVI 35747. 26ff. Copied on Saturday 2 
kr§napaksa of Vaisakha in Sarn. 1741 = 9 May 
1685. With the tika of Gopinatha. 

RORI Cat. IV 21620. 36ff. Copied by Sarnvalarama 
in Sarn. 1751 = a.d. 1694. With the fika of 
Gopinatha. 

BHU C.3638. lOff. Copied in Sam. 1790 =' a.d. 
1733. 

RORI Cat. XVI 36575. 2ff. Copied by Sankara 
Bhatfa in Sarn. 1837 = a.d. 1780. 

BHU C.3637. 6ff. Copied in Sam. 1839 = a.d. 1782. 
Incomplete. 

Oudh VIII (1876) XIX 10. 36pp. Copied in 1824. 
Property of Pandita Raghunatha Upadhyaya of 
Barabanki Zillah. 

RORI (Alwar) 2950. 87ff. Copied in Sam. 1913 = 
A.D. 1856. With the tika of Hr§ikesa. 

RORI (Udaipur) 5468. 8ff. Copied by Haridatta at 
Jayapura in Sarn. 1951 = a.d. 1894. 

BHU B.4332. 3ff. Incomplete. 

BHU C.305. 9ff. 

BHU C.695. 9ff. Sarada. 

BHU C.744. 5ff. Sarada. Incomplete. 

BHU C.3913. 7ff. Sarada. With a tippani. 

BHU C.4769. llff. Sarada. 

RORI Cat. IV 18569 (9). llff. 

RORI Cat. IX 28724. 27ff. (ff. 1-2 missing). With 
the tika of Gopinatha. Incomplete. 

RORI (Alwar) 2951. 9ff. 

Wien UB 290 (1.67121). Ff. 1-7. Acquired in 1891. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


131 


*TRIVIKRAMA 

Trivikrama was the son of Mahadeva of the 
Sandilyagotra, a resident of Prati$thana; his 
SiddhMtatattva (see CESS A 3, 92b) follows the 
Brahmasphinasiddhdnta of Brahmagupta (b. 598). 
Additional information concerning a manuscript: 

RORI (Alwar) 2624 = *Alwar 2003. 19ff. Copied in 
Sam. 1912 = a.d. 1855. 

Verse 43 at the end is: 

sandilyasitadevalapravarake vamse mahadeva ity 
as it sadganako gunaikanilayo viprah prati^thanake // 
vrttais tattanayas trivikrama idam sahk^ipya 
sastrarnavarn 

cakre sajjanato§akari karanarn siddhantatattvam 
sphutam // 

The colophon begins: iti sritrivikramacaryaviracite 
siddhantatattve brahmaguptasiddhantasammate. 

TRIVIKRAMA BHATTA 

Author of a Mrgaydvicdra. Manuscripts: 

Udaipur RVSS 189. 99ff. Copied in Sam. 1926 = 
A.D. 1869. Incomplete. 

Udaipur RVSS 886. 44ff. Copied in Sam. 1928 = 
A.D. 1871. Incomplete. 


^TRIVIKRAMA (fl. 1704/1737) 

2. Additional manuscripts of his Slghrasiddhi (see 
CESS A 3, 93a), which was completed on Sunday 6 
kr§napak§a of Karttika in Sam. 1776 = 22 Novem¬ 
ber 1719: 

RORI (Chittorgarh) 2776. 157ff. Copied by Vijaya- 
sagara at Sojhata in Sarn. 1858 = a.d. 1801. 
*RORI Cat. I 628. Ff. 1-9. Copied by Harirama 
Muluji Sarasuta for Valabarnji (?) Maga 
Giranara (= Girinarayana?) at Mothala on 
Thursday 12 kr§napak§a of Masottamamasa in 
Sam. 1884 = a.d. 1827. 

LDI (LDC) 1349. lOff. Ascribed to Vikrama Dai- 
vajna. 

Verse 2 of adhikara 1 is: 

mahadevena ye purve krtah khefa mrgahkatah // 


tathaiva svabhramair yuktah svasvavadhimukhah 
krtah // 

Verses 49-51 of adhikara 3 are: 

asid vai naline pure dvijavarah kalyananama dvijas 
tatsunur haribhaktitatparamatih srikahnajid vac^a- 
vah // 

sunus tasya trivikramo ’jani subhakaryaya yogyan 
grahan 

spartan svabhramasamyutan ganitavitprityai 
cakaradarat //49// 

granthasya likhita do§a va maya kukrtam tatha // 
tat sarvam dhivaraih sodhyam ragam yatha 
dayalubhih //50// 

srivikramat §anmunisaptacandra- 
mite ’bdake karttikamasakr^ne // 

§a§Iyarn ravau sighragrahasya siddhim 
cakara daivajhatrivikramo vit //51// 

4. Additional manuscripts of his Bhramanasarinl 
(see CESS A 3, 93a, and A 4, 105a): 

RORI Cat. IV 20033. 290ff. Alleged to have been 
copied in Sarn. 1754 = a.d. 1697. No author 
mentioned. With a Jyod^asahgraha. 

RORI Cat. Ill 13913. 89ff. Copied by Ugracanda R§i 
in Sam. 1842 = A.D. 1785. No author mentioned. 
RORI Cat. IV 20254. 138ff. (f. 102 missing). Copied 
at Pali in Sam. 1880 = a.d. 1823. 

RORI Cat. IV 20246. 31ff. (f. 8 repeated; f. 27 miss¬ 
ing). Copied by Caturbhuja at Puphavati in Sarn. 
1888 = A.D. 1831. No author mentioned. 

Jodhpur 838. 91ff. (ff. 1-10 missing). (Sdri- 

riisahgraha of Bhramaka). Incomplete. 

Oxford (Vyasa) 40. If. Incomplete. Formerly prop¬ 
erty of Mulaji Vyasa. 

RORI Cat. Ill 16084. 8ff. No author mentioned. 
RORI Cat. IV 20249. 2Iff. No author mentioned. 
RORI Cat. IV 20267. 25ff. 

RORI Cat. IV 20271. 42ff. (ff. 10-21 missing). 
Incomplete. 

5. Additional manuscript of his Tithisdrini (see 
CESS A 3, 93a-93b): 

RORI (Chittorgarh) 2609. 3ff. 


^TRIVIKRAMA (fl. 1712) 

Trivikrama wrote his Tdjikasdravrtti (see CESS A 
3, 91b) in Sarn. 1769 = a.d. 1712; he may be identi- 


132 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


cal with Trivikrama (/?. 1704/1737). Additional 

manuscripts: 

Pattan II 13602. 79ff. Copied in Sam. 1802 = a.d. 
1745. 

Pattan II 13145. 79ff. Copied in Sam. 1809 = a.d. 
1752. 


TRIVIKRAMADASA 

Author of a fika in bha§a on the Vasantaraja- 
sakuna of Vasantaraja (/?. ca. 1090/1100). Manu¬ 
scripts: 

BORI 517 of 1892/95. 55ff. Copied in Sam. 1890 = 
A.D. 1833. 

RORI (Udaipur) 2959. 53ff. Copied by Taracanda 
Misra, a resident of Dagaravada, at Mahuva in 
Sam. 1897 = a.d. 1840. 

Jaipur (Khasmohor) 5321. 


TRYAMBAKA BHAIRAVA 

Author of a Kundacamatkara in 52 slokas; there 
is a tika by his grandson, Vasudeva. Manuscripts: 

Wai 2998. 4ff. Copied in Saka 1706 = a.d. 1784. 
Baroda 1300. 6ff. Copied in Saka 1738 = a.d. 1816. 
IM Calcutta 5797. See NCC, vol. 4, p. 178. 

Nagpur 423 (1194). 4ff. (Kufidapramaija). From 
Nasik. 


^TRYAMBAKA BHATTA (fl. 1478) 

A pupil of Vi§nu and a resident of Sevantagrama 
on the bank of the Gautami, Tryambaka wrote a 
tithigrahakhefasarini entitled Slmantika’, its epoch 
is Saka 1400 = a.d. 1478 (see CESS A 3, 93b). 
Additional information concerning a manuscript: 

*BORI 894 of 1886/92. Ff. 1-71. Copied on Wed¬ 
nesday 4 suklapak§a of Pau§a in Sarn. 1865, Saka 
1730 = 21 December 1808 from a manuscript 
copied by Dhundhiraja on 1 suklapak§a of Bha- 
drapada in Saka 1693 = ca. 9 September 1771. 

The last two verses are: 

tithyadikhefapradasariniyam 
suvistara tryambakabhattanamna // 
akari sevantapure sthitena 


sodhya pra<ka>sya mama kirtivrddhyai // 
sevantiva sugandheyarn khetamala sukhaprada // 
racita tadvidarn prityai pritir yajno yato mama // 

The colophon begins: iti srigautamitire sevanta- 
gramasthadaivajnavaryavi§nujyotirvicchi§yatryamba- 
kabhat tadaivajnaviracita. 


^TRYAMBAKA (fl. 1610/1620) 

The example for finding the ahargana in his tika 
(see CESS A 3, 93b-94a, and A 4, 105a-105b) on 
the Vi^nukarana of his father, Vi§nu (fl. 1608), is 
Monday 15 suklapak§a of Vaisakha in Sarn. 1669, 
Saka 1534 = 7 May 1612; for a lunar eclipse that of 
Wednesday 15 suklapak^a of Margasirsa in Sarn 
1677, Saka 1542 = 13 December 1620; for a solar 
eclipse that of Wednesday 30 kr§napak§a of Mar- 
gasir§a in Sarn. 1667, Saka 1532 = 5 December 
1610; for a syzygy that of 15 suklapak^a of Vaisakha 
in Sarn. 1669, Saka 1534 again; for a first visibility 
of the Moon that of Saturday 1 suklapak§a of 
Magha in Sarn. 1667, Saka 1532 = 5 January 1611; 
for a last visibility of Venus in the East that of 
Thurscay 8 suklapak§a of Caitra in Sam. 1667, Saka 
1532 = z2 March 1610; for a last visibility of Jupi¬ 
ter that of 15 suklapak§a of Vaisakha in Sarn. 1669, 
Saka 1534 again; for the time of Moon-rise that of 
Saturday 9 suklapak§a of Vaisakha in Sam. 1667, 
Saka 1532 = 21 April 1610; for the elevation of the 
Moon’s horns that of Thursday 5 suklapak§a of 
Jye§tha in Sarn. 1667, Saka 1532 = 17 May 1610; 
for a conjunction of Mars and Saturn that of Sunday 
10 suklapak§a of Vaisakha in Sam. 1667, Saka 1532 
= 22 April 1610; and for the occurrence of a pMa 
that of Saturday 7 kr§napak§a of Vaisakha in Sarn. 
1670, Saka 1535 = 1 May 1613. Additional informa¬ 
tion concerning a manuscript: 

*BORI 193 of A 1883/84. Ff. 2-41. Copied on Wed¬ 
nesday 7 kr§napak§a of Vaisakha in Sarn. 1864, 

Saka 1729 = 27 May 1807. 

The last verse is: 

sphutak§ararthagambhira ganakanandadayini // 
krtis tadatmanah sai§a tryambakasya mude rahah // 

The colophon begins: iti srivi^nudaivajfiasuta- 
tryambakabhat taviracitayam. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


133 


TRYAMBAKA UPASANI {ft. 1811/1814) 

The son of Gahgadhara of the Atrivamsa, a resi¬ 
dent of Punyastambha on the Godavari, Tryambaka 
wrote a fika on the Kheiakrti of Raghava Appaji 
Khandekara (/?. 1810) between Saka 1733 = a.d. 
1811 and Saka 1736 = a.d. 1814. This was pub¬ 
lished at Punern in 1889. Verse 4 at the beginning is: 

godanirmalavarvidhatakalu§aih sadbhOsurair bhQ^ite 
punyastambhapure ’trivarnsajaladhau 
satkairavanandadah // 

srigaiigadharamanujo ’bhavad upasanyahvayas 
tryambakas 

tatputro ’ham udahrtirp khagakrter vyakhyarn ca 
kurve subham // 


DATTANATHA YOGIN 

Author of a Hindi translation of the Trilokasara 
of Nemicandra {fl. ca. 975). Manuscript: 

Nagaur 1709. 92ff. Copied on Monday 5 suklapak§a 
of A^adha in Sarn. 1862 = 1 July 1805. 

DATTARAJA KETAKARA (fl. 1929/1930) 

The son of Vehkatesa Ketakara (b. 1853), Datta- 
raja taught at the Government High School in Bija- 
pur. He wrote a tika, Ketaklparimala, on his 
father’s Ketakigrahaganita\ it was published with the 
mula as SJP 6, Bijapur 1930. He also wrote a Sastra- 
suddhapahcahgayanamsanirnaya; it was published 
together with the Ketaklparimala on Ketaklgraha- 
ganita 1, 1-6, as SJP 7, [Bijapur] 1929. 

DATTATREYA YAT I NORA 

Author of a Smrtiratnakosa based on the works 
of Madhava (fl. ca. 1360/1380). Manuscripts: 

Mysore ORI P.4873. Ff. 1-155. Telugu. 

Mysore ORI P.5237. Ff. 1-105. Telugu. Incomplete 
(to grahanavicara). 

The tag-verse is: 

madhavamukhavibudhakrtarn 
satigraham uddhrtya dharmasastranam // 
dattatreyavipascic 

cakre smrtiratnakosam akhilartham // 


DAYANIDHI NAN DA 

A samagacarya, Mahamahopadhyaya Dayanidhi 
wrote a Sisubodhinl. Manuscripts: 

Bhubaneswar IV 156 (Jy/15). llOff. Oriya. Copied 
on 23 Simha of Sal San 1311. the 28th ahka of 
Viramukunda = ca. 5 September 1903. With an 
Oriya translation. From Gada Manitri, Khurdha, 
Puri District. 

Bhubaneswar IV 157 (Jy/115). 63ff. Oriya. With an 
Oriya translation. Incomplete (adhyayas 1-8). 
From Bhubaneswar, Puri District. 

*DAYAPRIYA (fl. 1533) 

Additional information concerning a manuscript 
of his Sdrasahgraha (see CESS A 3, 94b-95a): 

^Jaipur (Khasmohor) 5128. 

^'DAYASANKARA (fl. 1767) 

The author of the Grahadipika (see CESS A 3, 
95a) is the son of Dharanidhara, and therefore is 
identical with the author of the Sdhkhdyanagrhya- 
pradlpa (see CESS A 3, 95a, and A 4, 106a-106b). 

1. Additional manuscript of the Grahadipika: 
Kathmandu (1964) 89 (2976). llff. 

The first verse is: 

namaskrtya ganesanarn pratyuhavyuhaharinam // 
dayasaiikaranamaharn dyotaye grahadipikam // 

The colophon begins: iti sridharanidharasununa 
dayasatikarena krta. 

2. Additional manuscript of his Sdhkhayanagrhya- 
pradlpa: 

WHMRL E.ll.i. Ff. 1-19; and 1-26. Incomplete. 

DAYASANKARA (fl. 1877) 

Author of a tika, Paddrthabodhinl, on the 
Kundakalpadruma of Madhava (fl. 1655) in Saka 
1799 = A.D. 1877. Manuscript: 


134 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Baroda 3874. 42ff. 


*DAYASANKARA UPADHYAYA (fl. 1963) 

His Jyautisaprasnaphalaganana with his own 
Hindi tika, Vimala (see CESS A 3, 95b), was 
reprinted at Varanasi in 1975. 

*DAYASIMHA GANI (fl. 1436/1440) 

1. Additional manuscripts of his Balavabodha on the 
Sahgrahanl of Sricandra Suri (fl. ca. 1150) (see 
CESS A 3, 95b-96a, and A 4, 106b): 

Pattan II 1146. 25ff. Copied in Sarn. 1548 = a.d. 
1491. 

Pattan II 1147. 40ff. Copied in Sarn. 1548 = a.d. 
1491. 

Pattan II 882. 52ff. Copied in Sarn. 1551 = a.d. 
1494. 

Pattan II 10439. 33ff. Copied in Sam. 1557 = a.d. 
1500. 

EDI (Gujarati) 257 (6191) = *LDI 6191. Ff. 
35-100. Copied in Sarn. 1577 = a.d. 1520. 
Incomplete. 

Pattan II 10374. 39ff. Copied in Sam. 1604 = a.d. 
1547. 

EDI (Gujarati) 258 (4374) = *EDI 4374. 36ff. Cop¬ 
ied in Sarn. 1610 = a.d. 1553. 

Pattan II 12961. 38ff. Copied in Sam. 1615 = a.d. 
1558. 

EDI (Gujarati) 256 (4223) = *EDI 4223. 75ff. Cop¬ 
ied by Muni Vardhamana in Sarn. 1670 = a.d. 
1613. 

AS Bengal XIII 279 (G. 7412) = *AS Bengal Jaina 
7412. 32ff. Incomplete. 

EDI (Gujarati) 259 (3407) = *EDI 3407. 35ff. (f. 

15 missing). 

Pattan II 1001. 29ff. 

Pattan II 3743. 54ff. 

Pattan II 10336. 36ff. 

Pattan II 10987. 16ff. 

RORI (Bikaner) 13273. 66ff. 

RORI (Bikaner) 13274. 55ff. 

2. His Balavabodha on the K^etrasamdsa of Ratna- 
sekhara (see CESS A 3, 95b) was composed in Sam. 
1497 = A.D. 1440. Additional manuscripts: 

RORI Cat. V 23419. 18ff. Copied by Anandasamu- 
dra at Ahamadabada in Sam. 1535 = a.d. 1478. 
RORI (Bikaner) 14900. 70ff. Copied in Sam. 1606 


= A.D. 1549. 

EDI (Gujarati) 255 (6325) = *EDI 6325. 95ff. Cop¬ 
ied in Sarn. 1743 = a.d. 1686. 

Pattan II 13547. 124ff. Copied in Sam. 1878 = a.d. 
1821. 

RORI Cat. IX 30028 (16). Ff. 129-198. 

^DALAPATIRAJA (fl. ca. 1511/1512) 

Additional manuscripts of his Nrsimhaprasdda 
(see CESS A 3, 96a, and A 4, 106b-107a): 

Jaipur (Dharma) 365. 439ff. Copied by Isvara, the 
son of Khevaraja of the Gaudanvaya, on Monday 
11 suklapak§a of Agrahana in Sam. 1568 = 1 
December 1511 at Kasi during the reign of 
Surivana Sikandara. 

Alwar 1483. (santi). 

AS Bengal II.A.4 (karmavipaka; kalanirnaya; and 
prayascitta); and II A 6 (ahnika; and sraddha). 
Benares (1956) 11904. 117ff. (sarnskara). 

Benares (1956) 12658. Ff. 1-33 and 35-56. (vyava- 
hara; incomplete). 

Mysore ORI C.2735/1. Ff. 1-6. (santisara). 

RORI (Alwar) 3767 = Alwar 1376. 104ff. (ff. 5 and 
20 missing). 

The Satriskdrasdra was edited by Ramagovinda 
Sukla as SBG 121, Varanasi 1985. 

DALELAPURl 

Perhaps identical with the author of the Hindi 
Grahabhdvaphala and Muhunacintdmani (see CESS 
A 3, 96a-96b), Dalelapuri wrote a $atpahcdsikd in 
Hindi. Manuscript: 

Vrndavana (Hindi) 9679. lOff. Incomplete. 
^DASABALA (fl. 1055/1058) 

1. Additional manuscript of his Cintdmapisdranikd 
(see CESS A 3, 96b): 

Pattan II 2785. 9ff. (ko$thaka). 

Both his Cintdmanisdranikd and his Karana- 
kamalamdrtanda are edited by D. Pingree as Aligarh 
OS 9, Aligarh 1989. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


135 


^DASARATHA 

Additional manuscripts of his Sanistotra = 
Sanaiscarastotra (see CESS A 3, 97a, and A 4, 
107b): 

RORI Cat. XVI 34459 (9). Ff. 25-29. Copied by 
Vastanatha at Vikramapura in Sarn. 1863 = a.d. 
1806. 

GVS 4351. 6ff. Copied on Wednesday 13 kr§na- 
pak§a of Jye^lha in Sam. 1870 = 15 June 1814. 
GOME Madras R.5115 (n). Ff. 33-37v. Grantha. 
Presented in 1925/26 by Subbalak^mi Ammal, 
the wife of N. C. Subrahmanya Sastrigaj of Nida- 
mahgalam, Tanjore District. 

Mysore ORI C.4654/11. Ff. 1-2. Kannada. Incom¬ 
plete (verses 1-20). 

Mysore ORI P.500/4. Ff. 36-64. Nandinagari. 

Mysore ORI P.5748/4. Ff. 25-28. Telugu. 

Mysore ORI P.7486/54. 3ff. Nandinagari. 

Nagaur 1439. 3ff. 

Pattan II 8259. 2ff. 

A version of the Sanistotra in 59 verses was pub¬ 
lished as Caukhamba Stotra Granthamala .23, Vara¬ 
nasi 1966. 

DASARATHA MISRA 

Author of a Jyoti^asarasahgraha. Manuscript: 

Bhubaneswar IV 79 (Jy/60). 174ff. Oriya. Incom¬ 
plete. From Jagatsirnhapur, Cuttack District. 


^DADABHAl (/?. 1719) 

2. Additional manuscripts of his Turlyayantrotpatti 
(see CESS A 3, 97b): 

AS Bengal I.B.ll. BengMi. 

BHU B.1193. 5ff. (Turyayantrotpatti). 

DAMODARA 

Author of an Abdaprabodha also called Bhoja- 
devasafigraha. Manuscripts: 

Kathmandu (1964) 8 (708). 79ff. Nevari. Copied on 
Wednesday 5/6 kr§napak§a of Karttika in NS 472 
= 9 November 1351. 


Kathmandu (1964) 9 (702). 65ff. Nevari. Copied on 
Saturday 14 kr§napak§a of Jye§tha in NS 473 = 
1 June 1353 during the reign of Jayayak§amalla- 
deva = Jayarajadeva (1347-1361). Incomplete. 
Kathmandu (1905) III 397 C. 99ff. Nevari. No 
author mentioned. 

The first verse is: 

sarvajham advayam anadim anantam isam 
murdhabhivandya vacanair vividhair muninam // 
abdaprabodham udayajnamudanidanam 
damodaro vyaracayad guninah k^amadhvam // 

DAMODARA 

Collaborator in a Khadililavati. Manuscript: 

Bhubaneswar IV ganita 8 (G/53) = Bhubaneswar 2. 
G/53. 207ff. Oriya. Copied by Haribali Arasirnha 
for Vrndavana Nayaka of the K§itivarnsa on Fri¬ 
day 10 Sirnha of Sal San 1284, the 22nd ahka of 
Divyasirnha III = 25 August 1876. From Niji- 
gada Tapanga, Khurdha, Puri District. 


^DAMODARA 

Additional information concerning a manuscript 
of his JatakMesa (see CESS A 3, 98a): 

RORI (Alwar) 11M = *Alwar 1769. 124ff. Copied 
in Sarn. 1912 = a.d. 1855. 


DAMODARA 

Additional manuscripts of his Yantracintamani 
(see CESS A 3, 98b-99a, and A 4, 107b-108a): 

Jaipur (Khasmohor) 6663. Copied in Sarn. 1730 = 
A.D. 1673. 

Leipzig 1363. Ff. 2-42 and 45-47. Copied by Suka- 
deva at Giripura in a.d. 1699 during the reign of 
Khumanasirnha. Incomplete. 

Sastri, Not. 1900. 297. 38ff. Bengali. Copied in 
Sarn. 1843 = a.d. 1786. Incomplete. No author 
mentioned. Property of Ramuna’s Kalimatha in 
Dhaka. 

*BORI 245 of A 1883/84. 57ff. Copied on Sunday 
10 suklapak§a of Phalguna in Sarn. 1858 = 14 
March 1802. 


136 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Chittorgarh) 4628. 26ff. Copied by Khusala- 
candra Josi at Ambikapuri in Sam. 1864 = a.d. 
1807. 

Wai 8233. 39ff. Copied by Vi§nu Dik§ita Bapota 
Golapakara on Monday 10 kr§napak§a of Sra- 
vana in Saka 1758 = 22 August 1836. 

RORI (Alwar) 4382. 17 and 25ff. Copied in Sam. 
1903 = A.D. 1846. 

Oxford CSS I 571 (d. 702 (1)). Ff. 1-51. Copied by 
Gopinatha Pandya on Sunday 9 kr§napak§a of 
A^adha in Sam. 1905 = 23 July 1848. 

RORI (Alwar) 4406. 43ff. Copied in Sam. 1912 = 
A.D. 1855. 

PUL II App. 999. Ff. 9-40. Copied in Sam. 1913 = 
A.D. 1856. Incomplete. 

*BORI 1140 of 1886/92. 59ff. Copied by Ghana- 
syama Parasvara, a Brahmana residing in Raja- 
puranagara in Mevadadesa, on Wednesday 10 
<kr§napak§a> of Margasir^a in Sam. 1918 = 
27 November 1861. 

RORI Cat. XVI 34595. 46ff. Copied by Phakira in 
Sarn. 1922 = a.d. 1865. 

VSM 3764. Ff. 40-55. Copied by Narayana Bhatta 
on Saturday 9 suklapak^a of Bhadrapada in Saka 
1799 = 18 August 1877. Incomplete (yantras 
only). 

BHU B.49. 17ff. Incomplete. 

BISM 29,1811. Ff. 2-27. Incomplete. 

DC 2876. 20ff. 

GOML Madras D. 17226. 15ff. Grantha. Incomplete 
(vasyadhikara; incomplete). 

Jaipur (Khasmohor) 6775; 6800; and 7658. 

Jammu 4919. 12ff. 

Leipzig 1362. 8ff. Incomplete (ends in vasikarana 
16). 

NPS (Sanskrit) 9044. 3ff. Incomplete. 

Oppert I 6641. Property of Durbha Ramasastrulu of 
Maddi near Padmanabha, Vizagapatam District. 

Oppert I 6775. Property of Indraganti Gopalasastrin 
of Madugal, Vizagapatam District. 

Paris BN 212 M (Sanscrit Dev. 314). Ff. 14-17. 
Incomplete. Acquired in May 1842. 

Pattan II 13320. 56ff. 

RORI (Alwar) 2878 (1). 81ff. 

RORI (Alwar) 4446. 7ff. Incomplete (vidve§anaman- 
tradi). 

Sastri, Not. 1900. 298. 16ff. Bengali. Incomplete 
(vasyadhikara). No author mentioned. Property 
of Ramatarana Thakura of KMhalpada, Naihafi, 
24 Parganas. 

Tanjore D.Suppl. 385 = BL 7037. 30ff. 

Vrndavana 5159. lOff. Incomplete. 

VSM 3765. 17ff. Incomplete. 

WRI 1469. 14ff. Incomplete. 


WRI 3441. 4ff. Incomplete. 

WRI 4647. lOff. 

WRI 6496. 45ff. Sarada. With an udaharana. 
WHMRL K.3.d. Ff. 16-20. Incomplete (akar^anadhi- 
kara 4, 5-vidve§anadhikara 1, 2). 

Wien UB 35 (I 9819). Ff. 1-62. Bought by E. 
Hultzsch in 1884/85. 

The Yantracintamani was edited under the title 
Kalpacintamani from one manuscript and translated 
into English by Narendra Nath Sharma, Delhi 1979; 
published with the Hindi fika of Baladevaprasada 
Misra at Kalyana-Bambai in 1983; and edited from 
BISM 29,1811; BORI 113 of 1873/74; BORI 245 of 
A 1883/84; BORI 1140 of 1886/92; DC 2876; Tan¬ 
jore D Suppl. 385; VSM 3764; VSM 3765; and Wai 
8233 by Hans-Georg Turstig, Stuttgart 1988. A 
French translation by J. M. Riviere was published at 
Milano in 1976. 


*DAMODARA 

Additional information concerning the 
manuscript of his Ratnajataka (see CESS A 3, 99a): 

RORI (Alwar) 2739 = *Alwar 1924. 30ff. 


^'DAMODARA 

Additional information concerning a manuscript 
of his Horapradlpa (see CESS A 3, 99b-100a): 

RORI (Alwar) 2777 = *Alwar 2032. 28ff. Incom¬ 
plete (adhyayas 1-41). 


^'DAMODARA PANDITA 

Additional manuscripts of his Balavabodha on 
the Jyotisaratnamala of Sripati (/?. 1039/1056) (see 
CESS A 3, 100a): 

Udaipur RVSS 207. 75ff. (ff. 30 and 33 missing). 
Copied in Sam. 1800 = a.d. 1743. (Balabodhini 
in Rajasthani of Damodara Bhatta). 

RORI Cat. V 23342. 4Iff. Copied by Ranachodadasa 
in Sam. 1870 = a.d. 1813. 

LDI (Gujarati) 3544 (2436) = *LDI 2436. 55ff. 
Pattan II 14623. 54ff. Said to be in Gujarati. 

RORI (Bikaner) 14644. 26ff. Copied by 

Lak§miratna. 

RORI (Bikaner) 14645. 42ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


137 


DAMODARA BHAJTA 

The son of Mohana Bhaffa, Damodara wrote a 
Kalanirnaya. Manuscripts: 

Jaipur (Dharma) 134. 17ff. Copied by Ramakr§na 
on Friday 7 kr§napak§a of Sravana in Sam. 1726 
= 29 July 1670. 

Jaipur (Dharma) 135. 15ff. Copied by Visvesvara 
for Gopesvara and Raghunanda on Saturday 1 
suklapak^a of Caitra in Sarn. 1787, Saka 1652 = 
7 March 1730. 

The colophon begins: iti srimanmohana- 
bhaUatmajadamodarakrtah. 

DAMODARA HAR^A 

The son of Narayana, Damodara wrote a fika, 
Nauka, on the Kundarka of Saiikara. Manuscripts: 

RORI Cat. XVI 37363. 16ff. Copied by Bhattam- 
bhatta, the son of Yadupati, in Saka 1775 = a.d. 
1853. 

SOI. See NCC, vol. 4, p. 189. 

^DAMODARA MISRA (fl. 1387 or 1434). 

M. Shastri [A5. 1974] argues that his Smrti- 
sagarasara is based on his own Smrtisagara, and 
that this latter is probably identical with his Smrti- 
gahgajala, of which some portions are still extant. He 
also identifies another manuscript of Damodara’s 
Smrtisagarasara (see CESS A 3, 100a-100b): 

Gauhati 290 E. Ascribed to Ruciramisra. 


^DAMODARA (/?. 1417) 

Additional information concerning the 
manuscript of his Bhatatulya (see CESS A 3, 100b): 

*BORI 346 of 1882/83. Ff. h 4-16, and 18-25. Cop¬ 
ied by Mahipaka of the Srimalajhati on Tuesday 
13 kr§napak§a of Vaisakha II in Sarn. 1559 = 23 
May 1503. Incomplete. 


^DAMODARA (fl. 1551) 

Damodara, the son of Raghava of the Sandilyago- 
tra and the pupil of Candidasa, completed his 
Ratrisamvitpradlpa on Sunday 1 suklpak§a of 
Madhu in Saka 1473 = 8 March 1551. Additional 
manuscripts (see CESS A 3, 101a): 

RORI Cat. IV 18569 (3). Ff. 82-84. Copied by Vif- 
fhala, the son of Vaikuntha, at Pipada. 

RORI Cat. V 22654. If. (rMripradipakanamayantra). 
RORI (Alwar) 2687 = *Alwar 1937. 3ff. 

The first verse is: 

natva suryarn mrdanim girisam atha ganadhisvararn 
sarhgapanirn 

candidasadvijagryo ganakaganasiroratnanirajitah- 
ghrih // 

jhatva siddhantatattvarn svaguruvacanato ratrisarn- 
vitpradiparn 

suspa^farn yena vidyan nisisamayam idarn yantram 
etad bravimi // 

Verses 3-4 at the end are: 

dahanagiriyugendau sammite sakakale 
madhusitadivasadye vasare tigmarasmeh // 
krtam idam atha yantram ratripQrvarn pradiparn 
suganakasukhakrt syad brahmano vasarantam // 
srimatpanditasaliyodhanagare srimalladeve nrpe 
rajyarn sasati raghavo dvijavarah sandilyagotro 
’bhavat // 

yah khyatah svagunaih ksitau prthuyasa damodaras 
tatsuto 

yantrarn sre§tham idarn cakara mahitarn 
ratripradiparn budhaih // 

DAYASAHABA (= DA SAHIB ?) 

Author of a Pancmgapdtl (Ika. Manuscript: 

BHU C.1453. llff. Incomplete. 

DASARATHI MUNTA 

Collaborator in writing a Ganita in Oriya. Manu¬ 
script: 


Bhubaneswar IV ganita 28 (G/48). 19ff. Oriya. 
Incomplete. From Bhubaneswar, Puri District. 


138 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


DINAKARA PANDITA 

Author of a Pahcmgaratnamala. Manuscript: 

Pattan II 8827. If. Copied by Pandita Nayavijaya 
Gani. 


^DINAKARA (fl. 1578/1583) 

1. Additional manuscripts of his Candrarki (see 

CESS A 3, 102b-104a, and A 4, 109a): 

Oxford CSS I 66 (*d. 772 (3)). Ff. 1-3. Copied (by 
Kr§na?) on Thursday 5 suklapak§a of Karttika in 
Sam. 1680, Saka 1545 = 7 October 1624. 

RORI Cat. XVI 35586. 14ff. Copied in Sam. 1765 = 
A.D. 1708. No author mentioned. 

RORI (Jaipur) 11058. 9ff. (ff. 1-2 missing). Copied 
at Mathura in Sarn. 1799 = A.D. 1742. (sarini). 
Incomplete. No author mentioned. 

RORI Cat. IV 20220. llff. Copied at Jasola in Sarn. 
1823 = A.D. 1766. No author mentioned. 

RORI (Chittorgarh) 2779. 13ff. Copied by Kusalasa- 
rana at Keligrama in Sarn. 1834 = A.D. 1777. 

Oxford (Vyasa) 36. Ff. 1-15. Copied by Sivasahkara, 
the son of Prabhuji Vyasa, the son of Kalyana 
Vyasa, the son of Ranachoda Vyasa of the 
UdicyajhMi, a resident of Lahgulapura, on 3 
suklapak§a of Pau§a in Sam. 1835 = ca. 22 
December 1778. Formerly property of Mulaji 
Vyasa. 

AS Bengal 6937 (G. 7536). If. Copied at the Nago- 
ragaccha on Saturday 9 kr^napak^a of Vaisakha 
in Sam. 1839 = 24 May 1783. 

Pattan II 14305. llff. Copied in Sam. 1846 = A.D. 
1789. 

RORI (Chittorgarh) 740. 2ff. Copied by Rupaji at 
Nandavati in Sarn. 1849 = A.D. 1792. No author 
mentioned. 

RORI (Jaipur) 9026 (1). 4ff. Copied in Sam. 1855 = 
A.D. 1798. 

RORI (Bikaner) 17339. 7ff. Copied by Manakacanda 
at Sojata in Sarn. 1865 = A.D. 1808. Incomplete 
(masapravesa). No author mentioned. 

BHU B.3303. 4ff. Copied in Sam. 1873 = A.D. 1816. 
(Jyoti^acandrdrka ). 

Pattan II 14477. If. Copied in Sarn. 1876 = A.D. 
1819. 

RORI Cat. VI 25009. 3ff. Copied at Sojata in Sarn. 
1880 = A.D. 1823. 

RORI Cat. VI 23842. 16ff. Copied by Devadatta at 
Rinasigrama in Sam. 1881 = A.D. 1824. With a 
tabartha in Old Hindi. 


RORI (Chittorgarh) 2773. lOff. Copied by Hindu- 
mala in Sam. 1882 = A.D. 1825. No author men¬ 
tioned. 

RORI Cat. IV 21290. lOff. Copied by Kesaricanda 
Vairagin at Pali in Sarn. 1904 = A.D. 1847. 

*BORI 510 of 1895/1902. Ff. 22-26. Copied by 
Meghaji on Friday 11 kr§napak§a of Bhadrapada 
in Sam. 1904 = 8 September 1848. With a sta- 
baka. 

PrSB 3591 (Berlin or. fol. 2285). 2ff. Copied on 10 
kr§napak§a of Margasir§a in Sarn. 1910 = ca. 
15 December 1854. 

Jaipur (Khasmohor) 5015; 5081; and 5247. 

Jodhpur 789 (B). 3ff. Copied by Muni Sarvavijaya at 
Rayapura. 

Jodhpur 835. 4ff. (sarini). No author mentioned. 

Oxford (Vyasa) 35. If. Copied by Ambaya Madha- 
vaji, and presented to Ganapati Dvivedin. For¬ 
merly property of Ganesa, and then of Mulaji 
Vyasa. 

Oxford (Vyasa) 37. Ff. 2-9 and < 10-11 >. Incom¬ 
plete. 

Oxford (Vyasa) 80. If. Incomplete. 

Oxford (Vyasa) 83. If. Incomplete. 

Oxford (Vyasa) 194. If. With a fika. Incomplete 
(verse 1). 

Pattan II 14219. llff. No author mentioned. 

Pattan II 14377. If. 

PrSB 3592 (Berlin or. fol. 2840). 12ff. 

RORI Cat. II 8181. 9ff. No author mentioned. 

RORI Cat. IV 20248. 7ff. No author mentioned. 

RORI Cat. V 22808. 4ff. With a fippana. 

RORI Cat. VII 26281. 21ff. No author mentioned. 

RORI Cat. XVI 35372. If. No author mentioned. 

RORI (Alwar) 5229. 3ff. With a tika. No author 
mentioned. 

RORI (Chittorgarh) 1240. llff. Incomplete. 

RORI (Chittorgarh) 2162. 2ff. Incomplete. No 
author mentioned. 

RORI (Chittorgarh) 2349. 7ff. No author mentioned. 

RORI (Chittorgarh) 2351. lOff. Copied by Vijayasa- 
gara at Ahipura. No author mentioned. 

RORI (Chittorgarh) 2353. lOff. Copied by Kamala- 
sagara at Nagora. No author mentioned. 

RORI (Chittorgarh) 2576. 2ff. No author mentioned. 

RORI (Chittorgarh) 2591. 5ff. 

RORI (Chittorgarh) 2619. 19ff. No author men¬ 
tioned. 

RORI (Chittorgarh) 2628. 3ff. No author mentioned. 

RORI (Chittorgarh) 2766. 12ff. (ff. 2 and 5 missing). 
Copied at Pali. Incomplete. No author men¬ 
tioned. 

RORI (Chittorgarh) 2963. 4ff. No author mentioned. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


139 


RORI (Jaipur) 5482. 4ff. Copied by Vi§nudatta 
Panda. 

RORI (Jaipur) 5755. 2ff. 

RORI (Jaipur) 7752. 8ff. (ko§thaka). No author 
mentioned. 

RORI (Jaipur) 7753. 4ff. (sarini). No author men¬ 
tioned. 

RORI (Jaipur) 7754. 8ff. (sarini). No author men¬ 
tioned. 

RORI (Jaipur) 7987. 2ff. No author mentioned. 

RORI (Jaipur) 10180. 12ff. (sarini). No author men¬ 
tioned. 

RORI (Jaipur) 10208. 12ff. (f. 5 missing), (sarini). 
Incomplete. No author mentioned. 

RORI (Jaipur) 11019. 7ff. (sarini). No author men¬ 
tioned. 

RORI (Jaipur) 11222. 8ff. (sarini). Incomplete. No 
author mentioned. 

RORI (Jaipur) 11633. 4ff. No author mentioned. 

RORI (Udaipur) 1627. 6ff. 

RORI (Udaipur) 6243. lOff. Incomplete. No author 
mentioned. 

RORI (Udaipur) 6481. 13ff. With a tika in bhasa. 
No author mentioned. 

2. Additional manuscript of his Candrarki {ippanika 

(see CESS A 3, 104a, and A 4, 109b): 

RORI Cat. V 22819. 4ff. Copied by Caturyanandi 
Muni in Sarn. 1840 = a.d. 1783. (Candrdrki- 
vrtti). 

3. Additional manuscripts of his Khetasiddhl (see 

CESS A 3, 104a-104b): 

RORI (Jaipur) 4550. 4ff. Copied by Sivanatha in 
Sarn. 1870 = a.d. 1813. 

RORI (Udaipur) 5432. 8ff. Copied by Haridatta at 
Indora in Sarn. 1939 = a.d. 1882. Incomplete. 
No author mentioned. 

*Jaipur (Khasmohor) 5125. 

Oxford (Vyasa) 14. If. Incomplete. 

Oxford (Vyasa) 15. Ff. 1-39. Incomplete. Formerly 
property of Sivasahkara Mulaji Vyasa. 

Oxford (Vyasa) 16. Ff. 9-38. Incomplete. Formerly 
property of Ramakr§na Vyasa. 

Rattan II 12540. Ff. 2-5. 

RORI (Chittorgarh) 2308. 3ff. No author mentioned. 

RORI (Jaipur) 11029. 5ff. Incomplete (sarani). No 
author mentioned. 

RORI (Jaipur) 11057. 5ff. Incomplete. 

RORI (Jaipur) 11059. 3ff. 

RORI (Jaipur) 11801. 4ff. Incomplete. 


4. Additional manuscripts of his Tithisaranl (see 
CESS A 3, 104b): 

RORI Cat. VII 25383. 14ff. Copied by Kanakasagara 
at Benatapura in Sarn. 1740 = A.D. 1683. 

RORI (Chittorgarh) 2316. 2ff. (Candrarkitithi- 
sdrinl). 

5. Additional manuscript of his fika on Ganesa’s 
Grahaldghava (see CESS A 3, 104b): 

RORI (Jaipur) 11060. 4ff. (sarani). 


^DINAKARA BHATTA (fl. ca. 1600) 

1. Additional manuscripts of his Sdntisara (see CESS 

A 3, 105a-105b, and A 4, 109b-110a): 

Benares (1953) 9087. Ff. 1-63, 74-100, 157-170, 
181-186, and 189-227. Copied in Sam. 1720 = 
A.D. 1663. Incomplete. 

Benares (1953) 7461. Ff. 1-2. Copied in Sarn. 1760 
= A.D. 1703. Incomplete (trikasantiprayoga and 
ramalikhanodyapana). Ascribed to Divakara of 
the Bharadvajagotra. 

RORI Cat. VII 26317. 139ff. (ff. 11 and 107-110 
missing; f. 85 repeated). Copied by Lakhamirama 
in Sarp. 1845 = A.D. 1788. Incomplete. 

Mysore ORI C.4323. Ff. 1-163. Copied on 2 kr§na- 
paksa of Asadha in Saka 1724 = ca. 16 July 
1802. 

RORI Cat. IX 29353. 206ff. (ff. 48-49 repeated). 
Copied in Sam. 1859 = a.d. 1802. 

Poona, Mandlik. Smrti and Dharma 69. 275ff. Cop¬ 
ied in Saka 1726 = a.d. 1804. 

BHU B.1260. 8ff. Copied in Sam. 1886 = A.D. 1829. 
Incomplete (Aslesajananasantiprayoga). 

RORI Cat. VII 26574. 254ff. (f. 39 missing). Copied 
by Sivabagasa in Sarn. 1901 = a.d. 1844. Incom¬ 
plete. 

Mysore ORI C.3858/2. Ff. 1-156. Copied on Thurs¬ 
day 10 suklapak§a of Asvina in Saka 1788 = 18 
October 1866. 

Alwar 1484. 

AS Bengal III.E.61; and III.E.115. Incomplete (vas- 
tusanti). 

Benares (1953) 7545. Ff. 1-8. Incomplete (darsa- 
santiprayoga). 

Benares (1953) 8708. Ff. 1-2. Incomplete 

(vyatipatasantiprayoga). 

Benares (1953) 8920. I3ff. Incomplete. No author 
mentioned. 


140 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Benares (1953) 8992. Ff. 1-49. Ascribed to Divakara 
Bharadvaja. 

Benares (1953) 11152. Ff. 1-21. Incomplete 

(vyatipatadisantiprayoga). Ascribed to Divakara 
Bhafta. 

GOME Madras R.5105. 36ff. Grantha. Incomplete 
(satacandisahasracandipujaprayoga). Purchased 
in 1925/26 from R. Varadacaryar of SirudamQr, 
South Arcot District. 

Jaipur (Dharma) 80. 209ff. 

Mysore ORI C.2853. Ff. 1-94. 

Mysore ORI C.4023. Ff. 2-174. 

Mysore ORI C.4048/1. Ff. 1-201. 

PrSB 3118 (Berlin or. oct. 672). 7ff. Incomplete 
(Asle§asanti). 

RORI (Jaipur) 4544. 2ff. Incomplete (maha- 
marisanti). No author mentioned. 

RORI (Jaipur) 5107. 6ff. Incomplete (§adgrahayoga- 
santi). No author mentioned. 

VSM (Upadhye) 12548. 3ff. Incomplete (grahana- 
santi). 

2. Additional manuscripts of his Dinakaroddyota (see 
CESS A 3, 105b, and A 4, llOa-llOb). See also Vis- 
vesvara Gagabhafta, Dinakara’s son who completed 
the Dinakaroddyota. 

RORI (Udaipur) 214 (6). 38ff. Copied at Rajagiri in 
Sarn. 1734 = a.d. 1677. (asaucakanda). 

Jaipur (Dharma) 71. Ff. 142-374. (vratakanda; 
incomplete). 

Oppert II 4650. Property of the Saiikaracaryasvami- 
matha at Srhgeri, Mysore. 

Rajputana, p. 7. (vyavahara). At Ujjain. 

RORI (Udaipur) 214 (3). 157ff. (vyavaharakanda). 
RORI (Udaipur) 214 (4). 97ff. (ff. 1-26 missing), 
(acarakanda). 

RORI (Udaipur) 214 (7). 92ff. Copied by BapQ 
Bhafta. (prayascittakanda). 

Wien UB 24 (I 9649). Ff. 1-13. (sarnnyasavidhi). 
Bought by E. Hultzsch in 1884/85. 

3. Dinakara also wrote a Karmavipdkasara. Manu¬ 
scripts: 

lO 1766 (201). 99ff. Copied by KasikevasI K^etra- 
pati Brahmana on 13 kr§napak§a of Vaisakha in 
Sarn. 1696 = ca. 20 May 1639. From H. T. Cole- 
brooke. 

RORI (Udaipur) 222. 117ff. (ff. 67-68 missing; ff. 
6/7 combined). Copied in Sarp. 1701 = a.d. 
1644. 

Anup 1620. 69ff. Copied in Sam. 1702 = a.d. 1645. 


Formerly property of Manirama Dik^ita. 

Benares (1956) 12417. Ff. 1-128. Copied in Sarn. 
1711 = A.D. 1654. 

Jaipur (Dharma) 79. 9Iff. With the seal of Rama- 
simha, dated Sam. 1718 = a.d. 1661. 

WBISIS 282. 25ff. Copied in Sam. 1719 = a.d. 
1662. Incomplete. 

Benares (1956) 13579. Ff. 1-23. Copied in Sarn. 
184- = A.D. 1783-1792. 

RORI Cat. XVI 34584. 149ff. Copied in Sam. 1879 
= A.D. 1822. 

Baroda 8805. 150ff. Copied in Sam. 1890 = a.d. 
1833. 

Anup 1621. 58ff. 

Anup 1622. 92ff. 

AS Bengal 2572 (G. 5940). 109ff.; and 2ff. 

Benares (1956) 12005. Ff. 1-91. 

Benares (1956) 12627. Ff. 14-21, 26-31, and 

3lb-72. Incomplete. 

Benares (1956) 12675. Ff. 1-84 and 87-118. Incom¬ 
plete. 

Benares (1956) 13837. Ff. 1-96; and 12ff. 

Mitra, Not. 2549. 120ff. Property of Babu Radhi- 
kaprasada Sena of Barhampur. 

Mysore ORI A.641. Ff. 1-134. Telugu. 

Mysore ORI P.4865/1. Ff. 1-44. Telugu. Incomplete. 
Oudh XV (1882) Vaidyaka 1. 180pp. Property of 
Prayagaprasada of Rae Bareli. 

PUL I Dharma 140. 93ff. Incomplete. 

Stephens, Loraine. Ff. 1-59 and < 60-65 >. Incom¬ 
plete (taraiigas 4-16). 

WBISIS 1220. 117ff. Incomplete. 

The first verse is: 

prasutoma prasuryam tanayam iha pita ramakr§nas 
ca so ’yam 

prayascitte§u sararn dinakaravibudhah santikanam 
ca saram // 

krtvatho karmapake§v akhilabudhamude saram etam 
tanoti 

sriramaiighriprasadad ayam api bhajatarn khyatim 
uccair dharayam // 

The colophon begins: iti srimadramesvarasurisunu- 

srimannarayanasutasrimadramakr§nasutadinakara- 

krtah. 

DIVAKARA 

Alleged author of a Kundarka. Manuscript: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


141 


CP, Hiralal 938. Property of Govindprasad Sastri of 
Jubbulpore. 


DIVAKARA 

Author of a Candrasarin'i. Manuscript: 
Jaipur (Khasmohor) 5249. 


DIVAKARA 

Author of a Tdjikadivdkara. Manuscript: 

RORI (Alwar) 2796. 7ff. (f. 1 missing). Copied in 
Sam. 1849 = A.D. 1792. Incomplete. 


^DIVAKARA 

Additional manuscript of his Prasnakaiimud! 
(see CESS A 4, 111a): 

Oxford CSS I 522 (d. 924 (6) A). Ff. 1-12. Bengali. 
The final verse is: 

saktyayutarn pranamyadau sivarn sa ko§adah sa- 
tam // 

srimaddivakaracaryah karoti prasnakaumudim // 

DIVAKARA 

Author of a Suryddipahcdyatanaprati^ (hdpad- 
dhati: cf. Divakara Bhatta Bharde (see CESS A 4, 
111a) and Divakara {fl. 1683). Manuscripts: 

AS Bengal III.E.118. 

Benares (1953) 9724. Ff. 1-17. 

Benares (1953) 10932. Ff. 1-16. 

BORI 160 of 1892/95. 24ff. 


* DIVAKARA (fl. 1053) 

The inscription mentioning Divakara (see CESS 
A 3, 106a), the court astrologer of the Silahara 
Mahamandalesvaradhipati Mummuniraja, ruler of 
Sthanaka (= Thana) from ca. 1045 till ca. 1070, was 
edited by V. V. Mirashi, Inscriptions of the Sildhdras, 
CII 6, New Delhi 1977, pp. 107-110. 


^DIVAKARA (b. 1606) 

1. Additional manuscripts of his Jdtakamarga (see 
CESS A 3, 106b-107b, and A 4, 111a): 

RORI Cat. VI 23078. 9ff. Copied in Sam. 1717 = 
A.D. 1660. 

RORI (Jaipur) 10202. 6ff. Copied by Durgasahkara, 
the son of Vijayasahkara, in Sam. 1872 = a.d. 
1815. (Var^apaddhati or Divdkartpaddhati). 
*Alwar 1764. Copied in Sarn. 1912 = a.d. 1855. 
BHU B.3715. 8ff. 

Kathmandu (1964) 142 (6547). 7ff. 

Mysore ORI P.2336/1. Ff. 33-76. Grantha. 

Mysore ORI P.6847/5. Ff. 238-242. Telugu. 

Oxford CSS I 284 (d. 924 (12) A III). Ff. 2-3, 5, and 
9. Bengali. Incomplete (7-27, 38-48, and 73-82). 
Oxford CSS I 285 (*e. 145 (8)). Ff. 1-10. 

Oxford (Vyasa) 173. Ff. 3, 5, 11-15, 20-22, 24-27, 
29-30, 32-33, 35, 35b (= 36), 37-41, and 44. 
With his own tika. Incomplete. 

RORI (Udaipur) 4615. Ff. 1 and 3-8. Incomplete. 
Tanjore D.11377 = BL 11051(e). 18ff. Grantha 
(Janipaddhatiprakasa of the son of Narasimha). 
Tanjore D. 11378 = BL 11052(e). Grantha. 

The Jdtakamarga was published by K. K. Raikva 
in his Jdtakapaddhatisamuccaya, Surata Sam. 1993 = 
A.D. 1936, pp. 61-75. 

2. Additional manuscripts of his Ganitatattva- 
cintdmani (see CESS A 3, 107b-108a): 

RORI (Alwar) 2688. 96ff. Copied in Sam. 1902 = 
A.D. 1845. 

Oxford (Vyasa) 173. Ff. 3, 5, 11-15, 20-22, 24-27, 
29-30, 32-33, 35, 35b (= 36), 37-41, and 44. 
Incomplete. 

3. Additional manuscripts of his Praudhamanoramd 
(see CESS A 3, 108a-108b): 

RORI (Alwar) 2667. lOff. Copied in Sarn. 1912 = 
A.D. 1855. 

Oxford CSS I 259 (*d. 788). Ff. 2-150. Incomplete 
(ends in 19). 

RORI (Alwar) 2665. 127ff. 

The Praudhamanoramd was published in Hara- 
jivanaddsa SG 32, Varanasi 1985. 

4. A computation in his Makarandavivarana (see 
CESS A 3, 108b-109b, and A 4, llla-lllb) is for 


142 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Saka 1542 = a.d. 1620, which date is presumably 
close to that of its composition. Additional manu¬ 
scripts: 

BHU B.817. 17ff. Copied in Sam. 1831 = a.d. 1774. 
RORI (Bikaner) 4574 (1). 7ff. Copied by Balacanda 
Svamin at Pahadagadha in Sam. 1839 = a.d. 
1782. 

BHU B.814. 12ff. Copied in Sam. 1844 = a.d. 1787. 
*Poleman 4879 (Columbia, Smith Indie 173) and 
*Poleman 4721 (Columbia, Smith Indie 79) form 
one manuscript of 7ff. Copied on Saturday 11 
kr§napak§a of an unnamed month in Sarn. 1853, 
Saka 1718; if the month was A§adha, the date 
was 30 July, if Margasir^a 24 December in 1796. 
Followed by a RajMinirnaya in 19 verses. 

RORI (Alwar) 2630. 16ff. Copied in Sarn. 1883 = 
A.D. 1826. 

RORI (Alwar) 2631. 14ff. Copied in Sarn. 1883 = 
A.D. 1826. 

GJRI 8573/748. Ff. 1-11. Maithili. Copied in Sarn. 
1917 = A.D. 1860. 

*Poleman 4720 (Columbia, Smith Indie 49). Ff. 
1-18. Copied by Takuramarii Tripathin at Govar- 
dhanapura in Kasi on 14 kr§riapak§a of Asvina 
in Sarn. 1922 = ca. 17 October 1865. Followed 
by various material including a Rajadinirnaya in 
10 verses. 

BHU C.847. lOff. 

BHU C.1448. 6ff. 

BHU C.4810. 8ff. 

Harvard Indie 2409. F. 1. Incomplete (ends in 13a). 
^Jaipur (Khasmohor) 5299. 

Mysore ORI P.10056/46. If. Nandinagari. Incom¬ 
plete (end of pahcatigasafikrantyadisphutika- 
rana). 

RORI (Chittorgarh) 379. 23ff. Incomplete. 

5. Additional manuscripts of his Patasdrani (tka 
(see CESS A 3, 109b-110a, and A 4, 111b): 

Oxford CSS I 61 (*e. 145 (12)). Ff. 1-3. Copied by 
Cafigoji on Wednesday 8 Pau§a in Saka 1560 = 2 
or 16 January 1639. 

Jaipur (Khasmohor) 5518. 

6. Additional manuscripts of his Var^aganitabhii^ana 
(see CESS A 3, llOa-llOb, and A 4, 111b): 

BHU B.172. lOff. Copied in Sarn. 1726 = A.D. 1669. 
Ascribed to Kr§iia. 

RORI Cat. IV 19674. 19ff. Copied by Deva in Sarn. 

1826 = A.D. 1769. With the ttka of Raiiganatha. 
RORI Cat. IX 28172. 7ff. (f. 2 missing). Copied in 


Sarn. 1917 = a.d. 1860. Incomplete. 

^Jaipur (Khasmohor) 5312. 

Oxford CSS I 374 (d. 924 (12) A II). Ff. 2-5 and 
<8>. Bengali. Incomplete (6-34 and 57-69). 
RORI (Alwar) 5507. 4ff. 

7. Additional manuscript of his Mahjubhd^ini (see 
CESS A 3, 110b): 

RORI Cat. IX 28636. 23ff. Copied by Govindarama, 
the son of Ambadatta, in Sarn. 1851 = A.D. 1794. 

8. He also wrote a Bhubhdnayanavdsand, which, 
however, may be a part of his Makarandavivaraija. 
Manuscript: 

Kathmandu (1965) 167 (2637). 4ff. 

The colophon begins: iti srisakalagamacarya- 
srimannrsirnhadaivajnatmajadivakaraviracita. 

^^DIVAKARA KALA (fl. ca. 1625/1650). 

Additional manuscripts of his Kdlanirtiayacan- 
drikd (see CESS A 3, llOb-llla, and A 4, 111b): 

*BORI 343 of 1891/95 = BORI (Dharma) 261. Ff. 
1, 6-26, and 30-77. Copied by Yajharama on 
Sunday 1 kr§napak§a of Magha in Sarn. 1771 = 
11 February 1655. Incomplete. 

Alwar 1499. 

*BORI 523 of 1883/84 = BORI (Dharma) 260. 14ff. 
Incomplete. 

Mysore ORI *C.228. Ff. 1-80. Incomplete (pau§a- 
masaniriiaya). 

Mysore ORI *P.4012. Ff. 1-119. Telugu. 

SOI vol. II. See NCC, vol. 10, p. 145. 


WIVAKARA (fl. 1683) 

Additional manuscripts of his Tithyarka (see 
CESS A 3, 11 la-112a, and A 4, 11 lb-112a): 

Jaipur (Dharma) 680. 74ff. Copied in part by Teja- 
bhana Se§a on Saturday 12 suklapak§a of Mar- 
gas ir§a in Sarn. 1823 = 13 December 1766. 
*Poona, Mandlik. Smrti and Dharma 111. 124ff. 
RORI (Alwar) 3657. 68ff. Incomplete. 

RORI (Udaipur) 5252. 83ff. (ff. 1, 30-31, 55, 64-65, 
70-71, and 74-75 missing). Incomplete. No 
author mentioned. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


143 


^DIVYASIMHA MAHAPATRA {fl. ca. 1640/1680) 

Additional manuscripts of his Kaladlpa (see 
CESS A 3, 112a-112b, and A 4, 112a): 

Bhubaneswar VII 37 (Dh/425). 35ff. Oriya. Incom¬ 
plete. From Bhubaneswar, Puri District. 
Bhubaneswar VII 38 (Dh/478). 94ff. Oriya. From 
Gadamanitri, Begunia, Puri District. 

Bhubaneswar VII 39 (Dh/521b). 27ff. Oriya. From 
Puri. 

Bhubaneswar VII 40 (Dh/539). 38ff. Oriya. Incom¬ 
plete. From Puri. 

Bhubaneswar 2. Dh/998A. 

The Kaladlpa was edited with his own tika, 
Tejanyd, by Kulamani Misra Sarman, Puri 1982. 


DIK^ITA 

Alleged author of a fika, Cintdmani, on a Kun- 
darka. Manuscript: 

Kavindracarya 701. 

This is probably the Kundarkadldhiti of Cinta- 
mani. 


DINAKR^NA MAHANTl 

Collaborator in writing an Oriya translation of 
the Llldvati of Bhaskara (b. 1114). Manuscript: 

Bhubaneswar IV ganita 52 (G/5). 123ff. Oriya. From 
Puri. 


^DINANATHA 

Additional manuscript of his Sarvasahgraha (see 
CESS A 3, 112b-113a): 

Udaipur RVSS 29. 15ff. 


DIPTADASA 

Author of a Sakundvall in Hindi. Manuscript: 
Prayaga 3829. 54pp. Incomplete. From Jodhapura. 


*DURGADEVA (fl. 1032) 

His ^a^ (isamvatsaraphala (see CESS A 3, 
113b-114a, and A 4, 112a) is either identical with or 
a part of his Arghakdnda (see CESS A 3, 114b, and 
A 4, 112b). Additional manuscripts: 

LDI (Gujarati) 3545 (3905/1). Ff. 1-6. Copied in 
Sam. 1721 = A.D. 1664. 

LDI (VDS) 1316 (9726). 6ff. 

Oxford CSS I 138 (d. 753 (5)). Ff. 1-17. Incomplete. 
Oxford CSS I 139 (d. 785 (4)). Ff. 1-6. Incomplete. 
Oxford CSS I 140 (*d. 789 (3)). Ff. 1-11 and 
1 lb-29. 

RORI Cat. IV 18744. 13ff. 

RORI (Bikaner) 14728. 6ff. 

RORI (Bikaner) 16957. Ff. 1-18. 

RORI (Bikaner) 18229. Ff. 1-45. 

RORI (Jaipur) 7939. 3ff. Incomplete. 

RORI (Udaipur) 4293 (20). Ff. 180-189. Begins 
with Sarn. 1616 = A.D. 1559. Incomplete. 

For his Ris (asamuccaya (see CESS A3, 
114a-114b) see also N. Jyoti§acarya [A5. 1946/47b]. 

DURGAPRASADA SARMAN 

The son of Ramacandra Suri, a member of the 
Gurjara-Gauda varnsa of Brahmanas and a resident 
of Jayapura, Durgaprasada wrote a Hindi tika, 
Prabhd, on the Hdyanabhdskara of Lak§minarayana 
(fl. 1911) during the reign of Madhavasirnha; he may 
be identical with the Durgaprasada Sarman who 
wrote a Hdyanacandrodaya (see CESS A 3, 115a). 
The Hdyanabhdskara with Durgaprasada’s Prabhd 
was published at Bambai in 1987. The concluding 
verse is: 

srimanmadhavasirnhabhupatilakenativasarnrak§ite 
vikhyate jayapattane k§itisurah sriramacandratma- 
jah // 

tenedarn racitarn satam atimude durgaprasadabhidho 
grantham hayanabhaskarasya vimalam tikarn 
prabhanamikam // 

^DURGASANKARA PATH AKA (fl. ca. 1800/1850) 

Additional manuscript of his Suryddigraha- 
sddhana (see CESS A 3, 115b, and A 4, 112b): 


144 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Alwar) 2680. 6ff. Copied in Sam. 1912 = 
A.D. 1855. 


*DURGASAHAYA (fl. 1841) 

Additional information concerning a manuscript 
of his Abdaratna (see CESS A 3, 116a, and A 4, 
112b): 

RORI (Alwar) 2812 = * Alwar 1709. 14ff. Copied by 
Ramalala in Sam. 1912 = A.D. 1855. 


DURJAYA 

Author of a vyakhya, Aghasafigrahadlpikd, on 
the Asaucadasasloki of Vijhanesvara. Manuscripts: 

Mysore ORI P.573/3. Ff. 133-150. Telugu. Incom¬ 
plete. 

Mysore ORI P.2134/3. Ff. 166-187. Nandinagari. 

Incomplete (slokas 4-9). 

Mysore ORI P.2286/2. Ff. 11-37. Grantha. 

Mysore ORI P.3224/1. Ff. 184-229. Grantha. Incom¬ 
plete. 

Mysore ORI P.4535/5. Ff. 61-77. Telugu. Incom¬ 
plete (slokas 1-9). 

Mysore ORI P.5959. Ff. 149-200. Nandinagari. 

The last verse is: 

ittham kathitavan artharn dasamasyaghasaiigrahe // 
slokasya durjayah srimadraiigarajahghrisarnsrayah // 

The colophon of Mysore P.5959 begins: iti §atpa- 
naya slokabhijhanannabhat tavasudevatmajasimha- 
masvamyaparaparyayadurman < o > viracitayarn. 

■■'^DURYODHANA (/?. 1461) 

Additional manuscripts of his Jhdnapradipa- 
cintamani (see CESS A 3, 116a-116b, and A 4, 
113a): 

Kathmandu (1965) 63 (4014). 19ff. Copied on a 
Wednesday in the suklapak^a of Asadha in Sarn. 
1748, Saka 1613 = 17 or 24 June 1691. 

RORI Cat. IX 29667. 5ff. Incomplete. 


DURLABHA DAS A 

Author of an Oriya translation of the Jdta- 
kdlahkdra of Ganesa {fl. 1613), Manuscript: 

Bhubaneswar IV 46 (Jy/65). 91ff. Oriya. From Bhu¬ 
baneswar, Puri District. 

mURLABHARAJA (fl. 1160) 

Additional manuscripts of his Samudrikatilaka 
(see CESS A 3, 116b-117a, and A 4, 113a): 

*RORI (Udaipur) 580. 33ff. Copied by Devacandra 
Upadhyaya in Sarn 1632 = A.D. 1575. Incomplete 
(strilaksana). 

Jaipur (Khasmohor) 5447. Copied in Sam. 1715 = 
A.D. 1658. Incomplete (strilaksana). 

AS Bengal III.E.221. 

Jaipur (Khasmohor) 5009. Ascribed to Jagaddeva. 
Pattan II 10442. 14ff. Incomplete (ends with adhi- 
kara 3). 

PrSB 2991 (Gottingen, Sanscr. Sham 41). 31ff. 

RORI Cat. VIII 27181. 26ff. 

The Samudrikatilaka was edited with his own 
Hindi version by Radhakr§na Misra at Bambai in 
1956. 


^DURVALI SEVAKA 

Additional information concerning the 
manuscript of the Tithinirnaya = Tithiprakdsa of 
Durvali, the son of Lokamani (see CESS A 3, 117a): 

*WHMRL E.11.2. 2ff. Copied on 13 kr§napak§a of 
Bhadrapada in Sarn. 1896 = ca, 5 October 1839. 

The first verse is: 

natva bhavanicaranaravindarn 
santanyate mahgaladanapak§am // 
srilokamanyatmajasevakena 
balaprabodhaya tithiprakasah // 

The colophon begins: ity acaryadurvalikrta. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


145 


DEV AKIN AND AN A (fl. ca. 1600) 

The son of Raghunatha, the son of Vifthala (b. 
1515), the son of Vallabha (1478-1530), the son of 
Lak§manabhatta of Kahkaravac^a in Tailahgadesa, 
Devakinandana wrote an EkMasivratanirnaya. 
Manuscript: 

BORI 90 of 1884/86 = BORI (Dharma) 202. llff. 
Copied on 1 sukiapak§a of Caitra in Sarn. 1688 
= ca. 23 March 1631. 


DEVAKINANDANA (fl. 1650) 

Pupil of his uncle, Viharin, the son of Kr§na 
Vasudeva, Devakinandana wrote a Varsaphala- 
paddhati = Tdjikapaddhati in Saka 1572 = a.d. 
1650. Manuscripts: 

RORI Cat. VIII 26830. 13ff. Copied by Devaraja R§i 
at Balibhadrapura. 

RORI (Bikaner) 14641. 17ff. 

Verse 1 is: 

akarnya garjitam yasya vivastrah kavidiggajah // 
pitrvyarn tan nijarn natva gururn srimadviharinam // 

At the end are the verses: ^ 

kr§nah kr§na ivaparo dvijavarah srivasudevah 
sudhir 

asit tasya sutah kalasu nipunah srimadvihari 
prabhuh // 

prakhyato yasasa diso dasa viharava<t>ri- 
lak^mabhis 

tacchi§yas ca tadagrajasya mahajah putrah pavitrah 
krtih // 

umasambhupadambujasaktacetah 
suceta suceta budhanarn prajeta // 
sake dvyadribanendusahkhye tapasye 
muda devakinandano devarupah // 

^DEVAKINANDANA (fl. 1807/1838) 

His Krpdpaddhati (see CESS A 3, 118a) is identi¬ 
cal with the Kriydpaddhati (see CESS A 4, 113a). 
Additional information concerning a manuscript: 

RORI (Alwar) 2669 = *Alwar 1728. 16ff. With 3 
additional folia. 


Verses 11-12 at the end of the Krpdpaddhati are: 

asanne tuhinacalasya kamathadrau somanathantike 
gotre caiigirase babhuva sukrti lak§midharo 
daivavit // 

jivananda iti pratham adhigatah putro mahadaivavit 
tasyabhut phanirajabha§itamahabha§yadivacas- 
patih // 

tatputras taccaranakamaladvandvasampraptabodhah 
sake §advahninagavidhumite devakinandano ’ham // 
caitre mase vyaracayam imarn paddhatinarn 
krpakhyarn 

bho ambaitat krtijasukrtarn padayos te ’rpaye ’ham 

// 


^DEVAKINANDANA SIMHA (fl. 1934) 

His Jyotisaratndkara (see CESS A 3, 118a) was 
reprinted at Dilli in 1983 and again in 1988. 

DEVAKINANDANA SASTRIN (fl. 1970) 

Once Professor at the Benares Palmistry College 
and founder of the Sarasvatijyoti§avidyalaya and of 
the Bhrgujyoti§akaryalaya in Varanasi, Devakinan¬ 
dana completed near the Visvesvara temple in Kasi 
on Saturday 10 krsnapak^a of Pau§a in Sarn. 2026 
= 21 January 1970 a tika, Surya, on a Ptasna- 
prakdsa. This was published with the mula at Vara¬ 
nasi in Sarn. 2027 = A.D. 1970. 


^DEVANNA BHATTA (fl. ca. 1225/1250) 

Additional manuscripts of his Smrticandrikd (see 
CESS A 4, 113b-115b): 

Adyar Cat. 40 C 25. 426pp. Malayalam. (ahnika). 
BHU B.136. 120ff. (acara). 

Visvabharati (Adyar) 163. 254ff. Grantha. Incom¬ 
plete (ends in kanda 5). 

Visvabharati (Adyar) 478(b). 162ff. Telugu. (sarn- 
skara and ahnika). 

Visvabharati (Adyar) 479. 226ff. Telugu. (vyava- 
hara). Formerly property of Pudukkottai sarn- 
sthanarn Tirumayamtal Kodandaraman. 

The MSS edition by L. Srinivasacharya was 
reprinted in 3 volumes at Dilli in 1988. 


146 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


DEVADATT A 

Author of a Srsjikarana. Manuscripts: 

BHU C.22. 14ff. Sarada. With the fika of Catur- 
bhuja. Incomplete. 

RORI Cat. V 22294. 65ff. 


*DEVADASA MISRA 

Additional manuscripts of his Devadasaprakasa 
(see CESS A 3, 119a, and A 4, 116a), which is 
identical with his Tithinirnaya (see CESS A 3, 
119a): 

Benares (1956) 13795. Ff. 1-49. Copied in Sarn. 
1772 = A.D. 1715. 

Benares (1956) 12120. Ff. 1-4, 6-7, 9-17, 21-24, 
27-31, and 41-52; and ff. 1-2. Incomplete. 
Benares (1956) 13539. Ff. 2-270, 272-292, and 
297-307. Incomplete. No author mentioned. 
Benares (1956) 13935. Ff. 1-166, 166b-169, 

169b-174, and 176-194. Incomplete. (Divoddsa- 
prakdsa). 

*BORI 258 of 1887/91 = BORI (Dharma) 498. Ff. 
12-26, 28-32, and 34-36. Incomplete (tithipra- 
karana). 

-^DEVANATHA THAKURA TARKAPANCANANA 

Additional manuscript of his Smrtikaumudi (see 
CESS A 3, 119b, and A 4, 116a): 

Benares (1956) 13427. Ff. 1-236. Copied in Sam. 
1822 = A.D. 1765. 


'^'DEVAPAMATYA SURI 

Additional manuscripts of his Andhra tika on 
the Sarvatobhadra (see CESS A 4, 116a): 

GOME Madras D. 13996. Ff. 46-69v. Telugu. 

GOME Madras D. 13997. Ff. 69v-82. Telugu. Incom¬ 
plete (ends in pariccheda 5). 

The colophon begins: iti sarvatobhadracakre 
devapamatyasuriviracite. 


DEVABHADRA SARM AN 

Author of a Pausdder lak^ana. Manuscript: 
Benares (1956) 14181. Ff. 1-18. 


^DEVABHADRA SURI {fl. ca. 1175) 

Additional manuscripts of his Safigrahanlratna- 
vnti (see CESS A 3, 119b-120b, and A 4, ll4): 

Pattan II 10583. 45ff. Copied in Sarn. 1471 = A.D. 
1414. 

Panjab JB I 2714 (Patti 51). 13ff. Copied in Sarn. 
1505 = A.D. 1448. 

Gondal (Jaina Dharma) 371. 19ff. Copied by 

Srivacha Vipra at Visalanagara on Wednesday 15 
suklapaksa of Magha in Sam. 1508 = 24 January 
1453. Attributed to Devacandra Suri. 

RORI (Bikaner) 13264. 19ff. Copied by Jesaka 
Mantrin at Sarodi in Sarn. 1512 = A.D. 1455. 
RORI (Bikaner) 13263. 15ff. Copied at Ahamada- 
bada in Sarn. 1524 = A.D. 1467. 

AS Bengal XIII 275 (G. 2575). 56ff. Copied by 
Krstiadasa on Monday 1 suklapaksa of Vaisakha 
in Sarn. 1529 = 29 March 1473. 

BM Or. 2116 D. Copied in A.D. 1484. 

Panjab JB I 2708 (Amritsar 341). 81ff. Copied in 
Sarn. 1591 = A.D. 1534. 

RORI (Bikaner) 16322. lOlff. Copied by Gutiacan- 
dra at Rajanagara in Sarn. 1751 = a.d. 1694. 
RORI (Bikaner) 13266. 11 Iff. Copied by Dayamurti 
in Sarn. 1780 = a.d. 1723. 

Pattan II 14364. 65ff. Copied in Sarn. 1821 = a.d. 
1764. 

RORI (Chittorgarh) 3600. 82ff. Copied by Raiiga- 
vijaya at Eikhamaiiapura in Sarn. 1876 = a.d. 
1819. 

Panjab JB I 2715 (Nakodar 44). 98ff. Copied in Sarn. 
1878 = A.D. 1821. 

Pattan II 13523. 83ff. Copied in Sarn. 1879 = a.d. 
1822. 

RORI (Bikaner) 13267. 76ff. (f. 35 repeated). Cop¬ 
ied at Bikanera in Sarn. 1882 = a.d. 1825. 

AS Bengal XIII 276 (G. 7571) = *AS Bengal Jaina 
7571. 117ff. 

BM Or. 2116 A. 

Jesalmere II Pothi 125, no. 2199. No ff. given. 

Pattan II 1137. 21ff. 

Pattan II 1138. 68ff. 

Pattan II 6966. 79ff. 

Pattan II 7627. 7ff. 

Pattan II 10329. 39ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


147 


RORI Cat. IV 19420. 59ff. 
RORI Cat. IV 20465. 45ff. 


*DEVABHADRA PAJHAKA (fl. 1755/1769) 

Additional manuscripts of his vyakhya (see CESS 
A 3, 120b, and A 4, 116b) on the Nak^atrasattra- 
sutra of Baudhayana: 

PUL I Srauta 489. 80ff. Copied in Sana. 1818 = a.d. 
1761. 

WRI 3708. 67ff. 


DEVAMURTI {fl. 1398) 

Author of a Satriskrtaksetrasamasa in Sana. 1455, 
Saka 1320 = a.d. 1398; Devamurti composed his 
own tika. Manuscripts: 

Pattan II 3744. 12ff. Copied in Sam. 1532 = a.d. 

1475. With his own avacuri. 

Pattan II 1500. 60ff. With his own vrtti. 

Pattan II 4003. lOff. Incomplete (ends with 
jambudvipadhikara). No author mentioned. 

Pattan II 7642. llff. 


^DEVARAJA _ 

Additional manuscripts of his Kut (akarasiromani 
(see CESS A 3, 120b-121a): 

Mysore (1905) 750. 36pp. 

Mysore ORI *B.596/2. Ff. 1-10. Kannada. 

Mysore ORI *B.597/b. Ff. 1-59. Kannada. 

Mysore ORI *B.1165/b. Ff. 1-33. Kannada. Incom¬ 
plete (end of bhinnabahvagra). 

Mysore ORI *P.4398/2. Ff. 1-35. Nandinagari. 


*DEVALA 

Additional manuscript of his Kakaruta (see CESS 
A3, 121a): 

WHMRL G.20.g. F. 1. 

Additional manuscripts of his Gomukhajanana- 
santi (see CESS A 3, 121a): 


Mysore ORI P.3023/69. F. 38. Telugu. 

Mysore ORI P.5672/62. Ff. 98-99. Kannada. 

*DEVACARYA (fl. 689) 

Additional manuscripts of his Karanaratna (see 
CESS A 3, 121b; see also K. S. Shukla [A5. 1984] 
and R. Billard [A5. 1986]): 

*Kerala 3045 (T.559). 24pp. Copied on 14 Leo in 
A.D. 1097 (presumably an error for 1897). 

Mysore ORI *B.576/35. Ff. 159-163. Kannada. 

Incomplete (mahapatadhyaya). 

Mysore ORI P.656/6. 3pp. Nandinagari. 

Mysore ORI *P.4477/3. Ff. 46-55. Nandinagari. 
Incomplete (to 2, 62). 

Mysore ORI P.4481/5. Ff. 19-21. Nandinagari. 

Incomplete (mahapatadhyaya). 

Mysore ORI P.8283/4. Ff. 16-38. Telugu. Incom¬ 
plete (mahapatadhyaya). 

Mysore ORI P.9779/1. Ff. 1-7. Nandinagari. Incom¬ 
plete. In Kannada. 

Mysore ORI P.9779/3. 6ff. Nandinagari. With a 
Kannada vyakhya. Incomplete (verses 1-4 miss¬ 
ing). 

The text of chapters 1-8 of the Karanaratna was 
edited from Kerala T.559, that of the mahapatadh¬ 
yaya from Mysore B.576 and P.4477, by K. S. 
Shukla, Lucknow 1979. 

Verse 1, 1 is: 

hariharahiranyagarbhan 
pranamya gojanmavanditan bhaktya // 
grahacararn vyaktataram 
kathayati devah samasena // 

Verse 1, 5 begins: sakavar$arn rudrarasai rahitarn. 

^DEVANANDA 

Additional manuscripts of his K^etrasamasa (see 
CESS A 3, 121b): 

RORI Cat. IV 19295. 14ff. Copied on pQrnima of 
Bhadrapada in Sam. 1696 = ca. 2 September 
1639. 

Pattan II 1002. 13ff. Copied in Sarn. 1957 = a.d. 
1900. 


Mysore ORI P.2279/39. Ff. 116-118. Nandinagari. 


148 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


DEV ARY A 

Author of a Kannada vyakhya, Bhavaprakasika, 
on the Brhajjdtaka of Varahamihira (/?. ca. 550). 
Manuscript: 

Mysore ORI P.5073. Ff. 1-92. Telugu. Incomplete. 
DEVlDATTA 

Author of a Ramalasdra. Manuscript: 

BHU C.4526. 3 Iff. Copied in Sam. 1952 = a.d. 
1895. 


DEV I DAS A 

A member of the Mativamsa (= K§itivamsa), 
Devidasa collaborated in the writing of several 
works on ganita in Oriya. 

1. Khadlpdfha. Manuscript: 

Bhubaneswar IV ganita 5 (G/34) = Bhubaneswar 

2.G/34. 142ff. Oriya. From Haladia, Khurdha, 
Puri District. 

2. Ganita. Manuscripts: 

Bhubaneswar IV ganita 14 (G/12). 183ff. Oriya. 

Copied in Sal San 1289, the 21st aiika of Divya- 
sirnha = a.d. 1881. From Puri. 

Bhubaneswar IV ganita 13 (G/10) = Bhubaneswar 
2.G/10. 21ff. Oriya. Incomplete. From Puri. 
Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 

From Ranapur, Puri District. 

Bhubaneswar IV ganita 24 (G/37) = Bhubaneswar 
2.G/37. 73ff. Oriya. Incomplete. From Bhubanes¬ 
war, Puri District. 

Bhubaneswar IV ganita 28 (G/48). 19ff. Oriya. 

Incomplete. From Bhubaneswar, Puri District. 
Bhubaneswar IV ganita 29 (G/55) = Bhubaneswar 
2.G/55. 149ff. Oriya. Incomplete. From Turintra, 
Balianta, Puri District. 

Bhubaneswar IV ganita 55 (G/28). 54ff. Oriya. At 
the end of the manuscript. From Jagatsirnhapur, 
Cuttack District. 

Bhubaneswar 2.Cy/288. 

3. Grahadhruvadhikdra. Manuscript: 

Bhubaneswar 2.Jy/314. 


4. Dhardna. Manuscript: 

Bhubaneswar IV ganita 36 (G/19). 76ff. Oriya. From 
Kapileswar, Puri District. 

5. Nalasdgara. Manuscript: 

Bhubaneswar IV ganita 38 (G/32). 135ff. Oriya. 
From Puri. 

6. Ndyakadhana cautisd. Manuscript: 

Bhubaneswar IV ganita 40 (G/22) = Bhubaneswar 
2.G/22. 104ff. Oriya. Copied by Kamapala Patta- 
nayaka for (?) Digambara Nayaka of the K§iti- 
vamsa at Podapoda on Saturday 9 suklapak§a of 
Jye§tha in Sal San 1245, the 25th ahka of Rama- 
candra = 10 June 1837. From Ranapur, Puri 
District. 

7. Pdthasamudra. Manuscripts: 

Bhubaneswar IV ganita 42 (G/7). 70ff. Oriya. Incom¬ 
plete. From Cuttack. 

Bhubaneswar IV ganita 43 (G/13). 30ff. Oriya. 

Incomplete. From Puri. 

Bhubaneswar IV ganita 44 (G/27a). 17ff. Oriya. 

Incomplete. From Jagatsirnhapur, Cuttack 
District. 

Bhubaneswar IV ganita 45 (G/42). 119ff. Oriya. 

Incomplete. From Turintra, Balianta, Puri Dis¬ 
trict. 

Bhubaneswar IV ganita 47 (G/52). 102ff. Oriya. 

Incomplete. From Khurdha, Puri District. 

8. Bljamdlikd, written with Bhalabhadra. Manu¬ 
script: 

Bhubaneswar 2.G/128. 


^DEVlSAHAYA 

Additional manuscript of his Llldvatlvildsa (see 
CESS A 3, 122b): 

WHMRL a 120. llff. Incomplete (verses 211-236). 


DEVENDRA {fl. ca. 1250?) 

Sometimes confused with his pupil, Dharma- 
gho§a (d. 1300?), Devendra was the pupil of Jagac- 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


149 


candra, and taught Vidyananda as well as Dharma- 
gho§a. To him is attributed a tika on the Sahgra- 
hanlratna of Sricandra (/?. ca. 1150). Manuscript: 

Rattan II 3493. 83ff. 


DAIVAJNARAJA 

Title of the author of a K^ayamasanirnaya. Manu¬ 
script: 

Kathmandu (1964) 56 (6313). 3ff. 

The colophon begins: iti sridaivajfiarajakrtah. 


^DVARAKANATHA YAJVAN (fl. 1609) 

The son of Tikabhafta, Dvarakanatha finished 
his Sulbadlpika (see CESS A 3, 123b) on the 
Baudhdyanasulbasutra at Kasi on Friday 5 kr§na- 
pak§a of Asvina in Sarn. 1666 = 6 October 1609. 
Manuscripts: 

Wai 1721. 29ff. Copied in Saka 1611 = a.d. 1689. 
Incomplete. 

VSM 3366. 50ff. Copied by Govinda Manohara in 
Saka 1768 = a.d. 1846. 

lO 4636 (Burnell 445). 54ff. Copied from one of the 
Tanjore manuscripts in 1871. From A. C. Bur¬ 
nell. 

AS Bengal I 2. 267 (II.B.38). Ff. 1-77. Copied in 
Beng. Sarn. 1279 = A.D. 1872. 

Bombay U Desai 124. 63ff. Copied on 6 kr§napak§a 
of Vaisakha in Sam. 1971 = ca. 3 June 1915. 
Alwar 105. 

AS Bengal 606 (G.1854) = AS Bengal I 2. 800. 17ff. 

Incomplete. 

AS Bengal III.F.273. 

Baroda 553. 61ff. 

Baroda 12439. 31ff. Incomplete. 

Benares (1953) 4084. Ff. 1-66. Perhaps the same as 
Benares (1870/80) Veda 39. 60ff. 

Benares (1953) 4412. Ff. 1-58. Alleged to have been 
copied in Sarn. 1666 = a.d. 1609. This is the 
same as Mitra, Not. 656. 58ff. Copied in Sarn. 
1666 = A.D. 1609. Property of Queen’s College, 
Benares. 

Bombay U 755 II. Ff. 5-20v. Copied by Vinayaka 
Dhupakara. Incomplete (adhyaya 1). 
lO 292 (1678b). 102ff. From H. T. Colebrooke. 

N-W P IX (1885) I 26. 59ff. Property of Rama Can¬ 
dra Panta Dasaputra of Benares. 


Osmania University B 77/2. 126ff. 

PUL I Srauta 481. 49ff. 

PUL I Srauta 482. 48ff. 

Rajputana, p. 6. At Ujjain. 

Tanjore D.2069 = BL 3742. 87ff. 

Tanjore D.2070 = BL 3743. 90ff. 

Tanjore D.2071 = BL 9160b. Ff. 66-71. Grantha. 
Incomplete. 

Visvabharati (Adyar) 88(c). llff. Grantha. Incom¬ 
plete. 

VVBISIS 1371 (D). 17ff. Film of AS Bengal G.1854. 
WRI 5572. 89ff. 

Wai 1719. 70ff. 

Wai 1720. 12ff. Incomplete. 

Wai 1722. 12ff. Incomplete. 

The Sulbadlpikd was also edited by VibhQti- 
bhu§ana Bhattacarya in SBG 107, Varanasi 1979; 
and the edition by Satyaprakash and Ram Swarup 
Sharman was reprinted at New Delhi in 1980. 

The first verse is: 

baudhayaniyasulbasya pravyakhyah prek§ya 
yajvana // 

tikabhaftatmajeneyam kriyate sulbadipika// 

The last verse is: 

tikabhatfatmajeneyarn dvarakanathayajvana // 
trtiyo vyakrto ’dhyaya upapattisamanvitah // 

'^'DHANANJAYA (fl. 1733) 

1. Additional manuscripts of his Jyotiscandrodaya 
(see CESS A 3, 123b-124a): 

Bhubaneswar IV 63 (Jy/40). 108ff. Oriya. Copied by 
Madhusudana Jani through the favor of Udaya- 
pratapadeva at the Dhavalesvarasannidhi in 
Bhamuria in Saka 1793, the 15th ahka of Divya- 
sirnha = a.d. 1871. Incomplete. From Bhawa- 
nipatana, Kalahandi District. 

Bhubaneswar 2.Cy/91. 

2. He also wrote a Pdlakapanjikd, a pancahga for 
Saka 1655 = a.d. 1733. Manuscript: 

Bhubaneswar IV 116 (Jy/16). 27ff. Oriya. From 
Puri. 

The first verse is: 



150 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


indradivrndarakavrndavandyam 
natva murares caranaravindam // 
dhananjayo daivavidam hitartham 
karomy aham palakapanjikam tarn // 

3. Additional manuscripts of his Lllavatigan,ita (see 
CESS A 4, 117b), which is an Oriya translation of 
the Lllavan of Bhaskara (b. 1114): 

Bhubaneswar IV ganita 52 (G/5) = Bhubaneswar 
2.G/5. 123ff. Oriya. From Puri. 

Bhubaneswar 2.G/82; and G/83. 


^DHANARAJA (fl. 1635) 

Additional manuscripts of his MahMevldlpika 
(see CESS A 3, 124a-124b, and A 4, 117b): 

Pattan II 13263. 59ff. Copied in Sarn. 1752 = a.d. 
1695. 

*AS Bombay 254. 30ff. Copied by Malukacandra 
R§i, the pupil of Viracandra Rsi of the Parsva- 
candragaccha, at Radhanapura on Tuesday 9 suk- 
lapak^a of Jye^tha in Sam. 1809 = 9 June 1752. 
Pattan II 13927. 37ff. Copied in Sarn. 1835 = a.d. 
1778. 

Baroda 3229. 7ff. 

Panjab JB I 2028 (Ambala 129). 25ff. No author 
mentioned. 

RORI Cat. IV 19553. 35ff. (f. 4 missing). 

RORI Cat. IV 20216. 3ff. Incomplete (dasamabhava- 
sarani). 

RORI Cat. IV 20259. 3ff. Incomplete (tryaikya- 
ko§thakani). 

RORI Cat. VI 24499. 31ff. (ff. 25 and 27 missing). 
Incomplete. 


*DHANAVIJAYA VAC AKA {fl. 1662) 

Dhanavijaya wrote his stabaka on the Lokanali- 
kadvatritnsikd of Dharmagho§a (see CESS A 4, 
118a) at Rajavaranagara in Sarn. 1719 = a.d. 1662. 
Additional information concerning a manuscript: 

LDI (Gujarati) 264 (3898) = *LDI 3898. 9ff. 


DHANIKA BHAJTA 

Author of a bha§ya on Brahmagupta’s Khanda- 
khadyaka (665). Manuscript: 


RORI (Bikaner) 14760. 9ff. 

DHANIDASA 

Collaborator in composing a Khadipd^ha. Manu¬ 
script: 

Bhubaneswar IV gaiiita 5 (G/34). 142ff. Oriya. From 
Haladia, Khurdha, Puri District. 

DHANIRAMA 

Author of a fika, Jyotsna, on a Var^akrtya. 
Manuscript: 

BHU C.2337. 34ff. Copied in Sarn. 1897 = a.d. 
1840. 

DHANIRAMA 

The son of Tularama, Dhanirama wrote a 
Dvadasamasavratotsavavise^avidhi. Manuscript: 

RORI Cat. IX 28419. 56ff. (ff. 16-18 missing). Cop¬ 
ied in Sarn. 1890 = a.d. 1833. Incomplete. 

DHANESVARA 

Author of a Maghamahatmya. Manuscript: 
Udaipur RVSS 1554. 120ff. 

DHANESVARA 

Author of a Vibudhananda. Manuscript: 

BHU C.840. 2ff. 

^DHARANlDHARA 

Author of a Jatakapaddhati that most likely is 
identical with the Dharanldharipaddhati (see CESS 
A 3, 125a). Manuscript: 

RORI (Chittorgarh) 2633. 4ff. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


151 


DHARAN'IDHARA PUROHITA 

Author of a Grahanapaf fa. Manuscript: 

RORI Cat. VI 24081. 5ff. Copied by Srinatha 
Purohita at Jodhapura in Sam. 1691 = a.d. 1634. 


DHARAN'IDHARA BHATJA {fl. 1486) 

The son of Murari, Dharanidhara wrote an Eka- 
daslnirnayasara in Saka 1408 = a.d. 1486 during 
the reign of Visaladeva. Manuscript: 

Baroda 12052. 37ff. Copied in Margasir^a of Sarn. 
1620, Saka 1485 = 15 November-15 December 
1563. 


DHARAN'IDHARA NAY AKA (fl. ca. 1750) 

A member of the K§itivarnsa and the father of 
Lokanatha (fl. 1798). Dharanidhara wrote a number 
of works on ganita in Oriya: 

1. He collaborated in composing a Ganita. Manu¬ 
scripts: 

Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 

From Ranapur, Puri District. 

Bhubaneswar 2.G/94; and G/121. 

2. Dharanidhara ganita. Manuscript: 

Bhubaneswar IV ganita 34 (G/36) = Bhubaneswar 
2.G/36. 18ff. Oriya. From Bhubaneswar, Puri 
District. 

3. Dharanidhara cautisd. Manuscript: 

Bhubaneswar IV ganita 35 (G/21) = Bhubaneswar 
2.G/21a. 64ff. Oriya. From Ranapur, Puri Dis¬ 
trict. 

4. He collaborated in composing a Dhardna. Manu¬ 
script: 

Bhubaneswar IV ganita 36 (G/19) = Bhubaneswar 
2.G/19. 76ff. Oriya. From Kapileswar, Puri Dis¬ 
trict. 

5. He collaborated in composing a Nala cautisd. 
Manuscript: 


Bhubaneswar IV ganita 37 (G/39). 55ff. Oriya. From 
Kapileswar, Puri District. 

6. He collaborated in composing a Pdfhasamudra. 
Manuscript: 

Bhubaneswar IV ganita 46 (G/47). 35ff. Oriya. 

Incomplete. From Bhubaneswar, Puri District. 

7. He collaborated in composing a Mdganasindhu- 
kallola. Manuscript: 

Bhubaneswar IV ganita 49 (G/50). 84ff. Oriya. 

Incomplete. From Khurdha, Puri District. 

8. He collaborated in composing a Vdmphinala. 
Manuscript: 

Bhubaneswar IV ganita 57 (G/40). 50ff. Oriya. 

Incomplete. From Bhubaneswar, Puri District. 

DHARAN'IDHARA SASTRIN (fl. 1971) 

The son of Sivalala, the son of Devakinandana, 
Dharanidhara wrote a Sugamagrahasdnti at Aja- 
mera; this was published at Kisanagadha in Sam. 
2028 = A.D. 1971. The last 4 verses are: 

gr haprati§ thodyapanajye§ fhamuladisantisama- 
veta // 

atisugama grahasanti racita dharanidharenai^a //!// 
sunur devakinandanaputranayanapramodayasadya // 
srisivalalajadharanidharena raciteyam ajamere HIH 
jayapuravasisriyutaharakacandabudhapitrvyasam- 
matya // 

manyasuryanarayananamna dattah suto ’smabhyam 

//3// 

asuto^abalo ’yam janakasametas cirahjivyat // 
iti dharanidharavinitah sambhoh padabjayor 
bhaktya //4// 

DHARAN'IRAJA 

His Mahgalducikd was published by Harikr^na in 
his Mahgalds (aka, Aurahgabada 1885, ff. 3-3v. 


DHARAMU 

Collaborator in composing a Ganita in Oriya. 
Manuscript: 


152 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bhubaneswar IV ganita 12 (G/8). 170ff. Oriya. From 
Gac^amanitri, Khurdha, Puri District. 

DHARAJADHAVA 

Author of a tika on the Kundakalpadruma (of 
Vitfhala Dik§ita?). Manuscript: 

Benares (1953) 4325. Ff. 1-13. 

*DHARMAGHO$A SURI (d. 1300?) 

Additional manuscripts of his LokanMikddva- 
tritnsikd (see CESS A 4, 118a-119a): 

Pattan II 6983. 2ff. Copied in Sam. 1475 = a.d. 

1418. With an avacuri. No author mentioned. 
RORI (Bikaner) 13200. 2ff. Copied by Lavanyasila 
at Sripattana in Sarn. 1491 = a.d. 1434. With a 
Sarnskrta avacurni. 

LDI (KS) 597 (10443). 2ff. Copied in Sam. 1492 = 
A.D. 1435. With the avacuri of Kulamandana Suri 
(the mula is ascribed to Kulamandana, the 
avacuri to Jnanasagara). 

Pattan II 1006 (1). Ff. 1-2. Copied in Sarn. 1555 = 
A.D. 1498. 

Pattan II 1006 (2). Ff. 2-6. Copied in Sam. 1555 = 
A.D. 1498. With a vivarana. 

Panjab JB I 2269 (Amritsar 334). 3ff. Copied in 
Sarn. 1610 = a.d. 1553. With an avacuri. No 
author mentioned. 

Pattan II 5498. 4ff. Copied in Sam. 1631 = a.d. 
1574. With an avacuri. 

Panjab JB I 2264 (Amritsar 345). 3ff. Copied in 
Sam. 1651 = a.d. 1594. With an avacuri. 

RORI (Bikaner) 14164. 7ff. Copied by Jayanidhana 
in Sam. 1654 = a.d. 1597. With the Balava- 
bodha of Nayavilasa. 

Pattan II 4472 (4). Ff. 8-10. Copied in Sam. 1699 = 
A.D. 1642. With an avacuri. No author men¬ 
tioned. 

Pattan II 10952 (1). 4ff. Copied in Sarn. 1699 = a.d. 
1642. No author mentioned. (with a 
Jambiidvl pasahgrahan X ). 

RORI Cat. XVI 34050. 4ff. Copied in Sam. 1699 = 
A.D. 1642. No author mentioned. 

Pattan II 13985. 4ff. Copied in Sarn. 1724 = a.d. 

1667. With a GujarMi stabaka. 

Pattan II 4486. 3ff. Copied in Sarn. 1727 = a.d. 

1670. With an avacuri. No author mentioned. 
RORI (Bikaner) 16398. 7ff. Copied in Sam. 1754 = 
A.D. 1697. With the Bdldvabodha of Sahajaratna. 


RORI Cat. VI 24119. 6ff. Copied by Phatahecanda 
Muni in Sarn. 1815 = a.d. 1758. With a stabaka 
copied by Raiiganidhana. No author mentioned. 

RORI (Chittorgarh) 3728. 9ff. Copied by Punyasila 
Gani at Pali in Sarn. 1830 = a.d. 1773. With a 
vrtti. No author mentioned. 

RORI (Bikaner) 13726. 3ff. Copied by Sukhani- 
dhana Muni in Sam. 1864 = a.d. 1807. With a 
Sarnskrta avacuri. 

RORI (Jaipur) 5680. 9ff. Copied in Sarn. 1879 = 
A.D. 1822. With the Baldvabodha of Jasavijaya. 
No author mentioned. 

Pattan II 11658. 8ff. Copied in Sarn. 1885 = a.d. 
1828. With a Gujarati Bdldvabodha. No author 
mentioned. 

RORI (Bikaner) 16794. Ff. 76-80. Copied in Sarn. 
1887 = A.D. 1830. With a Sarnskrta avacuri. 

RORI (Jaipur) 6195. 8ff. Copied by Gusani Saiikara 
Jati at Vikramapura in Sarn. 1891 = a.d. 1834. 
With a fika. No author mentioned. 

RORI (Chittorgarh) 4594. 6ff. Copied in Sarn. 1909 
= A.D. 1852. With the fika of Molha. No author 
mentioned. 

Pattan II 12810. 51ff. Copied in Sarn. 1915 = a.d. 
1858. With the stabaka of Sahajaratna. No author 
mentioned. 

Panjab JB I 2270 (Amritsar 335). 8ff. Copied in 
Sarn. 1952 = A.D. 1895. With a tika. No author 
mentioned. 

LDI (VDS) 508 (9369). 7ff. Copied by Mohacandra. 
With a stabaka in Old GujarMi. 

Panjab JB I 2265 (Ambala 697). 9ff. No author men¬ 
tioned. 

Panjab JB I 2266 (Nakodar 358). 2ff. No author 
mentioned. 

Panjab JB I 2267 (Zira 351). llff. With a Gujarati 
Bdldvabodha. No author mentioned. 

Panjab JB I 2268 (Zira 668). 6ff. With a fika. No 
author mentioned. 

Pattan II 983. 2ff. With an avacuri. No author men¬ 
tioned. 

Pattan II 1187. 2ff. Ascribed to Devendra. 

Pattan II 1188. 4ff. With an avacuri. Ascribed to 
Devendra. 

Pattan II 1189. If. With an avacuri. Ascribed to 
Devendra. 

Pattan II 1191. 26ff. With a Gujarati Bdldvabodha. 
Ascribed to Devendra. 

Pattan II 3612. 3ff. No author mentioned. 

Pattan II 4388. 9ff. With an avacuri. No author men¬ 
tioned. 

Pattan II 4553. 3ff. With a Gujarati avacuri. No 
author mentioned. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


153 


Pattan II 4554. I4ff. With the Balavabodha of 
Udayasagara. 

Pattan II 4555. 6ff. With the Balavabodha of Molha. 

Pattan II 4556. 7ff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 4699. lOff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 4790. 2ff. No author mentioned. 

Pattan II 6982. 4ff. No author mentioned. 

Pattan II 6984. 8ff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 6985. 3ff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 7358. 4ff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 7687. 2ff. No author mentioned. 

Pattan II 7688. 2ff. With an avacuri. No author men¬ 
tioned. 

Pattan II 7691. 3ff. With a Gujarati tabartha. No 
author mentioned. 

Pattan II 7693. 5ff. With a Gujarati stabaka. No 
author mentioned. 

Pattan II 7817 (2). 4ff. No author mentioned, (with 
another work). 

Pattan II 10600. If. No author mentioned. 

Pattan II 11006. If. With a yantra. 

Pattan II 11007. 2ff. 

Pattan II 11008. 2ff. 

Pattan II 11009. 5ff. With the tika of Kulamandana. 

Pattan II 11010. 2ff. With the tika of Kulamandana. 

Pattan II 11011. If. With the tika of Kulamandana. 

Pattan II 11012 (1). If. No author mentioned, (with 
the Nandi svaradvlpavicarastava). 

Pattan II 11285 (3). 3ff. No author mentioned, (with 
3 other works). 

Pattan II 12711. 9ff. With the tika of Udayasagara. 
No author mentioned. 

Pattan II 12968. lOff. With the tika of Kalyanaji. 
No author mentioned. 

Pattan II 13399. 9ff. With a citra. No author men¬ 
tioned. 

Pattan II 13573. 8ff. With a tika. No author men¬ 
tioned. 

RORI Cat. IV 19839. 5ff. Copied at Jagattarini. 
With the Balavabodha of Jasavijaya. No author 
mentioned. 

RORI Cat. IX 29015. 4ff. (ff. 1-2 missing). Copied 
by Jasaraja R§i, the pupil of Jayacanda Suri. With 
a Rajasthani stabaka. Incomplete. No author 
mentioned. 

RORI Cat. IX 29206. 4ff. No author mentioned. 

RORI Cat. IX 29678. 8ff. With a Rajasthani 
Balavabodha. No author mentioned. 

RORI (Bikaner) 11731. Ff. 6-8. 


RORI (Bikaner) 13600. 4ff. Copied by Vivekacan- 
dra. With the avacuri of Jnanasagara. 

RORI (Bikaner) 13601. 7ff. 

RORI (Bikaner) 13735. 6ff. With a Sarnskrta ava¬ 
curi. 

RORI (Bikaner) 13827. 4ff. With a Sarnskrta ava¬ 
curi. 

RORI (Bikaner) 16558. 5ff. 

RORI (Chittorgarh) 774. 4ff. (f. 2 missing). With an 
avacuri. Incomplete. No author mentioned. 

RORI (Chittorgarh) 1110. 7ff. No author mentioned. 
RORI (Chittorgarh) 1134. 7ff. With a Rajasthani 
stabaka. No author mentioned. 

RORI (Chittorgarh) 1890. 2ff. Copied by Pandita 
Har^anandana. No author mentioned. 

RORI (Chittorgarh) 2423. 6ff. Copied by Sivaraja. 
With a Rajasthani stabaka. Incomplete. No 
author mentioned. 

RORI (Chittorgarh) 2925. 4ff. With a Rajasthani 
stabaka. No author mentioned. 

RORI (Chittorgarh) 3283. 3ff. No author mentioned. 
WHMRL /3 206. Ff. 1-4. With an Anhabalabodha. 

^DHARMAPATHIN (DHARMU PATHIN) 

The son of Gandharvananda of the Bharadvaja- 
gotra, Dharmapafhin (see CESS A 3, 125b), also 
known as Dharmu Pafhin or Dasa, wrote a Kalacan- 
drika. Manuscript: 

Bhubaneswar VII 34 (Dh/291). 49ff. Oriya. From 
Dharakota, Ganjam District. 

The Kalacandrikd was edited by Khagesvara 
Misra with his own notes, VijayasrUippanl, as 
Srisadasivakendriyasarnskrtavidyapl (haprakasaka 6, 
Puri 1986. The third verse is: 

bharadvajasagotrena sudhiya dharmupathina // 
smrtih sarvah paramrsya tanyate kalacandrika // 

At the end are the verses: 

smrtir ya dharmudasena racita kalacandrika // 
seyarn srikr§napadabjayuta bhQyat samarpita // 
gandharvanandaputrarn mam dasatvena svapada- 
yoh // 

aiigarn kurvantu santyajya sarva granthagatas 
trutih // 

The colophon begins: iti sridharmupurohitaviracita. 


154 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


^DHARMAMERU 

Additional information concerning the manu¬ 
script of the Sahgrahanistabaka (see CESS A 3, 
125b) of this member of the Kharataragaccha: 

LDI (Gujarati) 265 (60) = *LDI 60. lOOff. Copied 
by Muni Kapuraharnsa at Aupura in Sana. 1891 
= A.D. 1834. 

He was also the author of a Rajasthani fippana 
on the Jambudvtpasahgrahar}! of Haribhadra Suri 
(/?. ca. 1300). Manuscript: 

RORI Cat. VIII 26971. 64ff. Copied by Amalaka- 
candra at Pallikapattana in Sarn. 1903 = A.D. 
1846. 


DHARMASIMHA 

Author of a Hindi translation of the Sakuna of 
Vasantaraja (fl. ca. 1090/1100). Manuscript: 

PrSB 3727 (Berlin or. fol. 1667). 93ff. Copied by 
Gahgaprasada in Sarn. 1935 = A.D. 1878. 


DHARMU PATHIN 
See Dharmapathin. 


DHARMESVARA (b. 1594?) 

An udaharana on his Jatakapaddhati, presumably 
by Dharmesvara himself, is dated Sarn. 1651, Saka 
1516 = A.D. 1594; this is probably his own nativity. 

1. Additional manuscripts of his Vasanabha^ya (see 
CESS A 3, 126a, and A 4, 119b): 

Kathmandu (1964) 45 (6536). 72ff. Copied on Tues¬ 
day 6 suklapak§a of Jye^fha in Sam. 1767 = 23 
May 1710. 

RORI Cat. VI 24433. 54ff. Copied by Jhananidhana 
at Jayapura in Sam. 1853 = a.d. 1796. 

RORI Cat. XVI 36780. 93ff. Copied by Nanurama in 
Sam. 1888 = a.d. 1831. 

GJRI 8277/502. Ff. 1-53. Maithili. Copied in Saka 
1788 = A.D. 1866. 

GJRI 8276/501. Ff. 1-9. Incomplete. 


(see CESS A 3, 126a-127a, and A 4, 119b): 

RORI (Udaipur) 5193. Ff. 2-25. Copied in Sam. 

1792 = A.D. 1735. Incomplete. 

Kathmandu (1964) 125 (2925). No ff. given. Copied 
by Lihga Vipra on Thursday 4 suklapak§a of 
Bhadrapada in Saka 1699 = 27 August 1778. 
RORI (Udaipur) 6458. 33ff. Copied in Sam. 1847 = 
A.D. 1790. 

RORI (Udaipur) 6100. 22ff. Copied by Nandikes- 
vara Vyasa in Sam. 1852 = a.d. 1795. 

RORI Cat. VIII 26685. 19ff. (f. 1 missing). Copied 
in Sarn. 1854 = a.d. 1797. Incomplete. 

RORI (Alwar) 2768. 24ff. Copied in Sarn. 1912 = 
A.D. 1855. 

GJRI 8320/545. Ff. 1-19. Maithili. Copied in Saka 
1790 = A.D. 1868. 

NPS (Sanskrit) 8839. 16ff. Copied by Ramacandra 
Sarman on 2 krsnapak§a of Magha in Sarn 1927 
= ca. 7 February 1871. 

GJRI 8323/548. Ff. 1-15. Maithili. Incomplete. 
Oxford CSS I 274 (*d. 772 (6)). Ff. 1-14. 

Oxford CSS I 275 (d. 772 (7)). F. 6. Incomplete (end 
only). 

3. Additional manuscripts of his Jatakapaddhati (see 
CESS A 3, 127a, and A 4, 119b): 

VSM (Upadhye) 12754. 2ff. Copied by Nilakantha 
Budhe in Saka 1761 = a.d. 1839. 

WHMRL a 1390. If. Incomplete (verse 1). With an 
udaharana. 

4. Additional manuscripts of his Muhurtasiromani 
(see CESS A 3, 127a): 

Jodhpur 818 (A). 32ff. (ff. 1-2 missing). Copied by 
Sivarama Vyasa at Indraprastha in Sam. 1714 = 
A.D. 1657. Incomplete. 

RORI (Alwar) 2917 = *Alwar 1910. 57ff. Incom¬ 
plete (ends with rajyabhi^eka). 

The first two verses are: 

ganapatim abhivande vighnavidhvarnsanartham 
abhimataphalasiddhau bharatirn bhaskaradin // 
sulalitapadagumphajhaptaye ramacandrarn 
pitaram api gururn srimadhavam vitthalam ca //I// 
nanamunipravacanani vicarya samyag 
dharmesvaro nikhiladaivavidarn hitaya // 
sahk^iptam arthabahularn vitanoti rama- 
candratmajah subhamuhurtasiromanirn tu HIH 


2. Additional manuscripts of his Anvayarthadipika 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


155 


5. Additional information concerning the manuscript 
of his Subodhinl (see CESS A 4, 119b), which he 
completed on Thursday kamatithi of Radha in Sarn. 
1714 = 9, 16, 23, or 30 April 1657: 

*Jodhpur 851. 81ff. Copied by Satidasa, the son of 
Sridatta, a resident of Yoddhapura, on Saturday 
the second 13 of the suklapak§a of Asvina in 
Sarn. 1714, Saka 1579 = 10 October 1657. 

The first two verses are: 

harirn ganesam girijarn mahesarn 
sribhaskaracaryam aham namami 
sriramacandrarn pitararn gururn tarn 
srimadhavarn vifthaladik^itam ca //I// 
avyaktaganitavyakhyam sopapattirn subodhinim // 
satarn dharmesvaracaryah karoti jnanahetave HIH 

At the end are the verses: 

sridevadattasya suto ’tividyo 
yo malaviyo balabhadranama // 
ratnakaras tasya suto ’sya sunuh 
prabhakaro yasya ca ramacandrah // 
sriramacandrat susuve sutarn sri- 
dharmesvaram srir iva devayani // 
subodhini yena krtarkabije 
subhavitam bijam ihapa purtim // 

After the colophon is the verse: 

vedendughanatulyabde radhe kamatithau gurau // 
dharmesvarakrta purna bijatika subodhini // 

DHlRA SARMAN 

Author of a tika on the Brhajjdtaka of Varaha- 
mihira {fl. ca. 550). Manuscript: 

Vrndavana 1890. lOff. Bengali. 


^DHRTIKARA DVIVEDIN 

Additional manuscripts of his Daivajnavallabha 
(see CESS A 3, 127b): 

Rattan II 8850. Ff. 2-10. 

RORI (Jaipur) 4119. 37ff. Incomplete (to adhyaya 

6 ). 


NATH Drama 

Author (or scribe?) of an Arghakdnda. Manu¬ 
script: 

Udaipur RVSS 815. 2ff. Copied in Sarn. 1927 = a.d. 
1870. 


NANDADASA 

Author of a Mdrgaslrsamahatmya in Hindi. 
Manuscript: 

Jaipur (Khasmohor) 1200 (3). 


mANDAPANDITA 

Additional manuscript of his Jyotihsastrasamuc- 
caya (see CESS A 3, 128a-128b, and A 4, 

119b-120a), here entitled Jyotisasarasamuccaya: 

RORI (Alwar) 3011. 106ff. Copied in Sam. 1853 = 
A.D. 1796. 


^NANDAPANDITA {fl. ca. 1580/1630) 

1. Additional manuscripts of his Tattvamuklavali 

(see CESS A 3, 128b, and A 4, 120a): 

BORI 88 of 1899/1915 = BORI (Dharma) 492. 
135ff. Copied on Friday 6 suklapak§a of Aha- 
gana in Sarn. 1831 = 9 December 1774. With the 
tika of Venidatta. 

Mysore ORI C.4050/1. Ff. 1-165. Copied by Rama 
on 10 suklapak§a of Vaisakha in Saka 1723 = 
ca. 21 April 1801. With the tika of Venipandita. 

RORI (Udaipur) 3700. 29ff. Copied by Lunakarana 
Tirvadi in Sarn. 1910 = A.D. 1853. 

Benares (1956) 12000. Ff. 1-3, 5-73, 83, and 
87-210. Incomplete. 

Benares (1956) 12090. Ff. 1-10, 11/12, and 13-26. 

Benares (1956) 13304. Ff. 1-12. With the tika of 
Venidatta. 

BHU B.1981. 92ff. With the tika of Venipandita. 
Incomplete. 

Mysore ORI A.676/1. Ff. 1-223. Telugu. With a 
vyakhya. 

2. Additional manuscript of his Smrtisindhu (see 

CESS A 3, 128b, and A 4, 120a-120b): 


156 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Benares (1956) 13983. Ff. 1-27, 29-43, 43b-52, and 
52b-203. Copied in Sarn. 1811 = a.D. 1754. 
(dana). 

3. Additional manuscripts of his Vaijayanti (see 

CESS A 4, 120b-121a): 

BORI 39 of 1866/68 = BORI (Dharma) 335. Ff. 
1-27; 1-140; and 1-143. Copied on Monday 8 
suklapak§a of Karttika in Saka 1786 = 7 Novem¬ 
ber 1864. 

AS Bengal I.B.25. Bengali. 

Benares (1956) 12582. Ff. 1-25, 25b-43, 45-49, 
51-81, and 83-85. Incomplete (adhyayas 15-18). 

Benares (1956) 14141. Ff. 1-55. Incomplete (adhya¬ 
yas 15-18). 

Jaipur (Dharma) 410. 477ff. 

RORI Cat. VI 24826. 55ff. Incomplete (adhyayas 
1-3). 

RORI Cat. XVI 37227. Ff. 101-154. Incomplete. 

4. Additional manuscripts of his Vidvanmanohara 

(see CESS A 4, 121a): 

Benares (1956) 13629. Ff. 1-34; and 1-15. Incom¬ 
plete (adhyayas 2-4). 

Benares (1956) 13882. Ff. 1-7. Incomplete (adhyaya 
5). 

Benares (1956) 13883. 22ff. Incomplete (adhyaya 6). 

Benares (1956) 14058. Ff. 1-7. 

Jaipur (Dharma) 666. 12ff. 

5. Additional manuscript of his Pramitdk^ara (see 

CESS A 4, 121a): 

Benares (1956) 14167. Ff. 1-80. Incomplete. 


NANDARAMA 

The son of Hirananda, Nandarama wrote an 
A’ln i siydq (see C. A. Storey, Persian Literature, 
vol. 2, part 3, London 1977, p. 373), that is possibly 
identical with the Siyaq-namah ascribed to the same 
author and published at Lucknow in 1879 (see Sto¬ 
rey, p. 374). 


*NAND ARAM A MISRA (fl. 1763/1779) 

Nandarama’s father, Dipacandra, was the son of 
Jagadrama, the son of Kalyanamisra, the son of 
Hariscandra, the son of Bhalacandra of the Bhara- 
dvajagotra. 


1. Additional manuscript of his Grahanapaddhati 
(see CESS A 3, 128b): 

RORI Cat. XVI 35742. 4ff. Copied by Premalala in 
Sam. 1919 = a.d. 1862. 

2. Additional manuscripts of his Svarapahcasikd 
(see CESS A 3, 128b-129a): 

RORI (Alwar) 2985. 6ff. Copied in Sarn. 1908 = 
A.D. 1851. 

New Delhi, H. B. Lall 25. 5ff. (last f. numbered 6). 

3. Additional manuscripts of his Goladarpana or 
Bhdgavatajyoti^asastrabhugolakhagolavirodhapari- 
hara (see CESS A 3, 129a): 

RORI Cat. XVI 36818. 23ff. Copied by Bajurama 
Gujarati in Sarn. 1830 = a.d. 1773. No author 
mentioned. 

*Jodhpur 783. 20ff. Copied in Sarn. 1877 = a.d. 
1820. 

RORI Cat. IX 28626. 17ff. 

RORI Cat. IX 28681. 17ff. 

4. Additional manuscripts of his Kerallyaprasna- 
ratna (see CESS A 3, 129a-129b, and A 4, 121b): 

RORI (Alwar) 2840. 20ff. Copied by Hiralala Misra 
in Sarn. 1824 = A.D. 1767. 

RORI Cat. VII 25229. 2ff. Copied by Hariprasada 
Sarman in Sarn. 1832 = a.d. 1775. (Laghu- 
ratna). 

Vrndavana 8761. 17ff. Copied by Radhakr§na at 
Tak$akapura in Sarn. 1856 = a.d. 1799. 

(Prasnaratnasdra). 

RORI (Bikaner) 15933. 9ff. Copied in Sam. 1858 = 
A.D. 1801. 

RORI Cat. XVI 34263. 23ff. Copied by Himmata- 
rama at Jodhapura in Sam 1859 = a.d. 1802. 
Incomplete. (Prasnapradtpa). 

RORI Cat. XVI 37166. 19ff. Copied by Sivanatha in 
Sarn. 1868 = a.d. 1811. (Prasnapradlpa). With 
his own tika. 

RORI (Udaipur) 3141. 18ff. Copied by Ramajidasa 
Vyasa and Pu§karana Josi at Pali in Sam. 1889 
= A.D. 1832. (Keraliyasdraprasnaratna). 

New Delhi, H. B. Lall 5. 42ff. Copied on 10 kr^na- 
pak§a of Karttika in Sarp. 1903 = ca. 13 Novem¬ 
ber 1846. With his own fippani. 

RORI (Alwar) 2841. 40ff. Copied in Sam. 1912 = 
A.D. 1855. With his own tippani. 

*Jaipur (Khasmohor) 5584. With his own tippani. 
PrSB 2987 (Gottingen, Sanscr. Sham. 51). 20ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


157 


RORI (Alwar) 2842. 17ff. 

The edition with the Hindi tika of Sundaralala 
Sarman was reprinted at Kalyana-Bambai in 1987. 

5. Additional manuscripts of his Prasnaratnafippani 
(see CESS A 3, 129b-130a, and A 4, 121b): 

RORI Cat. XVI 37166. 19ff. Copied by Sivanatha in 
Sarn. 1868 = a.d. 1811. (Sahk^iptarthaprakasi- 
nl). 

New Delhi, H. B. Lall 5. 42ff. Copied on 10 kr§na- 
paksa of Karttika in Sarn. 1903 = ca. 13 Novem¬ 
ber 1846. 

RORI Cat. XVI 36275. 43ff. Copied in Sarn. 1903 = 
A.D. 1846. No author mentioned. 

RORI (Alwar) 2841. 40ff. Copied in Sam. 1912 = 
A.D. 1855. 

^Jaipur (Khasmohor) 5584. 

RORI (Chittorgarh) 214. 17ff. (ff. 1-9 missing). 
Incomplete. 

6. Additional manuscript of his tadarpana (see 
CESS A 3, 130a, and A 4, 121b): 

BHU C.4472. 4ff. (Nisekadarpana). 

7. Additional information concerning a manuscript 
of the Is (adarpapoddharana (see CESS A 3, 130a), 
which he composed in Sarn. 1832 = a.d. 1775: 

^Jaipur (Khasmohor) 5130. Copied in Sarn. 1834 = 
A.D. 1777. 

8. Additional manuscripts of his Sahketacandrikd 
(see CESS A 3, 130a): 

^Jaipur (Khasmohor) 5578. Copied in Sarn. 1834 = 
A.D. Mil. 

RORI (Alwar) 2724 = *Alwar 1986. 13ff. Copied in 
Sarn. 1909 = A.D. 1852. 

RORI (Alwar) 5468 (7). Ff. 34-40. Copied by 
Krstialala in Sarn. 1942 = A.D. 1885. 

9. Additional manuscripts of his Svarasdra (see 
CESS A 3, 130a-130b, and A 4, 121b): 

^Jaipur (Khasmohor) 5575. 

New Delhi, H. B. Lall 49. 12ff. 

11. Additional manuscripts of the Yantrasdra (see 
CESS A 3, 130b), which he composed in Saka 1693 
= A.D. 1771: 


*Poleman 4723 (Columbia, Smith Indie 127). 27ff. 
Copied by Ramakr§na Jyotirvid at Kalyatiaraya- 
jimandira on Tuesday 9 suklapak§a of A§adha in 
Sarn. 1891 = 15 July 1834. 

RORI (Alwar) 2635. 53ff. Copied in Sarn. 1910 = 
A.D. 1853. 

Verses 3-8 of the last adhyaya are: 

srimadbharadvajakule babhuva 
sribhalacandro nijakarmani^thah // 
catur§u tatsunu§u yo dvitiyo 
namna hariscandra itiha so ’bhut 11311 
manyo janaih keralividyaya yo 
bhavi§yavaktagamasastrani§thah // 
vedapraiiitacaranaikacittah 
sak§ad dhariscandra iva dvitiyah HAH 
kalyaiiamisreti babhuva namna 
tadauraso bhagrahasastradaksah // 
dvijarsabhanarn garianasu loke 
sarnstuyate ’dyapi janais tadakhya //5// 

§atsv asya putre§u babhuva mukhyo 
namna jagadrama iti dvitiyah // 
kr$iiasrayas tirtharucir vadanyo 
bandhupakare nirato yasasvi 11611 
catvarah santy asya putrah kani^tha 
jye§thas te§arn dipacandreti namna // 
yah silenajatasatrur vadanyo 
bhaktah srimannandasunor ananyah HIH 
catur§u mukhyas tanayo ’sya namna 
yo nandaramo gariite sucittah // 
tryahka^tisake ’krta yantrasararn 
govindapadambujalabdhabodhah //8// 

The colophon begins: iti srimisranandaramaviracite. 

14. Additional manuscripts of the Nirnayasdra (see 
CESS A 4, 121b), which he completed in Sarn. 1836 
= A.D. 1779: 

RORI Cat. VII 25172. 55ff. Copied in Sarn. 1894 = 
A.D. 1837. 

RORI Cat. VII 25355. 65ff. (f. 8 missing; f. 54 
repeated). Copied in Sarn. 1895 = a.d. 1838. 
RORI (Alwar) 3649 = *Alwar 1370. 108ff. (ff. 42 
and 92 missing). Copied in Sarn. 1912 = a.d. 
1855. Incomplete. 

RORI Cat. XVI 34016. 66ff. Copied in Sarn. 1959 = 
A.D. 1902. 

Verses 3-4 at the end are: 

yah srikamavane vraje nivasati sridipacandratmajo 
misro nanda iti pratham atigatas tenaditirthab- 








158 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


dhitah // 

saram saram ihoddhrtam tithikrte sviyatmanam 
jnaptaye 

yat tv atradhikam unam uktam api tac chodhyam 
dayardrair budhaih //3// 
rasagunadhrtimitavikramasamvatsarabodhani- 
divase // 

purttim agad grantho ’yam nirnayasaro ’tisank§iptah 

HAH 

15. He also wrote a Laghucintamani in Sarn. 1834 = 
A.D. Mil. Manuscripts: 

Jaipur (Khasmohor) 5574. 

RORI (Jaipur) 2477. 2Iff. Copied by Misranatha at 
Vijayagadha. With a sarin i. 

Verse 8, 8 is: 

vedakramebhavidhuvatsarasukrasukle 
yo nandaramavidu§a ravipu§yayoge // 
bhOmau hitaya jagatarn prakatikrto ’yam 
cintamanih sa dadatarn jagadipsitani // 

The colophon begins: iti srimisranandaramaviracite. 

NANDIKESVARA 

Author of a Kalacintamani; cf. the Kalottara of 
Nandikesvara. Manuscripts: 

Bhubaneswar VII 35 (Dh/522). 167ff. Oriya. From 
Sundaragrama, Cuttack District. 

Bhubaneswar VII 36 (Dh/523). 171ff. Oriya. With an 
anukramanika. From Sundaragrama, Cuttack 
District. 

The colophon begins: iti srimadudayacala- 
sikhararunamukutamanicaranaravindadvandvamaka- 
randapananirbharamattamadhukarasrinandikesva- 
racaryaviracite. 

NANDIKESVARA 

Author of a Kalajhana in Kannada. Manuscript: 

Mysore ORI A.47/24. Ff. 134-139. Telugu. 

He is probably also the author of a Nandikesva- 
ramata on prasna in Kannada. Manuscript: 

Mysore ORI P.7357. Ff. 1-11. Kannada. 


This may be identical with the Mu^icintdprasna 
ascribed to Vandikesvara. Manuscript: 

NPS (Sanskrit) 4701. Ff. 1-10. Copied in Sarn. 1860 
= A.D. 1803. 


NANDIKESVARA 

Author of a Rdsyddilak^ana. Manuscript: 
Dacca 552 G. See NCC, vol. 9, p. 331. 


^NANDIKESVARA (fl. ca. 1640) 

Additional manuscripts of his Gaijakamandana 
(see CESS A 3, 131a-131b), and A 4, 122a): 

RORI Cat. XVI 37066 (3). Ff. 13-14. Copied in 
Sam. 1851 = A.D. 1794. (ganitaprakarana; 

ascribed to Nandakesara). 

RORI Cat. IV 19000. 23ff. Copied by Sivarama at 
Pacevara in Sarn. 1855 = A.D. 1798. 

RORI Cat. XVI 37283. 29ff. Copied in Sarn. 1857 = 
A.D. 1800. 

Kathmandu (1964) 63 (651). 29ff. Copied by Kula- 
prasada on 15 suklapak§a of Pau§a in Sarn. 1887 
= ca. 29 December 1830. 

*Jaipur (Khasmohor) 5293. 

Kathmandu (1964) 60 (644). 30ff. 

Kathmandu (1964) 61 (641). 31ff. Incomplete. 
Kathmandu (1964) 62 (635). 23ff. Incomplete. 

Oxford CSS I 443 (*e. 147 (2)). Ff. 1-28. Incom¬ 
plete (to 3, 156). 

RORI Cat. XVI 34688. 29ff. 

RORI (Alwar) 2958. 49ff. 


*NANDISURI (fl. ca. 1747) 

Nandisuri was the son of Decanarya, the son of 
Madhavarya of the Gargyagotra. Additional 
manuscripts of his Kheiatantra (see CESS A 3, 
131b): 

Mysore ORI A.692/1. Ff. 1-29. Kannada. Incomplete 
(ends with madhyamadhikara). 

Mysore ORI P.2580/7. Ff. 93-102. Telugu. 

Mysore ORI P.9382/4. Ff. 1-2. Telugu. Incomplete. 

Verses 2-4 at the beginning are: 

gargyagotrasamudbhuto madhavaryo mahamatih // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


159 


tasyatmajo decanaryah sarvasastravisaradah HIH 
§adangavedaparajnah samastagamatantravit // 
tasya sunur aham nandi jyotihsastravicak^anah //3// 
khetatantram sphutam vak§ye balajnanaya 
tattvatah // 

pracinacaravi§ayam suryasiddhantasammatam HAH 

nandVsvara 

Author of a Rasicakra. Manuscript: 

GJRI 11122/1176. Ff. 1-2. Maithili. 


^NAYANASUKHOPADHYAYA {fl. 1729) 

Additional manuscripts of his Ukara (see CESS A 
3, 132a, and A 4, 122a): 

RORI Cat. IX 28480. 60ff. Copied on 6 kr§napak§a 
of Pausa in Sarn. 1952 = ca. 24 January 1897. 
RORI Cat. IX 28487 (4). Ff. 14-30. Incomplete. 

The Vkara was edited by VibhOtibha^ana Bhat- 
facarya as SBG 104, Varanasi 1978. 

He also was the author of the Yantrarajavicara 
in 20 adhyayas; this is a Sanskrit translation of the 
Risalat al-usturlab of Na§ir al-Din (1201/1274) (see 
CESS A 3, 145a, and A 4, 125a). Additional manu¬ 
scripts: 

BORI 179 of A 1883/84. Ff. 1-36. Copied on 6 
kr§napak§a of Jye^fha in Sarn. 1867 = ca. 21 
June 1810. No author mentioned. 

Benares 81865. Formerly property of Bhairavanatha. 
Mithila III 273. 15ff. Property of Pandita Rama- 
candra Jha of Mahinathapur, Deodha, Dar- 
bhanga. 

The Yantrarajavicara was published from the 
Benares manuscript by VibhOtibhu^ana Bhaftacarya 
as SBG 108, Varanasi 1979. 

The colophon is: iti nayanasukhopadhyayakrta- 
yantrarajavicaravirnsadhyayi arabitah sarnskrte 
nita. 

He is probably also the author of the treatise on 
the universal astrolabe invented by al-Zarqal in 
Spain, entitled Sarvade sly ajar akaliyantra. Manu¬ 
scripts: 

Cambridge R. 15.139a. Ff. 1-8. Copied by Bha- 


vanirama (as was R. 15.139b) on Thursday 2 suk- 
lapak§a of A§adha in Sam. 1859 = 1 July 1802. 

Baroda 9401. 9ff. (Sarvadeslyajakaliyantra). No 
author mentioned. 

Jaipur (Khasmohor) 4583. (Jarakaliyantra). No 
author mentioned. 


NAYAVIMALA GAN I 

Author of a stabaka in Gujarati on the Sahgra- 
hanilratna of Sricandra (fl. ca. 1150). Manuscript: 

Pattan II 1144. 46ff. 


^NAYAVILASA 

Additional manuscripts of his Baldvabodha on 
Dharmagho^a’s Lokanalikadvdtrirnsika (see CESS A 
4, 122b): 

RORI (Bikaner) 14164. 7ff. Copied by Jayanidhana 
in Sarn. 1654 = a.d. 1597. 

BORI 1297 of 1891/95. 8ff. (on Lokavicdra). 


mARACANDRA SURI (d. 1230) 

Additional manuscripts of his Naracandra (see 
CESS A 3, 132a-136a, and A 4, 122b): 

RORI Cat. IX 29371. 6ff. Copied by Sirnhameru 
Muni, the pupil of Sivadeva Gani, in Sam. 1540 
= A.D. 1483. 

Pattan II 8820. 8ff. Copied in Sarn. 1616 = a.d. 

1559. With a fippani. Incomplete (prakarana 1). 
RORI Cat. IV 19487. 14ff. Copied by Vira, the 
pupil of Caritrameru, at Nagapura in Sam. 1635 
= A.D. 1578. 

RORI Cat. XVI 34018. 12ff. Copied in Sam. 1667 = 
A.D. 1610. 

RORI (Chittorgarh) 4503. 15ff. (ff. 1-3 missing). 

Copied in Sam. 1667 = a.d. 1610. Incomplete. 
Pattan II 8819. 5ff. Copied in Sarn. 1679 = a.d. 

1622. Incomplete (prakarana 2). 

RORI Cat. II 9767. 20ff. Copied in Sam. 1699 = 
A.D. 1642. 

RORI Cat. VII 25384. 37ff. (f. 35 missing). Copied 
by Sridhara at Naranaula in Sarn. 1715 = a.d. 
1658. With the tika of Sagaracandra. 

RORI Cat. IV 15921 (1). 162ff. Copied by Vanarisa 
Megha at Manglana Godavada in Sarn. 1737 = 
A.D. 1680. (the first of 12 works). 


160 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Udaipur) 4257 (5). Ff. 48-170. Copied in 
Sam. 1744 = a.d. 1687. Incomplete. . 

Nagaur 983. 44ff. Copied on Tuesday 9 suklapak^a 
of Sravana in Sam. 1763 = 6 August 1706. 

RORI Cat. IV 20006. 23ff. Copied in Sam. 1763 = 
A.D. 1706. With a Rajasthani artha. Incomplete 
(prakarana 1). 

RORI Cat. XVI 36371. Ff. 2-23. Copied in Sam. 
1764 = A.D. 1707. With the tika of Sagara- 
candra. Incomplete. 

RORI Cat. VII 25888. 17ff. Copied by Samayadhira 
Gani in Sam. 1772 = a.d. 1715. With a fippana. 

RORI (Chittorgarh) 2995. 12ff. Copied in Sam. 1776 
= A.D. 1719. With the Uka of Sagaracandra. 

Oxford (Vyasa) 1. If. Copied by Subhasagara on Sat¬ 
urday 12 suklapak^a of A§adha II in Sarn. 1782, 
Saka 1647 = 10 July 1725. Incomplete. Formerly 
property of Sankara Visvanatha Vyasa. 

Nagaur 986. 26ff. Copied on 9 suklapak^a of Bha- 
drapada in Sarn. 1788 = ca. 30 August 1731. 

RORI (Bikaner) 14624. 36ff. Copied by Anan- 
datirtha in Sam. 1789 = a.d. 1732. With a 
Rajasthani stabaka. 

Panjab JB I 1456 (Nakodar 424). 20ff. Copied in 
Sam. 1790 = a.d. 1733. 

RORI (Chittorgarh) 2335. 2Iff. Copied by Deva- 
canda at Jodhapura in Sarn. 1803 = a.d. 1746. 

RORI (Bikaner) 14626. 12ff. Copied by Sukhahema 
Gani in Sarn. 1804 = a.d. 1747. Incomplete (pra¬ 
karana 1). 

RORI (Jaipur) 6481. 28ff. Copied by Jivanaji R§i in 
Sam. 1806 = a.d. 1749. Incomplete (prakarana 
1 ). 

RORI (Bikaner) 15868. 38ff. Copied at Rini in Sarn. 
1811 = A.D. 1754. With a Rajasthani stabaka. 

Jodhpur 806. 54ff. (f. 2 missing). Copied in Sam. 
1821 = A.D. 1764. With a tippani. Incomplete. 

RORI (Chittorgarh) 5252. 28ff. Copied at 

Santhananagara in Sam. 1830 = a.d. 1773. With 
a Rajasthani fippana. 

RORI Cat. IV 21525. llff. (f. 8 missing). Copied in 
Sam. 1831 = a.d. 1774. 

RORI (Bikaner) 14628. 89ff. Copied by Kusaladatta 
at Marota in Sam. 1832 = a.d. 1775. With a 
Rajasthani stabaka. 

Nagaur 989. 17ff. Copied on 1 kr§napak§a of Phal- 
guna in Sarn. 1837 = ca. 11 March 1781. With 
the tika of Bhujaditya. 

RORI (Bikaner) 17062. 33ff. Copied by Devacandra 
in Sarn. 1837 = a.d. 1780. 

RORI (Bikaner) 14625. 2Iff. Copied in Sarn. 1838 
= A.D. 1781. 

Panjab JB I 1455 (Zira 501). 64ff. Copied in Sam. 
1841 = A.D. 1784. 


RORI (Bikaner) 17105. 20ff. Copied in Sarn. 1841 
= A.D. 1784. 

RORI (Bikaner) 14623. 42ff. Copied by Dola at 
BhaggO in Sam. 1843 = a.d. 1786. With a 
Rajasthani stabaka. 

RORI (Bikaner) 14629. 15ff. Copied at Rini in Sarn. 
1845 = A.D. 1788. 

RORI (Jaipur) 6050. lOff. (ff. 1-2 missing). Copied 
by Kapuracanda at Pa(^ala in Sam. 1850 = a.d. 
1793. Incomplete. 

Panjab JB I 1457 (Amritsar 404). 49ff. Copied in 
Sam. 1852 = a.d. 1795. 

RORI Cat. XVI 36484. 54ff. Copied by Hararupa at 
Sojata in Sam. 1855 = a.d. 1798. With a stabaka. 

RORI Cat. XVI 35647. 6Iff. Copied at Kantaliya in 
Sam. 1865 = a.d. 1808. 

RORI (Chittorgarh) 548. Ff. 55-66. Copied by 
Nathurama at Ghanerava in Sarn. 1869 = a.d. 
1812. Incomplete. 

Pattan II 13823. llff. Copied in Sarn. 1871 = a.d. 
1814. 

RORI (Chittorgarh) 4381. 14ff. (ff. 1-9 missing). 
Copied by Navalarama at Gahgapura in Sam. 
1871 = A.D. 1814. Incomplete. 

Pattan II 13928. 22ff. Copied in Sam. 1875 = a.d. 
1818. 

Nagaur 980. 90ff. Copied on Monday 15 suklapak^a 
of Asvina in Sarn. 1879 = 28 October 1822. 

RORI (Chittorgarh) 4877. 32ff. Copied by Suma- 
tisena at NathOsata in Sarn. 1884 = a.d. 1827. 
With a Hindi tippana. 

RORI (Jaipur) 4910. 9ff. Copied at Jhunjhanu in 
Sam. 1884 = a.d. 1827. 

RORI Cat. IX 29830. 77ff. Copied in Sam. 1886 = 
A.D. 1829. With a stabaka. (after f. 62 come a 
Vivahapafala, a Meghamala, etc.). 

RORI (Alwar) 5157. 20ff. Copied by Khusalacanda 
at Paficapadara in Sarn. 1888 = a.d. 1831. 

RORI Cat. VIII 26697. lOOff. Copied by Rama Savai 
at Sojatanagara in Sarn. 1889 = a.d. 1832. 

RORI Cat. VI 24152. 69ff. Copied by Hukamacan- 
dra for Gaiigaramaji Bhattaji at Pali on Friday 
6 suklapak§a of Magha in Sam. 1890 = 14 Feb¬ 
ruary 1834. With the fippana entitled Yantra- 
koddhara. 

RORI Cat. IX 29871. 19ff. Copied by Khusalavijaya 
at Lakhaglavasa in Sarn. 1897 = a.d. 1840. 

Udaipur RVSS 447. 12ff. Copied in Sam. 1903 = 
A.D. 1846. Incomplete. Ascribed to Maharama. 

Pattan II 5100. 4Iff. Copied in Sam. 1936 = a.d. 
1879. With a Gujarati stabaka. 

RORI Cat. VIII 27451 (2). Ff. 7-13. Copied by 
Amrtalala Bhojaka in Sam. 1936 = a.d. 1879. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


161 


RORI Cat. IV 20626. 59ff. Copied in Sam. 1943 = 
A.D. 1886. 

RORI Cat. V 22148. 3Iff. Copied by Hajarimala at 
Jaitarana in Sam. 1943 = A.D. 1886. With a 
Balavabodha in Old Rajasthani. 

RORI (Chittorgarh) 2653. 37ff. Copied in Sam. 1943 
= A.D. 1886. With a Rajasthani stabaka. 

Jaipur (Khasmohor) 5062. With the tika of Sagara- 
candra. 

Nagaur 981. 23ff. 

Nagaur 982. 3Iff. 

Nagaur 984. 25ff. 

Nagaur 985. 25ff. 

Oxford (Vyasa) 2. Ff. 1-38. With the lippanaka of 
Sagaracandra. Incomplete. Formerly property of 
Sankara Visvanatha Vyasa. 

Panjab JB I 1458 (Patti 188). 41ff. 

Panjab JB I 1459 (Patti 189). Ff. 2-26. 

Panjab JB I 1460 (Ambala 580). 42ff. 

Pattan II 2756. 49ff. With a tippana. Incomplete 
(ends in prakarana 2). 

Pattan II 2757. 37ff. With a fippana. Incomplete 
(ends in prakarana 2). 

Pattan II 2758. 9ff. Incomplete (prakarana 1). 

Pattan II 2759. 17ff. Incomplete (prakarana 1). 

Pattan II 2760. 34ff. Incomplete (prakarana 1). 

Pattan II 7267. llff. Incomplete (prakaranas 1-2). 

Pattan II 7268. 30ff. With the tika of Sagaracandra. 

Pattan II 7269. 32ff. With the tika of Sagaracandra. 

Pattan II 7355. 6ff. Incomplete (prakarana 1). 

Pattan II 8821. 8ff. With a tippana. Incomplete (pra¬ 
karana 1). 

Pattan II 8822. 5ff. Incomplete (prakarana 1). 

Pattan II 8823. 6ff. Incomplete (prakarana 1; incom¬ 
plete). 

Pattan II 8824. Ff. 7-22. With the tika of Sagara¬ 
candra. Incomplete (prakarana 2; incomplete). 

Pattan II 13040. 43ff. With the tika of Sagaracan¬ 
dra. Incomplete. 

Pattan II 14726. 29ff. Incomplete (prakarana 1). 

RORI Cat. IV 19459. 8ff. (ff. 4-6 missing). Incom¬ 
plete (to prakarana 2). 

RORI Cat. IV 19486. 5ff. With a Rajasthani ava- 
curni. 

RORI Cat. VI 24072. 29ff. Incomplete. 

RORI Cat. VI 24116. 4Iff. With a stabaka in Old 
Hindi. 

RORI Cat. VI 24483. 13ff. (ff. 5 and 7 missing). 
With a vrtti. Incomplete. 

RORI Cat. VII 25606 (1). 5ff. Incomplete. 

RORI Cat. VIII 26958. 5ff. With a tippana. 

RORI Cat. IX 29940. 15ff. 

RORI Cat. XVI 34338 (5). Ff. 32-44. (Jyoti^a- 


sahgraha). With a Dvdrasahgrahaiikd in 
Rajasthani. 

RORI Cat. XVI 34482. 32ff. Copied by Cunnilala 
Vaidya at Jasola. 

RORI (Alwar) 2955. 13ff. 

RORI (Alwar) 5492. 14ff. Incomplete. 

RORI (Bikaner) 14622. 39ff. With a Rajasthani sta¬ 
baka. 

RORI (Bikaner) 14627. 7ff. 

RORI (Bikaner) 15897. Ff. 9-21. With a Rajasthani 
artha. 

RORI (Bikaner) 15902. 9ff. 

RORI (Bikaner) 17126. 34ff. 

RORI (Bikaner) 17265. 9ff. 

RORI (Chittorgarh) 1652. lOff. Incomplete. 

RORI (Chittorgarh) 2263. 7ff. Incomplete. 

RORI (Chittorgarh) 2287. 2ff. Incomplete. 

RORI (Chittorgarh) 2762. 6ff. 

RORI (Chittorgarh) 2898. 43ff. (f. 1 missing). Cop¬ 
ied by Meghavijaya. With a Rajasthani stabaka. 
Incomplete. 

RORI (Chittorgarh) 2901. 18ff. With the fippana 
entitled Yaniroddhdra. Incomplete. 

RORI (Jaipur) 5809. 13ff. With a Rajasthani sta¬ 
baka. Incomplete. 

RORI (Jaipur) 6272. 22ff. Incomplete. 

RORI (Jaipur) 6654. 14ff. 

RORI (Jaipur) 6900. 38ff. Incomplete. 

RORI (Jaipur) 6925. 5ff. Incomplete. 

RORI (Jaipur) 7005 (1). 14ff. Incomplete (to surya- 
candrasarnyoga). 

RORI (Jaipur) 7273. 4ff. Incomplete. 

RORI (Jaipur) 7359. 12ff. (ff. 1-6 missing). Incom¬ 
plete. 

RORI (Jaipur) 8007. 9ff. Incomplete. 

RORI (Jaipur) 8087. 27ff. Incomplete. 

RORI (Jaipur) 10199. 56ff. Copied by Haranatha at 
Korata. With a Rajasthani stabaka. 

RORI (Udaipur) 4016 (47). Ff. 139-157. 

RORI (Udaipur) 4092 (2a). Ff. 35-40. Incomplete. 


*NARACANDROPADHYAYA (fl. 1167/1177). 

3. 4. Additional manuscripts of his Janmasamudra 
and Beddvrtti (see CESS A 3, 136b, and A 4, 122b): 

Pattan II 8837. 8ff. Copied in Sarn. 1643 = A.D. 
1586. With his own tika. 

RORI (Alwar) 5436. 8ff. Copied by Baladatta in 
Sarn. 1934 = A.D. 1877. (Veddjdtaka). 

RORI Cat. VIII 27138. 36ff. (f. 1 missing). With his 
own tika. Incomplete. 


162 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. XVI 36855. 18ff. With his own tika. 
Incomplete. 

5. Additional manuscript of his Jhanacaturvimsika 
(see CESS A 3, 137a, and A 4, 122b): 

Pattan II 5101. If. With the avacuri of SMhuraja 
Gani. 

*NARAPATI (fl. 1177) 

Additional manuscripts of his Narapatijayacarya 
(see CESS A 3, 137a-142a, and A 4, 122b-123b): 

Pattan II 12526. 47ff. (ff. 1-5, 18-21, and 36-37 
missing). Copied in Sam. 1438 = a.d. 1381. 
Incomplete. 

Udaipur RVSS 1637. 177ff. Copied in Sam. 1594 = 
A.D. 1537. Incomplete. 

RORI Cat. XVI 34371. 41ff. Copied by Dadhisuta in 
Sam. 1629 = a.d. 1572. 

RORI (Udaipur) 5519. 58ff. Copied by Ramaji, the 
son of Govardhana, at Ahimadabada in Sam. 
1633 = A.D. 1576. Incomplete. 

PrSB 3722 (Berlin or. fol. 1822). 68ff. Copied for 
Caturbhuja Pandita at Sahasravanagara on 
Thursday 13 suklapak$a of Sravana in Sam. 1669 
= 30 July 1612. 

Oxford CSS I 173 (*c. 425). If.; ff. 2-40 and 42; and 
ff. 1-6. Bengali. Copied by Ramagovinda Sarman 
in Sam. 1677 = a.d. 1620. 

Pattan II 9765. 4ff. Copied in Sarn. 1678 = A.D. 

1621. Incomplete (sarvatobhadracakra). 

Jaipur (Khasmohor) 5375. Copied in Sam. 1727 = 
A.D. 1670. (Samudrikasastra). 

Kathmandu (1965) 97 (5039). 27ff. Copied by Sava- 
ladasa Kayastha at Ramapura in Sarn. 1750 = 
A.D. 1693. With the Uka of Harivarnsa 
Mahadeva. 

RORI Cat. IX 28534. 133ff. Copied by Akhairaja 
Yati at Jayapura in Sarn. 1771 = a.d. 1714. 
Bhubaneswar IV 85 (Jy/14). 62ff. Oriya. Copied in 
atika 10 of Ramacandra = a.d. 1731. 

Jodhpur 804. 65ff. Copied in Sam. 1788 = a.d. 
1731. 

RORI Cat. IX 28631. 140ff. (ff. 93-96 missing). 
Copied at Indraprastha in Sarn. 1803 = a.d. 
1746. With the tika of Harivarnsa. Incomplete. 
Gauhati II 898. 53ff. Copied in Saka 1672 = a.d. 
1750. 

RORI Cat. VIII 26783. 208ff. Copied by BhQraji in 
Sam. 1823 = a.d. 1766. 

RORI Cat. IV 22142. 113ff. Copied by Dayakr^na at 


Jayapura in Sam. 1825 = a.d. 1768. 

BM Or. 13638. Copied in Saka 1691 = a.d. 1769. 
RORI Cat. IV 20990. 64ff. Copied by K§antivijaya, 
the pupil of Bhagyavijaya, at Kr^nagadha in Sarn. 
1826 = A.D. 1769. 

RORI Cat. XVI 34727. 78ff. Copied by Nathamalla 
Bhatta at Syananagara in Sam. 1830 = a.d. 
1773. 

GJRI 8475/700. Ff. 1-41. Maithili. Copied on Friday 
14 kr§napak§a of Pau§a in Saka 1702 = 21 Janu¬ 
ary 1780. 

RORI Cat. VII 25226. 174ff. (ff. 116-172 missing; ff. 
46-47 repeated). Copied by Hariprasada Sarman 
at Jayanagara in Sam. 1837 = a.d. 1780. Incom¬ 
plete. 

Gauhati II 987. 37ff. Copied by Devanatha Sarman 
in Saka 1709 = a.d. 1787. 

RORI Cat. XVI 35173. Ff. 2-186. Copied in Sam. 
1855 = A.D. 1798. With the tika of Harivarnsa. 
Incomplete. 

RORI Cat. VI 23983. 154ff. Copied in Sarn. 1858 = 
A.D. 1801. 

RORI (Chittorgarh) 5033. 129ff. Copied in Sarn. 

1860 = A.D. 1803. 

PrSB 3724 (Berlin or. oct. 735). 6ff. Copied on 
Tuesday 8 kr§napak§a of Bhadrapada in Sarn. 

1861 = 25 September 1804. Incomplete (panca- 
svaracakra). With the fika of Harivarnsa. 

Kathmandu (1965) 95 (5036). Ff. 1-248. Copied in 
Sarn. 1875 = A.D. 1818. With the tika of Nara- 
hari. 

RORI (Alwar) 5516. lOOff. Copied in Sarn. 1891 = 
A.D. 1834. 

Oxford CSS I 174 (*d. 767 (4) II). Ff. 18-27. Copied 
by Gaiiesabhatta Vodasa at KaU shortly after 22 
May 1841. Incomplete. 

RORI (Alwar) 2969. 102ff. Copied by Sivarama at 
Mojapura in Sarn. 1899 = a.d. 1842. 

RORI (Chittorgarh) 355. 46ff. (f. 44 missing). Cop¬ 
ied by Baladeva at Baravada in Sarn. 1906 = a.d. 
1849. 

RORI (Alwar) 2972. 169ff. Copied by Kanirama at 
Umarena in Sarn. 1908 = a.d. 1851. 

RORI (Udaipur) 6142. 7ff. (ff. 1-3 missing). Copied 
by Haridatta at Maiidava in Sarn. 1925 = a.d. 
1868. Incomplete (sarvatobhadra). 

PrSB 3723 (Berlin or. fol. 2136). 150ff. Copied by 
Haragovinda Parika, a Brahmana, at Savai Jaya¬ 
nagara on 3 suklapak§a of Asvina in Sarn. 1939 
= ca. 15 October 1882. With the tika of Hari¬ 
varnsa. 

Jammu 794. 161ff. Copied in Sarn. 1942 = a.d. 
1885. 

AS Bengal I.A.66. Bengali. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


163 


BHU B.641. lOlff. Incomplete. 

BHU B.4401. 4ff. With the tika of Harivamsa. 
Incomplete (ahicakra). 

BHU C,775. 48ff. Sarada. Incomplete. 

BHU C.829. 54ff. Incomplete. 

BHU C.1600. 71ff. Incomplete. 

BHU C.2012. 15ff. Incomplete. 

BHU C.3275. 23ff. Incomplete. 

BHU C.4688. 107ff. Sarada. 

Bhubaneswar IV 86 (Jy/38). 138ff. Oriya. With the 
tika of Narahari. Incomplete. From Khallikota, 
Ganjam District. 

Bhubaneswar IV 87 (Jy/61). 39ff. Oriya. Incomplete 
(to toranacakra). From Malatipatapur, Puri 
District. 

Bhubaneswar IV 88 (Jy/64). 23ff. Oriya. Incomplete. 
From Ranapura, Puri District. 

Bhubaneswar IV 176 (Jy/118). 52ff. Oriya. Incom¬ 
plete. With the tika of Narahari. From 
Bhubaneswar, Puri District. 

Gauhati II 1017-1. Off. Incomplete. 

Gauhati II 1138. 29ff. Incomplete. 

GJRI 8476/701. Ff. 1-71. 

GJRI 8477/702. Ff. 1-3. Maithili. Incomplete. 

GJRI 11055/1109. Ff. 1-2. Maithili. Incomplete 
(vanacakra and dipacakra). 

GVS 2944 (1648). 34ff. Incomplete (sapta- 

nadicakra). With the tika of Mahadeva. 

^Jaipur (Khasmohor) 2335; 4957; 4971; 5023; 5042; 
5045; 5072; 5386; 5444; 5453; 5468; and 5528 
(the last two entitled Samudrikasastra). 

Jodhpur 805 (A). 80ff. Incomplete. 

Jodhpur 805 (B). 5ff. Incomplete. 

Kathmandu (1960) 428 (I 1336). 44ff. Nevari. With 
the Suddhidlpikd of Srinivasa. Incomplete. 

Kathmandu (1965) 91 (557). No ff. given. 

Kathmandu (1965) 92 (564). 86ff. Incomplete 
(matradisvaracakra to abhi§ekamandalavidhi). 

Kathmandu (1965) 93 (553). 40ff. Incomplete (pur- 
vardha). 

Kathmandu (1965) 94 (551). 139ff. Incomplete 
(uttarardha). 

Kathmandu (1965) 96 (5039). Ff. 1-129; and 99 
(5039). Ff. 141-164. With the tika of Hari¬ 
vamsa Mahadeva. Incomplete. 

Kathmandu (1965) 102 (582). 167ff. With a Nevari 
translation. 

Mysore ORI C.3087. Ff. 1-86. Incomplete (ends in 
kelikundalayantra). 

Mysore ORI C.3780/1. Ff. 1-12. Telugu. (Svaro- 
daya). 

Mysore ORI *P.132/la. Ff. 1-59. Telugu. (sarvato- 
bhadracakra); and P 132/2. Ff. 60-66. Telugu. 
(kotacakra). 


Mysore ORI *P.212/1. Ff. 57-61. Nandinagari. 
(sarvatobhadracakra; incomplete); and P 212/8. 
Ff. 117-118. Nandinagari. (kotacakra). 

Mysore ORI P.313/1. Ff. 1-12. Nandinagari. Incom¬ 
plete (ends with kurmacakra). 

Mysore ORI P.665. Ff. 81-111. Kannada, (kotaca¬ 
kra). 

Mysore ORI *P.810/1. Ff. 1-18. Telugu. (sarvato¬ 
bhadracakra); and P 810/3. Ff. 19-25. Telugu. 
(kotacakra). 

Mysore ORI P.989/6. Ff. 55-76. Nandinagari. 
(kotacakra; and puracakra 1-5). 

Mysore ORI *P. 1723/1. Ff. 1-23. Telugu. (sarvato¬ 
bhadracakra). 

Mysore ORI *P. 1798/3. Ff. 72-74. Nandinagari 
(sarvatobhadracakra; incomplete). 

Mysore ORI P.1802/4. Ff. 52-197. Telugu. Incom¬ 
plete (adhyayas 1-3). 

Mysore ORI P.2252/1. Ff. 46-168. Telugu. Incom¬ 
plete (to stambhanavidhi). 

Mysore ORI P.2639. Ff. 89-139. Telugu. Incomplete 
(ends with ghufikaprayoga). 

Mysore ORI P.3172/4. Ff. 1-7. Telugu. (kotacakra; 
incomplete). 

Mysore ORI P.3182/1. Ff. 1-6. Grantha. (sarvato¬ 
bhadracakra). 

Mysore ORI P.4333/10. Ff. 44-64. Nandinagari. 

(sarvatobhadracakra). 

Mysore ORI P.4443/2. Ff. 112-125. Telugu. (sarva¬ 
tobhadracakra; incomplete). 

Mysore ORI P.4485/2. Ff. 6-9. Nandinagari. (sarva¬ 
tobhadracakra). 

Mysore ORI P.4561. Ff. 1-71. Nandinagari. Incom¬ 
plete (to jalaphanicakra). 

Mysore ORI P.4618/6. Ff. 1-10. Nandinagari. 

(sarvatobhadracakra; incomplete). 

Mysore ORI P.5693/4. Ff. 26-34. Nandinagari. 

(sarvatobhadracakra; incomplete). 

Mysore ORI P.5789/1. Ff. 1-61 and If. Telugu. 
Incomplete (adhyayas 1-3). 

Mysore ORI P.5947/14. F. 24. Kannada, (kotacakra; 
10 slokas only). 

Mysore ORI P.6655/1. Ff. 65-73. Telugu. (sarvato¬ 
bhadracakra). 

Mysore ORI P.6748. Ff. 1-63. Nandinagari. Incom¬ 
plete (bhQbala to toranacakra). 

Mysore ORI P.6761/1. Ff. 152-178. Kannada. 
Incomplete (to caturasiticakra); and P 6761/3. Ff. 
179-192. Kannada, (sarvatobhadracakra). 

Mysore ORI P.7367/1. Ff. 1-12. Telugu. (sarvato¬ 
bhadracakra). 

Mysore ORI P.7390/10. Ff. 122-159. Telugu. Incom¬ 
plete (adhyayas 1-4). 


164 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.7457/3. Ff. 134-144. Nandinagari. 
(kotacakra; ascribed to Padmaditya); and 
P.7457/4. Ff. 134-144 (sic!). Nandinagari. 

(Svarodaya\ incomplete). 

Mysore ORI P.7514/6. 4ff. Telugu. (sarvatobhadra- 
cakra). 

Mysore ORI ?.16391X6. Ff. 1-17. Telugu. (sarvato- 
bhadracakra). 

Mysore ORI P.8078/10. Ff. 108-150. Kannada. 
Incomplete. 

Mysore ORI P.8514/10. 30ff. Nandinagari. (kofaca- 
kra). 

Mysore ORI P.8773/12. Ff. 15-17. Nandinagari. 
Incomplete. 

Mysore ORI P.9270/9a. Ff. 93-116. Telugu. (sarvato- 
bhadracakra). 

Mysore ORI P.9657/1. Ff. 155-165. Nandinagari 
(kotacakra; incomplete). 

Mysore ORI P.9700/1. Ff. 1-14. Nandinagari. 
(sarvatobhadracakra). 

Mysore ORI P.9710/7. Ff. 95-113. Telugu. (kotaca¬ 
kra; incomplete). 

Mysore ORI P.9725/6. 27ff. Telugu. (sarvatobhadra¬ 
cakra; incomplete). 

Mysore ORI P.9753/7a. 8ff. Kannada, (sarvato¬ 
bhadracakra; incomplete). 

Mysore ORI P.9942/14a. Ff. 174-220. Telugu. 
Incomplete (cakrakhanda). 

Mysore ORI P.10059/la. If. Telugu. (kotacakra; 
incomplete); and P.10059/18a. Ff. 87-103. 
Telugu. (kotacakra; incomplete). 

Mysore ORI P.10279/2. Ff. 1-10. Nandinagari. 
(sarvatobhadracakra). 

Mysore ORI P.16262/2. 35ff. Nandinagari. (Svaro- 
daya\ incomplete). 

New Delhi, H. B. Lall 52. llOff. Mixed with folia 
from some other manuscript. 

New Delhi, N. M. 63/885. 201ff. 

New Delhi, N. M. 63/904. 206ff. 

Oxford CSS I 175 (*d. 759) I. Ff. 1-42, '48-49, 
49b-93, and 93b-lll. Copied by Ramabhadra 
Sarman. 

Oxford CSS I 176 (d. 769 (9) B). Ff. 2-3 and 
6-<7>. (ahibalacakra; incomplete). 

Oxford CSS I 177 (d. 771 (4)). Ff. 1-6. (sarvato¬ 
bhadracakra). 

Oxford CSS I 178 (e. 149 (2)). Ff. 1-9. Incomplete. 

Oxford CSS I 179 (*e. 247 II). Ff. 34-35 and If. 
(saptanadicakra). 

PrSB 2984 (Gottingen Sanscr. Sham 2). 75ff. Sarada. 

PrSB 2985 (Gottingen Sanscr. Madh 9). 126ff. 

RORI Cat. IV 18300. 3ff. Incomplete. 

RORI Cat. IV 19507. 93ff. With the tika of Maha- 


deva. Incomplete. 

RORI Cat. VI 23982. 15ff. Incomplete (adhyaya 2 to 
nadicakra). 

RORI Cat. VI 24820. If. With the tika of Narahari. 
(Svarodaya). 

RORI Cat. VII 25760. 105ff. (ff. 1-12, 38, and 56-57 
missing; ff. 65-68 repeated). Incomplete. 

RORI Cat. VII 26451. 53ff. (f. 20 repeated). 

RORI Cat. IX 29347. 32ff. Incomplete. 

RORI (Alwar) 2971. 104ff. 

RORI (Alwar) 2994. 29ff. (sarvatobhadra). 

RORI (Alwar) 2995. 9ff. (saptanadicakra). 

RORI (Alwar) 2996. 8ff. (ahibalacakra). 

RORI (Alwar) 2999. 5ff. (purahayogMi). 

RORI (Alwar) 3000. 13ff. (kurmacakradi). 

RORI (Chittorgarh) 2668. 3ff. (sarvatobhadracakra). 

RORI (Chittorgarh) 2755. 4ff. Incomplete. 

RORI (Chittorgarh) 3544. 14ff. 

RORI (Chittorgarh) 5409. 16ff. 

RORI (Jaipur) 5500 (1). 33ff. (f. 29 missing). 
Incomplete. 

RORI (Jaipur) 9408. 19ff. Incomplete. 

Udaipur RVSS 873. 85ff. With the tika of Hari- 
vamsa. Incomplete. 

Udaipur RVSS 1290. 4ff. Incomplete. 

Vrndavana 217. lOOff. 

Vrndavana 9088. 12ff. With the tika of Mahadeva. 

*WHMRL G.29.a. Ff. 1-3. (pathicakra; kotacakra; 
and yamadam§traphalaphalacakra). 

WHMRL a 31. Ff. 1-3. (dasahgarahukalanalasu- 
bhasubhaphala). 


^^NARAHARI 

Additonal information concerning the manuscript 
of his Tithicakra = Tithidarpana (see CESS A 3, 
142b): 

Wien UB 280 (I 67112). Ff. 1-17. Acquired in 1891. 


NARAHARI DAIVAJNA SAPTAR^I 

Author for Visvambhara Panc^ita of a Kunda- 
mandana = Mandapakundamandana in 60 verses, on 
which he wrote his own vyakhya, entitled Prakdsa\ 
cf. Nrhari Saptar§i (see CESS A 3, 207a). Manu¬ 
scripts of both mula and vyakhya: 

Oudh IX (1877) XIX 4. 76ff. Copied in 1839. (Pra- 
kdsikd). Property of Pandita Devidin of Pratab- 
garh Zillah. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


165 


RORI (Alwar) 3753. 109ff. Copied in Sam. 1912 = 
A.D. 1855. 

Baroda 9322. 67ff. 

lO 3161 (1254 c). 42ff. From H. T. Colebrooke. 

The first verse of the mula is: 

kurmanantadharamrtarnavamanidvipe ’tha 
kalpadruma- 

dhas cintamanimandape suvilasaddhrdratnavedyam 
vibhum // 

i^tvatah sumanorathoparacitaih svargaiigapadmadi- 
bhih 

saptar^ir nrharir bahir vitanute sanman^apady arci- 
tum // 

The colophon begins: iti srisaptar^yupakhyanara- 

haridaivajnaviracita. 

NARAHARI NAY AKA 

Author of a Ganita. Manuscripts: 

Bhubaneswar 2.G/101. 

Bhubaneswar IV ganita 55 (G/28). 54ff. Oriya. At 
end of manuscript. From Jagatsirnhapur, Cuttack 
District. 


NARAHARI SUKLA 

Author of a Tattvapradlpika. Manuscript: 
Mithila. See NCC, vol. 9, p. 370. 


^NARAHARI (fl. ca. 1500) 

Additional manuscripts of his Vydkhydplava (see 
CESS A 3, 143a-143b, and A 4, 124b): 

RORI (Udaipur) 6117. lOff. Copied in Sam. 1837 = 
A.D. 1780. 

RORI (Alwar) 2973. 161ff. Copied by Jiva Misra at 
Bharatapura in Sarn. 1863 = A.D. 1806. 

Varendra 112. 89ff. Bengali. Copied on 9 Agrahaya- 
na in Saka 1734 = ca. 18 December 1812. 

RORI Cat. XVI 36798. 175ff. Copied in Sam. 1957 
= A.D. 1900. 

AS Bengal I.A.66. Bengali. 

BHU B.696. 65ff. Incomplete. 

Bhubaneswar IV 86 (Jy/38). 138ff. Oriya. Incom¬ 
plete. From Khallikota, Ganjam District. 


Bhubaneswar IV 176 (Jy/118). 52ff. Oriya. Incom¬ 
plete. From Bhubaneswar, Puri District. 

Kathmandu (1965) 95 (5036). Ff. 1-248. Incomplete. 

New Delhi, H. B. Lall 50. 137ff. Incomplete (ends in 
tithikalacakra). 

Poona, Mandlik. Jyoti$a 34. 88ff. Ascribed to Nrsirn- 
ha. 

RORI Cat. VI 24820. If. Incomplete. 

RORI Cat. XVI 37232. 52ff. Incomplete. 

RORI (Jaipur) 10999. 2ff. Incomplete (nadicakra 
and pathacakra). 

RORI (Udaipur) 5189. Ff. 1-23. 

RORI (Udaipur) 5471. 37ff. Incomplete. 


^NARAHARI {fl. ca. 1550?) 

Narahari’s Dvaitanirnaya (see CESS A 4, 124a) 
was edited by Paramesvara (my copy lacks any 
indication of place or date of publication). The edi¬ 
tor’s note at the end claims that Narahari, a member 
of the Mandaravamsa of Mithila, was the son of 
Yajnapati, the son of Sivapati, the son of Pasupati 
(whose brother was Raghupati), the son of 
Vatesvara; and that another son of Vafesvara was 
Pak§adhara Misra (fl. 14507). If one assumes that 
this information is correct, one must conclude that 
Narahari wrote in ca. 1550. 


NARENDRASAGARA 

Author of a Rajasthani stabaka on Prthuyasas’ 
Satpahcdsikd. Manuscript: 

RORI (Chittorgarh) 5248. 5ff. 


^NARMADAGIRI AVADHUTA 

Additional manuscript of his tika on the Jdta- 
kdlahkara of Ganesa (fl. 1613) (see CESS A 3, 144a, 
and A 4, 124b): 

BHU B.3726. 113ff. Copied in Sam. 1890 = A.D. 
1833. 


NALINAK^A MARDDHARAJA 

Author of a Mdghamdhdtmya in Oriya. Manu¬ 
script: 

Bhubaneswar 2.Or. P/1311. 


166 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*NAVANITA NART AN A KAVI 

Additional manuscripts of his Ari^^anavanXta 
(see CESS A 3, 144a-145a, and A 4, 124b): 

Mysore ORI C.4123/1. Ff. 1-44. Nandinagari. Cop¬ 
ied on 13 kr§napak§a of A§adha in Saka 1732 = 
ca. 28 July 1810. 

BHU C.1195. 4ff. Copied in Satn. 1906 = a.D. 1849. 
No author mentioned. 

RORI (Alwar) 2782. 43ff. Copied in Sam. 1907 = 
A.D. 1850. With the fika of Sridhara. 

RORI (Alwar) 5719. 49ff. Copied in Sam. 1910 = 
A.D. 1853. With the fika of Sridhara. 

Kathmandu (1964) 11 (913). 14ff. With the fika of 
Sridhara. Incomplete. 

Mysore ORI B.574/2a. Ff. 1-59. Kannada. 

Mysore ORI *B.574/3. Ff. 59-66. Kannada. 

Mysore ORI C.4123/3. Ff. 1-6. 

Mysore ORI *P.1771/1. Ff. 1-8. Nandinagari. 

Mysore ORI *P.4398/4. Ff. 41-<7> 1..Nandinagari. 
Mysore ORI P.5270/1. Ff. 1-29. Grantha. Incom¬ 
plete (paricchedas 1-5). 

Mysore ORI P.5978/15. Ff. 148-161. Nandinagari. 
Mysore ORI P.6732/1. Ff. 134-197. Grantha. Incom¬ 
plete. 

Mysore ORI P.6901/2. Ff. 68-71. Telugu. Incom¬ 
plete. 

Mysore ORI P.7771/4. Ff. 144-149. Nandinagari. 
Mysore ORI P.7771/5. Ff. 149-154. Nandinagari. 

Incomplete (paricchedas 1-4). 

Mysore ORI P.9347/3. Ff. 33-36. Grantha. 


*NA$IR AL-DIN MUHAMMaD AL-TUS'I 
(1201/1274) 

The Sanskrit translation of his Risalat al-usturlab 
(see CESS A 3, 145a, and A 4, 125a) was perhaps 
made by Nayanasukhopadhyaya (fl. 1729). 


NAG A BHATTA (or BHADRA) (fl. before 1350) 

An authority cited by Vi§nusarman (fl. ca. 1370) 
on VidyamMhavlya 4, 30 (vol. 1, p. 299) and 4, 32 
(vol. 1, p. 306). 


NAG AD ATT A 

Author of a KaranakutuhalagatasdranX — i.t., of 
astronomical tables based on the Karanakutuhala 
composed by Bhaskara (b. 1114) in 1183. Manu¬ 


script: 

RORI Cat. IV 20197. 19ff. Copied by Hemavijaya at 
Bhillamala in Sarn. 1760 = A.D. 1703. 

CATURAGANA NAGADEVA 

Author of a Muktdval!. Manuscripts: 

Mysore ORI P.404/4a. Ff. 2-18. Kannada. Incom¬ 
plete (tithi to vivaha). 

Mysore ORI P.404/5a. Ff. 1-19. Kannada. 

The colophon begins: iti sricaturagananaga- 
devacaryaviracitayarn. 

^NAGASARMAN (fl. 1407) 

The son of Rama (a resident of Sripur), the son 
of Visala, the son of Yajhadatta, the son of Amara, 
the son of Devasarman of the Kasyapagotra, 
Nagasarman wrote in Saka 1329 = A.D. 1407 the 
Ganakavallabha (see CESS A 3, 145b) in 8 pari¬ 
cchedas: tithisadhana, nak§atrasadhana, yogasadhana, 
madhyamagrahasadhana, spa^fikarana, triprasna, 
candragrahana, and suryaparvan. Additional infor¬ 
mation concerning one of the manuscripts: 

*BORI 145 of A 1883/84. 17ff. Copied at Ahamma- 
da<p>u<re> on Thursday 8/9 suklapak§a of 
Magha in Sarn. 1485, Saka 1350 = 13 January 
1429. 

Verses 6-8 of adhyaya 8 are: 

varnse ’bhut kasyapasya prakafagunanidhir vedavid 
devasarma 

tatsunus camarakhyah sr<u>tivimalamati<r> 
vaidyanathas ca tadrk // 

rupas triskandhavettacyutacaranayugaradhanaika- 
gracitto 

vikhyatas tasya putro ganakaganavrto bhasito 
va < + > manyah //6// 

tadrk^o ’sau sabhayam ganitagananaya yajnadatto 
mahadhi < r > 

vikhyatas cagrajanam sadasi tu rata sri vihahgadeva- 
namnah // 

tajjato visalakhyas turagagunagatih sastravidya- 
vidhijho 

nityarn nityam sudhibhih svajanaparivrto vik§itah 
srinrsimhah HIH 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


167 


tasmin vamse sujatah srutisakalakalasarvasiddhanta- 
vetta 

khyatasripuri sa ramo vimalanaramati < r > brahma- 
tanvavabodhe // 

tatsunur dvadasatmadviramukhakayoh 
padapadmadvirephah 

svam cakre subodham ganakahrdi sada vallabham 
nagasarma //8// 

NAGENDRA PANDEYA (fl. 1984/85) 

A Lecturer on jyoti§a at Sampurnananda 
Sarnskrta Visvavidyalaya in Kasi, Nagendra wrote a 
Hindi tika, Kantimafi of the Pahcasvarah of 
Prajapatidasa; this was published at Varanasi in 
1984. He also wrote a Rekhaganita with a Hindi 
tika; this was published at Varanasi in 1985. 

NAG ESA 

Author of a Mahgala^iaka published by Hari- 
kr§na in his Mahgala^ (aka, Auraiigabada 1885, ff. 
4v-5. 


^NAGESA (fl. 1619/1628) 

1. Additional manuscripts of his Grahaprabodha 

(see CESS A 3, 145b-146a, and A 4, 125a): 

BISM 34,763. Copied on Wednesday 4 kr§napak§a 
of Asvina in Saka 1603 = 19 October 1681. No 
author mentioned. 

*AS Bombay 232. Ff. 2-32 (the sarini occupies ff. 
3v-32). The date, on f. 32v, is that of a nativity, 
not of the copying of the manuscript, though the 
scribe is the same. The native was born on Satur¬ 
day 13 krsnapak§a of Jye§tha in Saka 1735 = 27 
June 1813 at Aradramahama (Bharadvaja- 
grama?). 

*AS Bombay 233. Ff. 1-4 (Yadava’s udaharana 
occupies ff. 4-11). Copied by Sadasiva Jogadeva, 
the son of Ganesa. 

BORI 863 of 1887/91. 40ff. (sarini). No author 
mentioned. From Mahara§tra. 

Nagpur 515 (1402). 4ff. No author mentioned. From 
Nasik. 

Nagpur 516 (1567). 23ff. No author mentioned. 
From Nasik. 

2. Additional manuscripts of his Nirpayatattva (see 

CESS A 3, 146a-146b, and A 4, 125a-i25b): 


Benares (1956) 13359. Ff. 1-7. Incomplete. No 
author mentioned. 

Gwalior, MMrbhumi 78. See NCC, vol. 10. p. 145. 

IM Calcutta 5795. See NCC. 

SOI (List) 239. With the tika of Uddhava. See 
NCC. 

3. Additional information concerning a manuscript 
of his Muhiirtadlpaka (see CESS A 3, 146b, and A 

4, 125b): 

Oxford CSS I 436 (*d. 751 (11)). Ff. 1-18. 

4. Nagesa also wrote a Parvaprabodha in Saka 1550 
= A.D. 1628. To this there exists an udaharana, 
perhaps by Nagesa himself, in which the examples 
are a solar eclipse computed for Monday 30 Sravana 
in Saka 1567 = 11 August 1645 and a lunar eclipse 
computed for Friday 15 adhika Sravana in Saka 
1568 = 17 July 1646. Manuscripts: 

*PL, Buhler IV E 221. 9ff. Copied in Sam. 1854 = 
A.D. 1797. Property of Nana Josi of Nandura- 
bara. 

BORI 528 of 1895/1902. Ff. 1-4. With the udaha¬ 
rana. 

The last verse of the mula is: 

ganitabhavyadharanam satprati§thadaranarn 
laghuvidhicaturanarn proktam etan naranam // 
iti manasi vicaryam panditais capidharyam 
param iha na nivaryarn naganathoktakaryam // 

NAGESVARA 

Author of a Hrdayadyotinl. Manuscript: 

Mithila. See NCC, vol. 10, p. 23. 

NAGESVARA BHATTA 

The son of Lihgesvara Bhatta Suri, the son of 
Narasimha Bhatta Suri, the son of Mallikarjuna 
Bhatta Suri, Nagesvara wrote a vyakhya, Kdla- 
nirnayadldhiti, on the Kalanirpaya of Madhava (fl. 
ca. 1360/1380); this may be identical with the I^(a- 
kalanirnaya of Nagesa Bhatta (see CESS A 4, 125a). 
Manuscript: 

Mysore ORI C.2563/lb. Ff. 1-93. 


168 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


The colophon begins: iti srimatpadavakyapra- 
manaparavaraparinavidvanmukutahirahkurasrimad- 
bhat tamallikarjunasurisunusribhattanarasimhasuri- 
sunusribhat talihgesvarasurisunubhat tanagesvara- 
viracite. 


^NAGOJI BHATTA KALA (fl. ca. 1700/1750) 

Additional manuscripts of his Tithinirnaya (see 
CESS A 3, 146b-147a, and A 4, 126a): 

Benares (1953) 4386. Ff. 1-13, 13b-15, and 15b-20. 
(Parvanirnaya). 

Kavindradarya 545. (Parvanirnaya). 

Nagpur, Deo 86. (Parvanirnaya). See NCC, vol. 11, 
p. 242. 

RORI Cat. XVI 37372 (19). Ff. 30-35. (Parva- 
nirn,aya). 

RORI (Alwar) 3600. 53ff. (Tithindusekhara). 

He is also said to be the author of a Kunda- 
paddhati. Manuscript: 

CP, Hiralal 918. Property of Balkrsna Bhat Telaiig 
of Harda, Hoshangabad District. 


NATH A SUTRADHARA (fl. ca. 1450) 

The son of Ksetra and the brother of Mandana 
(fl. ca. 1450), Natha wrote a Vastumahjarl. Manu¬ 
scripts: 

Baroda 3598. 40ff. Copied in Sam. 1946 = a.d. 
1889. 

Baroda 10453. 20ff. Incomplete (3 stabakas). 
Rajputana, p. 38. At Udaipur. 


^NATHA (?) (fl. 1650) 

Additional information concerning a manuscript 
of his Prasnamarga (see CESS A 3, 147a, and A 4, 
126a). 

RORI (Alwar) 2838 = * Alwar 1854. 179ff. Copied 
in Sarn. 1912 = a.d. 1855. 


NA THUNARA YANA CA TUR VEDIN (fl. 1881?) 

Author of a fippani on the Yogarnava of Vehka- 
tesvara. Manuscript: 

RORI (Udaipur) 3793. 13ff. Copied by Nathunara- 
yana Gauda at Jayapura in Sarn. 1938 = a.d. 
1881. 


*NANABHAI 

The son of Visvanatha, his set of astronomical 
tables (see CESS A 3, 147b) is also entitled Laghu- 
paya. Manuscript: 

RORI (Chittorgarh) 2970. 90ff. Incomplete. 


^NARADA 

Additional manuscripts of his Naradaprasna (see 
CESS A 3, 148a): 

BHU C.4842. 4ff. Copied in Sam. 1903 = a.d. 1846. 
RORI (Alwar) 2844. 4ff. Copied by Kr^narama in 
Sarn. 1912 = a.d. 1855. (Prasnanirnaya). 
Bhubaneswar IV 79 (Jy/60). 174ff. Oriya. At end of 
manuscript. (Prasnalagna). From Jagatsimhapur, 
Cuttack District. 

GJRI 8484/709. Ff. 1-3. Maithili. 

IM Calcutta 1124; and 1281. See NCC, vol. 10, p. 
53. 

IM Calcutta 1373; and 8440 E. See NCC, vol. 10, p. 
58. 

Lucknow Museum. See NCC, vol. 10, p. 58. 

RORI (Alwar) 5410. 2ff. (Prasnanirnaya). 


'^NARADA 

Additional manuscripts of his Naradasarnhita 
(see CESS A 3, 148a-149b, and A 4, 126a-126b, 
where some manuscripts of the Naradasarnhita on 
dharmasastra seem to be listed): 

RORI Cat. V 23559. 23ff. Copied in Sam. 1634 = 
A.D. 1577. 

RORI Cat. IV 21601. 52ff. Copied by Ramadasa and 
Caturbhuja Misra in Sam 1691 = a.d. 1634. 
RORI (Udaipur) 523. 76ff. (ff. 24-38 missing). Cop¬ 
ied by Premadasa in Sarn 1735 = a.d. 1678. 
Incomplete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


169 


Kathmandu (1965) 113 (4563). 32ff. Copied in Sam. 
1801 = A.D. 1744. 

RORI (Jaipur) 5556. 24ff. (f. 11 missing). Copied in 
Sam 1835 = a.d. 1778. Incomplete. 

BHU C.2760. 56ff. Copied in Sam. 1839 = a.d. 
1782. 

AS Bengal I 3. 85. (I.D.23 (5)). 12ff. Copied in Sam. 

1865, Saka 1731 = a.d. 1808/9. 

RORI (Alwar) 2562. 90ff. Copied in Sam. 1912 = 
A.D. 1855. 

RORI (Alwar) 2561. 135ff. Copied in Sarn. 1913 = 
A.D. 1856. 

RORI (Bikaner) 14677. lOff. Copied by Krsnalala in 
Sam. 1917 = a.d. 1860. 

Oxford CSS I 389 (*d. 886 (1)). Ff. 1-3, <6>, and 
66-87. Copied on Saturday 8 kr§napak§a of A§a- 
dha in Sam. 1925 = 11 July 1868. Incomplete. 
Kathmandu (1965) 114 (4562). Ff. 1-60. Copied in 
Sarn. 1931 = a.d. 1874. Incomplete. 

Anup 5041. 154ff. Excerpts from this and many 
other texts. 

AS Bengal 6951 (G.7148) IV. Ff. 32-33. Incomplete. 
BHU C.3236. 12ff. Incomplete. 

IM Calcutta 10184. See NCC, vol. 10, p. 59. 

*Jaipur (Khasmohor) 5491. 

Kathmandu (1965) 115 (4561). 7ff. Incomplete. 
Mysore (1905) 770. 7pp. Incomplete (4 adhyayas). 
Mysore ORI C.4700/5. Ff. 10-16. Kannada. Incom¬ 
plete (astadasakuta). 

Mysore ORI P.574/6. Ff. 2-16. Kannada. (Laghu- 
naradiyasatnhita). Incomplete (adhyayas 1-5). 
Mysore ORI *P.1535/1. 200ff. Nandinagari. Incom¬ 
plete (ends with adhyaya 37). 

Mysore ORI P.5978/1. Ff. 2-21. Nandinagari. 

Incomplete. 

Mysore ORI P.7629/1. Ff. 1-57. Grantha. 

Mysore ORI P.7972/1. Ff. 1-187. Nandinagari. 

Incomplete. 

Mysore ORI P.8353/1. Ff. 3-244. Nandinagari. 

Incomplete (ends with jivaksaravarga). 

Mysore ORI P.8826. Ff. 1-9. Grantha. Incomplete 
(adhyayas 1-3). 

Mysore ORI P.9258/8. Ff. 1-232. Nandinagari. 

Incomplete (ends with vivahaprakarana). 

Mysore ORI P.10022/1. Ff. 1-90. Nandinagari. 
Mysore ORI P.10022/6. Ff. 32-47 and 49-51. Nandi¬ 
nagari. Incomplete (adhyayas 3-37). 

Mysore ORI P.10022/18. F. 11. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.10440/la. Ff. 3-219. Nandinagari. 

Incomplete (adhyayas 5-35). 

Mysore ORI P. 10624/a. Ff. 1-63. Telugu. Incom¬ 
plete. 


Oxford CSS I 390 (*d. 771 (5) A). Ff. 1-6 and 9. 
Incomplete (vivaha). 

Oxford CSS I 391 (*d. 771 (5) B). Ff. 12-21, 23-26, 
and 28-36. Incomplete. 

Oxford CSS I 392 (*d. 782 (1)). Ff. 9-10, 36-38, 
40-45, and 47. Incomplete. 

Poona, Mandlik. Jyotisha 3. 76ff. 

PrSB 3605 (Berlin or. 6301). Ff. 26-64. Telugu. 

Incomplete (adhyayas 1-27). 

RORI Cat. IV 18991. 24ff. Incomplete. 

RORI (Jaipur) 2645. 58ff. (ff. 24-31 missing). 
Incomplete. 

RORI (Jaipur) 5951. 8ff. Incomplete (grahacara and 
suryavibhaga). 

RORI (Jaipur) 9215 (1). If. (vr§tivicara); and (2). F. 
2. (utpata). 

Visvabharati (Adyar) 1178 (c). 26ff. Nandinagari. 
With a Telugu tika. Incomplete (upanayana, 
vivaha, and tithi). 

The Ndradasamhita was published with the Hindi 
tika, Vimald, of Ramajanma Misra as KSS 40, 2nd 
ed., Varanasi 1984. 


NARADA 

Author of a Ndradiyasamhitd on dharmasastra, 
including many sections on santi. Some manuscripts 
were listed among those of the jyotisa Ndrada¬ 
samhita in CESS A 3, 148b-149a, and A 4, 
126a-126b. Manuscripts: 

*AS Bengal 2622 (G.2141) II. Ff. 3-4. Copied by 
Prahladabhatta, the son of Gopala, on Friday 5 
suklapaksa of Pausa in Saka 1733 = 20 Decem¬ 
ber 1811. (kakamaithunadarsanasanti). 

Benares (1953) 6878. If. (utpatasanti). 

*GOML Madras D.3241. 3pp. (asvasanti). 

*GOML Madras D.3266. 2pp. (kakavisthasanti). 
*GOML Madras D.3267. 3pp. (kakavisthasanti). 
*GOML Madras D.3418. 16pp. Telugu. (vastusanti). 
*GOML Madras D. 17593. Ff. 79v-82v. Telugu. 
(kuhusanti). 

=^IO 5612 (Mackenzie XI 8) 1. Ff. 66-73. Udiya. 

(grahasanti). From Colin Mackenzie. 

*Kerala 2441 (13988 B). 18 granthas. (utpatasanti). 
*Kerala 3949 (13987 A). 115 granthas. (kuhQsanti). 
*Kerala 7337 (7630 C). 18 granthas. (darsasanti). 
Mysore ORI B. 117/35. Ff. 33-34. Kannada, (kaka- 
vistasanti); B. 117/47. Ff. 53-54. Kannada, (visa- 
nadijananasanti); and B.117/51. Ff. 59-62. 
Kannada, (sotpatajananasanti). 


170 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI B.622/14. Ff. 40-45. Telugu. (vi§a- 
naclijananasanti). 

Mysore ORI P.734/26. Ff. 47-48. Nandinagari. 
(asvasanti); P.734/27. F. 6. Nandinagari. (gaja- 
santi); and P.734/45. F. 84. Nandinagari. (kaka- 
vi^tasanti). 

Mysore ORI P.2239/47. Ff. 59-61. Grantha. (darsa- 
jananasanti). 

Mysore ORI P.3023/44. Ff. 29-30. Telugu. (darsa- 
jananasanti). 

Mysore ORI P.4180/24. F. 6. Nandinagari. (madhu- 
santi); and P.4180/100. Ff. 201-206. Nandina¬ 
gari. (devatavikrtisanti). 

Mysore ORI P.4396/34. F. 134. Grantha. (rajasva- 
lasantikalpa). 

Mysore ORI P.4720/45. Ff. 74-76. Nandinagari. 

(darsajananasanti). 

Mysore ORI P.4992/11. Ff. 24-25. Nandinagari. 

(amavasyaprasutisanti). 

Mysore ORI P.5313/41. F. 78. Nandinagari. (kaka- 
vi§tasanti). 

Mysore ORI P.5635/75. F. 63. Grantha. (kaka- 

vi^fasanti); P.5635/82. Ff. 71-72. Grantha. 
(vyatipatadijananasanti); and P.5635/94. Ff. 
81-82. Grantha. (grahayogasanti). 

Mysore ORI P.5672/45. Ff. 76-77. Kannada, (darsa¬ 
jananasanti); P.5672/78. F. 128. Kannada, (darsa¬ 
jananasanti); and P.5672/105. Ff. 165-166. Kan¬ 
nada. (vastusanti). 

Mysore ORI P.5930/12. F. 29. Nandinagari. (kaka- 
vi^tasanti); P.5930/18. F. 23. Nandinagari. (ma- 
hi§idanavidhi); and P.5930/133. Ff. 1-5. Nandi¬ 
nagari. (kuhusanti). 

Mysore ORI P.6030. Ff. 1-14. Grantha. (vi^nu- 
pujavidhi). 

Mysore ORI P.7401/10. If. Telugu. (darsajana¬ 
nasanti); P.7401/50. If. Telugu. (vastupujavidhi); 
and P.7401/82. 2ff. Telugu. (asvasanti). 

Mysore ORI P.7970/65. F. 51. Nandinagari. (kaka- 
vi§tasanti); P.7970/102. Ff. 82-83. Nandinagari. 
(vastupujavidhi); P.7970/113. If. Nandinagari. 
(asvasanti); P.7970/137. F. 157. Nandinagari. 
(kakapravesasanti); and P.7970/149. Ff. 174-176. 
Nandinagari. (vi^anadijananasanti). 

Mysore ORI P.8000/5. Ff. 10-11. Nandinagari. 
(ghukapravesasanti). 

Mysore ORI P.8532/8. Ff. 98-101. Nandinagari. 
(kuhusanti). 

Mysore ORI P.9254/14. Ff. 15-16. Nandinagari. 
(mrtyuharamahi§idanavidhi). 

Mysore ORI P.9951/102. F. 124. Nandinagari. 
(mrtyuharamahi§idanavidhi). 

Mysore ORI P.9965/58. Ff. 54-55. Nandinagari. (ro- 


hininak^atrajananasanti). 

Mysore ORI P.10041/36. Ff. 51-53. Telugu. (darsa¬ 
jananasanti); and P.10041/95. Ff. 155-156. 
Telugu. (kuhusanti). 

Mysore ORI P.10070/7. F. 8. Nandinagari. (kaka- 
vi§tasanti). 

NARADA 

Author of a Naradasahgraha\ cf. Narada’s Nara- 
diyasahgrahasdra (see CESS A 3, 149b). Manuscript: 

Srhgeri Matha 207 (2). See NCC, vol. 10, p. 59. 

^NARADA 

Additional manuscript of his Pahcdsadak^ara- 
phala (see CESS A 3, 149b), which is presumably 
identical with his Matrkdsakundvali (see CESS A 3, 
150a): 

WHMRL a 91 c. 9ff. (Varnamdld). 

^NARADA 

Additional manuscripts of his Mayuracitraka (see 
CESS A 3, 149b-150a, and A 4, 126b): 

RORI (Udaipur) 6521 (A). 24ff. Copied in Sam. 
1829 = A.D. 1772. 

RORI Cat. XVI 34728. 22ff. Copied by Kanhirama 
Misra in Sam. 1847 = A.D. 1790. With a Megha- 
mdld. 

Oxford CSS I 123 (*c. 315 (5)). Ff. 1-19. Copied by 
Thakuradasa Harasa, the son of Pu§kara, for 
Nandikisora, Yugalakisora, and Devakinandana, 
on Sunday 4 suklapak§a of Asadha in Sam. 1886, 
Saka 1731 = 16 July 1809. 

Vrndavana 8791. 17ff. Copied by Ramaprasada 
Misra on Saturday 12 suklapak^a of Margasir§a 
in Sarn. 1874 = 20 December 1817 during the 
reign of Dayarama. 

Vrndavana (micro) 396. 21ff. Copied in Sam. 1903 
= A.D. 1846. Incomplete. Property of Visvam- 
bhara Gosvamin of Vrndavana. 

RORI (Alwar) 2540. 23ff. Copied in Sam. 1907 = 
A.D. 1850. 

RORI Cat. IX 28832. 17ff. (f. 10 missing). Copied by 
isvaralala Rahga at Jodhapura in Sam. 1918 = 
A.D. 1861. Incomplete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


171 


Jammu 42 kna. 15ff. Copied in Sam. 1928 = A.D. 
1871. 

RORI Cat. XVI 35991. 36ff. Copied in Sam. 1954 = 
A.D. 1897. 

AS Bengal 6950 (G.74) = Mitra, Not. 858. 14ff. 

Incomplete (ketudayaphala). 

BHU C.27I7. llff. 

IM Calcutta 10571. See NCC, vol. 10, p. 53. 

RORI Cat. IV 20354. 18ff. 

RORI Cat. XVI 36840. 36ff. 

RORI (Chittorgarh) 4799. 2 Iff. Copied by 

Cunnilala. 

RORI (Udaipur) 3161 (1). Ff. 1-29 (ff. 20-24 miss¬ 
ing). Incomplete. 

RORI (Udaipur) 3663. 26ff. 

WHMRL 1.66. Ff. 1-14. 

WHMRL K.3.j.f. If. Incomplete (ends in 1, 9). 


NARADA 

Author of a Silpasastra. Manuscripts: 

Adyar Cat. 20 E 51. 8pp. Grantha. 
Adyar Cat. 22 M 7. 220pp. Telugu. 
Baroda 13515. 114ff. 

Mysore ORI A.764. Ff. 1-134. 


^NARADA 

Additional manuscripts of his Samudrika (see 
CESS A 3, 150a-150b, and A 4, 126b): 

*BISM 49,150. See CESS A 4, 126a. 

GOME Madras D.14003. Ff. 1-14. Grantha. Incom¬ 
plete. 

GOML Madras D. 14004. Ff. 65-76v. Telugu. Incom¬ 
plete. 


NARASIMHA 

Author of a Vasturaja. Manuscripts: 

Baroda 10990 (b). 12ff. Incomplete (ends in adhyaya 
13). 


NARAYANA 

Author of a Kdlajhana in Telugu. Manuscript: 
Mysore ORI P.7944. Ff. 11-19. Telugu. 


NARAYANA 

Collaborator in composing a Khadipatha in 
Oriya. Manuscript: 

Bhubaneswar IV ganita 5 (G/34). 142ff. Oriya. From 
Halodia, Khurdha, Puri District. 

NARAYANA 

Author of a Jyoti^asarasahgraha\ this may be 
identical with the Jyotihsara of Narayana Bhaffa- 
carya (see CESS A 4, 130b). Manuscript: 

Kathmandu (1965) 57 (4257). 58ff. Copied by Veni- 
sarman Misra, the son of Cintamani Misra, at 
Pataliputra in Vihara on Thursday 12 kr§na- 
paksa of Magha in Sarn. 1612 = 9 January 1556. 

The last verse is: 

vilokya vividhan granthan narayanamatadvijah // 
amurn hitaya balanam akarot sarasahgraham // 

^NARA YANA 

Additional manuscripts of his Dharmapravrtti 
(see CESS A 3, 151a-151b, and A 4, 126b-129b): 

RORI (Udaipur) 181. 17ff. Copied by Kalyana 
Gauda Bhatfa in Sam. 1685 = A.D. 1628. Incom¬ 
plete (prayascittaprakarana). 

RORI (Udaipur) 198. 210ff. Copied by Narasitnha at 
Udayapura in Sarn. 1733 = A.D. 1676. (Dharma- 
pradtpa). 

RORI Cat. VII 26567. 209ff. Copied in Sam. 1837 = 
A.D. 1780. Incomplete. 

RORI (Alwar) 3650 = ^'Alwar 1361. 223ff. Copied 
in Sam. 1849 = A.D. 1792. 

RORI Cat. XVI 36711. 80ff. Copied by Hari Bhatta 
at Barasiyani in Sarn. 1859 = a.d. 1802. Incom¬ 
plete. 

PrSB 1710 (Gottingen Mu I 129). Ff. 10-60. Sarada. 
Copied by Vartakabhatfa Kasaka on Saturday 
10/11 suklapak^a of Sravana in Laukika Sarn. 
<49 >45 = 12 September 1868 (?). 

AS Bengal III.D.8. 

BHU C.1878. 16ff. Incomplete (danaprakarana). No 
author mentioned. 

Mysore ORI C.277. Ff. 1-167. Incomplete (up to 
dehasuddhiprakarana). 

Mysore ORI C.3085/1. Ff. 1-125. 


172 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.113. Ff. 53-58. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.191. Ff. 1-82 and If. Nandinagari. 
Incomplete (up to sraddhaprakarana). 

Mysore ORI P.229. Ff. 1-123. Telugu. 

Mysore ORI P.439/1. Ff. 1-142. Telugu. 

Mysore ORI P.439/2. Ff. 2-54. Telugu. Incomplete. 

Mysore ORI P.1364/10. F. 72. Grantha. Incomplete 
(brhadgauritrtiyanirnaya). 

Mysore ORI P.1364/65. Ff. 101-108. Grantha. 
Incomplete, (prayascittavidhi). 

Mysore ORI *P.2238. Ff. 1-169. Telugu. 

Mysore ORI *P.2576. Ff. 1-182. Nandinagari. 
Incomplete. 

Mysore ORI *P.3263. Ff. 1-96. Telugu. Incomplete 
(up to amavasyakrtya). 

Mysore ORI P.3789. Ff. 1-256. Telugu. 

Mysore ORI P.3983. Ff. 1-135. Telugu. Incomplete 
(up to dvadasikrtya). 

Mysore ORI P.4360/21. Ff. 62-64. Nandinagari. 
Incomplete (upakarmanirnaya). 

Mysore ORI P.5957. Ff. 1-216. Kannada. Incom¬ 
plete (up to vrataprakarana). 

Mysore ORI P.7436. Ff. 109-235. Telugu. Incom¬ 
plete (up to prayascittaprakarana). 

Mysore ORI P.7562/1. Ff. 1-4. Telugu. Incomplete 
(anukramani: to ekottarasatakulanirupana); and 
P.7562/2. Ff. 1-160. Telugu. Incomplete (up to 
suvarnadiparimana). 

Mysore ORI P.7878. If. Telugu. Incomplete 
(upakarmanirnaya). 

Mysore ORI P.8193. Ff. 1-200. Nandinagari. 

Mysore ORI P.8324. Ff. 1-107. Nandinagari. Incom¬ 
plete (up to saiikrantipunyakalanirnaya). 

Mysore ORI P.8398. Ff. 2-64. Telugu. Incomplete 
(up to karmaprakarana). 

Mysore ORI P.8857/2. Ff. 1-4. Nandinagari. Incom¬ 
plete (anukramani); and P.8857/3. Ff. 1-142. 
Nandinagari. Incomplete (up to sthQlipakapra- 
karana). 

Mysore ORI P.9328. 214ff. Kannada. Incomplete (up 
to aurdhvadaihikanirnaya). 

Mysore ORI P.9331/1. Ff. 1-211. Nandinagari. 

Poona, Mandlik. Smrti and Dharma 112. 113ff. No 
author mentioned. 

PrSB 2687 (Berlin or. 6291). Ff. 27-171v. Nandina¬ 
gari. 

PrSB 3302 (Berlin or. 6290). 227ff. Nandinagari. 
Copied by Subrahmanya Sastrin, the son of 
Ahjundacarya of the Bharadvajagotra. 

RORI Cat. IV 21448. 206ff. (ff. 150-172 and 
203-204 missing). 

RORI (Alwar) 3964, 71ff. Incomplete. 


RORI (Jaipur) 2535. 87ff. (ff. 1-26, 29-30, 35-36, 
50, 58-60, and 88 missing). Incomplete. 
Visvabharati (Adyar) 150 (a). 188ff. Grantha. Cop¬ 
ied by Lak§minarayana on 9 Margali. Incom¬ 
plete (ends in tithinirnaya). 

Visvabharati (Adyar) 151. 141ff. Grantha. Copied 
by Bhavani Kr^nabhafta on Tuesday vikrti in 
Karttika. Incomplete (ends in tithinirnaya). 
Visvabharati (Adyar) 498 (a). 142ff. Nandinagari. 

Incomplete (ends in tithinirnaya). 

Visvabharati (Adyar) 1191 (a). 13ff. Telugu. Incom¬ 
plete (nityakarmaprakarana). 

NARAYANA or NARAYANATMAJA 

Narayana or the son of Narayana wrote a 
Pahcahgakarana or PancahgaganitMayana. Manu¬ 
scripts: 

Mysore ORI B.586/1. Ff. 1-2. Kannagla. (Pahcahga¬ 
karana of Narayanatmaja). 

Mysore ORI P.6390/4. 2ff. Telugu. Incomplete 

(Pahcahgaganitanayana of Narayana). 

NARAYANA 

Author of a Prasnajhana also called Aryaprasna\ 
probably identical with it are a Prasnatantra and a 
Prasnadlpika, though any or all of these works may 
be parts of the Prasnarnavaplava of Narayanadasa 
Siddha (fl. ca. 1525). Manuscripts: 

Mysore ORI P.316/7. Ff. 1-5. Kannada. Incomplete. 
Mysore ORI P.4333/6. Ff. 34-36. Nandinagari. 

(PrasnacPipika). 

Mysore ORI P.4482/3. Ff. 28-31. Nandinagari. 

(Prasnatantra). Incomplete (up to vr§tiprasna). 
Mysore ORI P.5167/2. Ff. 60-61. Grantha. (Prasna- 
sastra). 

Mysore ORI P.5262. Ff. 1-6. Kannada. 

Mysore ORI P.6112/2a. If. Telugu. (Prasnasastra). 

NARAYANA 

Author of a Makarandaprakasa. Manuscript: 
Mithila. See NCC, vol. 10, p. 88. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


173 


NARAYANA 

Author of a tika, Balabodhinl, partially in 
Kannac^a, on the Muhurtamartanda of Narayana {fl. 
1571/1572). Manuscript: 

Mysore ORI C.2258/2. Ff. 1-66. 

The first verse is: 

srilambodarasaradagurupadasrisailanatham sivam 
adityadinavagrahan saphaladan daivajhanarayanah // 
natva balakabodhinim prakurute mauhOrtamartan- 
dasad- 

vyakhyarn mahjulabha§inim hitakarim karnata- 
kanam mude // 

The last verse is: 

yah sauratantraganitarnavaparadr sva 
nityahitagnir atithipriyasatpratiksyah // 
narayanena vihito ’tra parisramo yah 
prito ’stu tena sukrti gurukasiviryah // 

The colophon begins: iti srimuhurtamartandavalla- 
bhayarn sisusukhavabodhinyarn. 

NARAYANA 

Author of a Vivahatantra. Manuscript: 

BHU C.4788. 3ff. 


^VAMORl NARAYANA 

Additional manuscripts of his Sabhdkaumudl 
(see CESS A 3, 152a, and A 4, 130a): 

Benares (1956) 12843. Ff. 1-32. Incomplete. 
Vrndavana 8483. 38ff. (ff. 5 and 7 repeated). Attrib¬ 
uted to Vanuri Narayana. 

NARAYANA OJHA 

Collaborator in composing a Ganita in Oriya. 
Manuscript: 

Bhubaneswar IV ganita 19 (G/24). 69ff. Oriya. 
Incomplete. From Jagatsirnhapur, Cuttack 
District. 


NARAYANA DASA 

Author of a Ganita in Oriya. Manuscripts: 

Bhubaneswar IV ganita 26 (G/44) = Bhubaneswar 
2.G/44. 105ff. Oriya. Incomplete. From Dhara- 
kota, Ganjam District. 

Bhubaneswar IV ganita 55 (G/28). 54ff. Oriya. At 
end of manuscript. From Jagatsirnhapur, Cuttack 
District. 

NARAYANA NAY AKA 

Collaborator in composing a Vamphlnala in 
Oriya. Manuscript: 

Bhubaneswar IV ganita 57 (G/40). 50ff. Oriya. 
Incomplete. From Bhubaneswar, Puri District. 

NARA YANA PA JJANA YAKA 

Author of a Karanasandarbha. Manuscript: 

Cuttack 19. With his own tika. See NCC, vol. 3, p. 
176, and vol. 10, p. 78. 

^'NARA YANA PANDIT A 

Additional manuscripts of his Narayanlpaddhati 
(see CESS A 3, 152b): 

GJRI 11060/1114. Ff. 1-23. Copied in Sarp. 1828 = 
A.D. 1771. 

IM Calcutta 8033. See NCC, vol. 10, p. 91. 

RORI (Alwar) 2673 = *Alwar 1825. 28ff. 

NARAYANA BHATTA 

The son of Laksmidhara, Narayana wrote a 
Grhydgnisagara = Prayogasdra\ cf. the Prayoga- 
ratna of Jagadguru Narayana Bhatta (b. 1513). 
Manuscript: 

Baroda 8613. 3ff. Copied in Saka (read Sarn.) 1929 
= A.D. 1872. Incomplete (kundalak^ana). 


174 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*NARA YANA BHA TTA 

Additional manuscripts of his Camatkara- 

cintamani (see CESS A 3, 152b-155b, and A 4, 

130a-130b): 

Oxford CSS I 271 (*d. 753 (4)). Ff. 1-3, <4>, and 
8. Copied by Mahavaji Sarman, the son of 
Padmanabha and a resident of Kauntapura, on 
Friday 4/5 kr§napak§a of Asvina in Sam. 1660, 
Saka 1525 = 14 October 1603. Presented to 
Kabhai (?) Sarman, a Brahmana, on Tuesday 9 
kr§napak§a of Bhadrapada in Sarn. 1662, Saka 
1527 = 27 August 1605. Incomplete. 

Kathmandu (1964) 122 (2918). 13ff. Copied on 
Monday 1 krsnapak§a of Phalguna in Sarn. 1719 
= 24 February 1662. 

RORI Cat. IV 21579. 4ff. Copied by Lalacandra in 
Sarp. 1748 = a.d. 1691. (dvadasabhavaphala). No 
author mentioned. 

Kathmandu (1964) 120 (2920). 8ff. Copied on 3 
kr§napak§a of Phalguna in Sam. 1750, Saka 1615 
= ca. 4 March 1694. 

RORI (Chittorgarh) 563. 14ff. Copied in Sarn. 1755 
= A.D. 1698. 

RORI (Udaipur) 534. lOff. Copied by Bha- 
vanisahkara Dasora in Sarn. 1771 = a.d. 1714. 

RORI (Chittorgarh) 4159. 7ff. Copied by Kusalavi- 
naya at Bhumadada in Sam. 1789 = a.d. 1732. 
With a Rajasthani stabaka. 

Oxford CSS I 272 (^'^d. 775 (9)). Ff. 1-11, 13-16, and 
18-19. Copied by Manasarama Bhafa on Friday 3 
suklapak§a of Jye^tha in Sarn. 1790, Saka 1656 
= 4 May 1733. Incomplete. 

RORI (Udaipur) 5193. Ff. 2-25. Copied in Sam. 
1792 = A.D. 1735. Incomplete. 

RORI (Chittorgarh) 2608. 37ff. Copied by Ladarama 
in Sarn. 1799 = A.D. 1742. 

RORI (Bikaner) 14699. 7ff. Copied by Sukhavilasa 
in Sam. 1805 = a.d. 1748. 

RORI (Chittorgarh) 1443. lOff. Copied in Sarn. 1816 
= A.D. 1759. With a stabaka. 

Kathmandu (1964) 125 (2925). No ff. given. Copied 
by Lihga Vipra at Cadalipura on Thursday 4 
suklapak§a of Bhadrapada in Saka 1699 = 24 
September 1778. With the fika of Dharmesvara. 

Kathmandu (1964) 121 (2917). llff. Copied on 
Tuesday 7 kr§napak§a of Karttika in Sam. 1841 
= 22 November 1786. 

RORI (Chittorgarh) 4883. 17ff. Copied by Dhana- 
rOpavijaya at Khanapura in Sarp. 1845 = a.d. 
1788. With a Rajasthani stabaka. 

RORI (Udaipur) 6458. 33ff. Copied in Sarp. 1847 = 


A.D. 1790. With the tika of Dharmesvara. 

RORI (Bikaner) 18340. 16ff. Copied at Mahimapura 
in Sarp. 1850 = A.D. 1793. With a Rajasthani sta¬ 
baka. 

RORI (Udaipur) 6100. 22ff. Copied by Nandikes- 
vara Vyasa in Sam. 1852 = a.d. 1795. With the 
fika of Dharmesvara. 

RORI Cat. VIII 26685. 19ff. (f. 1 missing). Copied 
in Sam. 1854 = a.d. 1797. With the tika of 
Dharmesvara. Incomplete. 

RORI (Chittorgarh) 1403. 7ff. Copied by Gahga- 
vi§nu Vyasa in Sam. 1863 = a.d. 1806. 

RORI (Chittorgarh) 1402. lOff. Copied by Jivana at 
Ramapuragrama in Sana. 1864 = a.d. 1807. 
Incomplete (bhavaphala). 

GJRI 8319/544. Ff. 1-14. Maithili. Copied in Saka 
1741 = A.D. 1819. 

RORI (Chittorgarh) 2968. 15ff. Copied in Sarp. 1876 
= A.D. 1819. 

RORI Cat. IV 19692. 25ff. (f. 1 missing). Copied by 
Javeracandra, the pupil of Nayaratna Suri, at 
Udayapura in Sam. 1881 = A.D. 1824. 

RORI (Chittorgarh) 2884. 8ff. Copied by Narayana 
at Rajagadha in Sarp. 1895 = a.d. 1838. 

RORI (Chittorgarh) 1235. 19ff. Copied by 

Jivanalala Dave in Sarp. 1898 = a.d. 1841. With 
a Balabodhini. 

NFS (Sanskrit) 7654. Ff. 2-41. Copied on Friday 11 
kr$napak§a of A§adha in Sarp. 1903, Saka 1768 
= 19 June 1846. Ascribed to Ramabhafta 

Nayana. 

RORI (Alwar) 2768. 24ff. Copied in Sam. 1912 = 
A.D. 1855. With the tika of Dharmesvara. 

WHMRL I. 39. Ff. 1-10. Copied by Jagannatha on 
Thursday 9 suklapak^a of Pau§a in Sarp. 1918 = 
9 January 1862. 

Oxford CSS I 273 (*g. 14). Ff. 1-19 and 19b-20. 
Copied in Sarp. <19>21 = a.d. 1864. Incom¬ 
plete. 

Kathmandu (1964) 123 (2921). No ff. given. Copied 
on 5 kr§napak§a of Magha in Sam. 1921 = ca. 
15 February 1865. 

GJRI 8320/545. Ff. 1-19. Maithili. Copied in Saka 
1790 = A.D. 1868. With the fika of Dharmes¬ 
vara. 

NFS (Sanskrit) 8839. 16ff. Copied by Ramacandra 
Sarman on 2 kr§napak§a of Magha in Sam. 1927 
= ca. 8 January 1871. With the tika of Dhar¬ 
mesvara. 

GJRI 8321/546. 7ff. Incomplete. 

GJRI 8322/547. Ff. 1-8. Maithili. 

GJRI 8323/548. Ff. 1-15. Maithili. With the tika of 
Dharmesvara. Incomplete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


175 


*Jaipur (Khasmohor) 2115 (28 and 35; both bha- 
vadhyaya); and 5513. 

Jodhpur 792. llff. With a Rajasthani l;ippani. 

Jodhpur 793. 7ff. (f. 1 missing). Incomplete. 

Jodhpur 794 (A). 6ff. Incomplete. 

Jodhpur 794 (B). 17ff. (f. 1 missing). Incomplete. 

Kathmandu (1964) 119 (2919). 14ff. 

Kathmandu (1964) 124 (7053). No ff. given. 

Mysore ORI P.7559/4. F. 9. Nandinagari. Incom¬ 
plete (ends with candraphala). 

Mysore ORI P.7559/13. Ff. 54-58. Nandinagari. 

Oxford CSS I 274 (*d. 772 (6)). Ff. 1-14. With the 
tika of Dharmesvara. Incomplete (verses 1-4).- 

Oxford CSS I 275 (*d. 772 (7)). Ff. 2-6. Incomplete. 

Oxford CSS I 276 (*f. 50). Ff. 1-26, 26b (= 27), 
and 28-43. Different version. Incomplete. 

Oxford (Vyasa) 181. Ff. 2-8. Incomplete (ravi 
6-rahu 9). 

PrSB 2930 (Gottingen, Sanscr. Sham 37). lOff. 

RORI Cat. V 23181. 5ff. (grahabhavaphala). No 
author mentioned. 

RORI Cat. VI 24253. 6ff. Copied by Sumativar- 
dhana. Incomplete. 

RORI Cat. VI 24534. 5ff. 

RORI Cat. XVI 34334. 6ff. 

RORI (Chittorgarh) 1669. 13ff. 

RORI (Chittorgarh) 2277. 9ff. With a Rajasthani 
tika. 

RORI (Chittorgarh) 2598. 15ff. No author men¬ 
tioned. 

RORI (Chittorgarh) 2739. 8ff. Copied by Radhaki- 
sana Khandelavala. (bhavaphala). 

RORI (Chittorgarh) 2971. 13ff. Incomplete. 

RORI (Chittorgarh) 4201. 12ff. With a Rajasthani 
stabaka. Incomplete. 

RORI (Chittorgarh) 4404. 3ff. With a Rajasthani 
stabaka. Incomplete. 

Vrndavana 1883. 8ff. Bengali. 

WHMRL 1.75. Ff. 1-13. 

An English translation with explanation of the 

Camatkaracintamani by S. S. Sareen was published at 

New Delhi in 1986. 


*NARAYANA VEDARADARA (= BHEDANKARA) 

The son of Mahalasa and Nrsimha Pandita, Nara- 
yana (see CESS A 4, Ola) wrote a Nak^atrasattra- 
hautraprayoga. Manuscript: 


*NARAYA!)/A S ARM AN SIDDHANTAVAGlSA 

BHATTACARYA 

2. Additional manuscripts of his Vyavasthasara- 

sahcaya (see CESS A 4, Ola): 

AS Bengal II.A.47. Bengali. 

Benares (1956) 12424. Ff. 1-34. Bengali. Incom¬ 
plete. 

Benares (1956) 12759. Ff. 1-8. Bengali. Incomplete. 
No author mentioned. 

Benares (1956) 12903. Ff. 1-40. Bengali. With a 
sQcipatra. 

Benares (1956) 0109. Ff. 1-6. Bengali. Incomplete 
(mrtadhanadhikari). No author mentioned. 

Benares (1956) 0 174. Ff. 1-10. Bengali. (Vyava- 
sthasarcLsamuccaya) . Incomplete. 

Calcutta, Sanskrit Sahitya Pari§at I, I 23 (incom¬ 
plete); 192; and 265. See NCC, vol. 10, p. 92. 


^NARAYANA SURI 

Additional manuscript of his Samudrikasara (see 
CESS A 3, 156a): 

Mithila. See NCC, vol. 10, p. 94. 


NARAYANA (fl. ca. 1200) 

A daivajna, Narayana, of the Atreyagotra, and his 
wife, Kamala, were the parents of the jyoti^a, Loka- 
narya (Ji. ca. 1230), whose sons by Sridevi, includ¬ 
ing Laksmidhara, received the village Gadivore in 
Ajjagavekampana in the Panasadesa from the 
Kadamba ruler, $asthadeva II, at Gokarna on 
Saturday amavasya of Pu§ya in the Durmatisarnvat- 
sara, Kaliyuga 4357 (read 4362) = 21 January 1262. 
See G. S. Gai [A5. 1961/62]. 

Verses 24-25 of the inscription are: 

atreyagotre samabhut pragalbho 
daivajhanarayana ity udarah // 
asit kalatrarn kamaleti tasya 
tayoh suto jyotisalokanaryah // 
sarvopakarinas tasya sridevity abhavat sati // 
tayoh suruciracarah putro lak§midharo ’bhavat // 


SOI (List) 521. See NCC, vol. 10, p. 84. 


176 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


NARAYANA PANDITACARYA {fl. thirteenth cen¬ 
tury) 

The son of Trivikrama Pandita, Narayana wrote a 
Dinatrayamimarnsa for the followers of Madhva. 
Manuscripts: 

Baroda 10405. 7ff. Copied in Saka 1756 = a.d. 
1834. Incomplete. 

Baroda 8456. Ff. 13-40. Incomplete. 

Baroda 9594. 5ff. Incomplete. 

BHU B.131. 55ff. Incomplete. (Tithitrayisetu). 

BORI 617 of 1882/83. 56ff. (ff. 1, 19, and 51-52 
missing). 


NARAYANA (fl. before 1350) 

Authority cited by Visnusarman (fl. ca. 1370) on 
VidyamMhavlya 2, 9 (vol. 1, p. 88); 2, 10-11 (vol. E 
p. 91); 6, 8 (vol. 2, p. 21); 7, 30-31 (vol. 2, p. 114); 
10, 4 (vol. 2, p. 317); and 10, 18-19 (vol. 2, p. 336); 
cf. the Ndrayaniya cited on 10, 17 (vol. 2, p. 335). 


■^'NARAYANA PANDITA (fl. 1356) 

1. Additional information concerning a manuscript 
of his Bljaganitdvatamsa (see CESS A 3, 156b): 

^Jaipur (Khasmohor) 5514. 

2. Concerning his Ganitakaumudl (see CESS A 3, 
156b-157a) see P. K. Majumdar [A5. 1978a]; P. 
Singh [A5. 1979]; [A5. 1981]; [A5. 1982]; [A5. 
1983/84]; [A5. 1984a]; and [A5. 1984b]; G. Abe [A5. 
1985]; and T. Hayashi [A5. 1986a]. Additional 
manuscripts: 

AS Bengal I.B.6. Bengali. 

^Cambridge R. 15.140. 41ff. Bengali. This manu¬ 
script was copied from lO 596 B for John Bent¬ 
ley (d. 1824) while he was in Calcutta. The date 
in the post-colophon, rendered by Aufrecht as 
A.D. 1791, is actually a copy of that of the arche¬ 
type. 

Chapter 14 was translated into Japanese by T. 
Hayashi in II 3, 1986, 1-34. 


VAGADGURU NARAYANA BHATTA (b. 1513) 

1. Additional manuscripts of his Kdlanirnayavi- 
varana (see CESS A 3, 157a-157b, and A 4, 130a): 

*BORI 102 of 1881/82 = BORI (Dharma) 283. llff. 
Copied on Thursday 11 suklapaksa of Asvina in 
Sarn. 1646 = 9 October 1589. 

BORI 95 of 1884/86 = BORI (Dharma) 284. 12ff. 
Copied by Bhagavana Misra at Labhapura on 
Wednesday 13 kr§napak§a of A§adha in Sarn. 
1652 = 23 July 1595. 

2. Additional manuscripts of his Prayogaratna (see 
CESS A 3, 157b, and A 4, 131b-137a): 

Benares (1953) 2384. Ff. 1-51, 68-207, and 

215-233. Copied in Sarn. (read Saka) 1547 = 
A.D. 1625. Incomplete. 

Benares (1953) 2490. Ff. 1-36, 38, and 43-76. Cop¬ 
ied in Sam. 1689 = a.d. 1632. Incomplete. 
Benares (1953) 2700. Ff. 1-161. Copied in Saka 
1599 = A.D. 1677. 

Benares (1953) 2485. Ff. 1-117. Copied in Sam. 
1748 = A.D. 1691. 

Benares (1953) 2405. Ff. 126-163. Copied in Sam. 

1755 = A.D. 1698. Incomplete. 

Benares (1953) 7753. Ff. 1-130. Copied in Sarn. 
1766 = A.D. 1709. 

VSM (Upadhye) 12186. 184ff. Copied in Saka 1681 
= A.D. 1759. With an anukramanika. 

VSM (Upadhye) 12304. 5ff. Copied in Saka 1701 = 
A.D. 1779. Incomplete (vapikupotsarga). 

PrSB 3313 (Berlin or. oct. 630). 183ff. Copied by 
Ramabhafta Citrarnva, the son of Baja, on 14 
krsnapak§a of Jye§tha in Saka 1705 = ca. 28 
June 1783. 

VSM (Upadhye) 12187. 102ff. Copied in Saka 1705 
= A.D. 1783. Incomplete (purvardha). 

RORI (Udaipur) 3476. 138ff. Copied in Sam. 1841 
= A.D. 1784. 

RORI Cat. VI 24980. 228ff. (ff. 1-6, 8, 20, 25, 
28-29, 146-147, 166, 168, 171, 173, 188-189, 
192-193, and 196-226 missing). Copied in Sarn. 
1847 = A.D. 1790. Incomplete. 

VSM (Upadhye) 12527. 13ff. Copied by Puru^ot- 
tama Kravanta in Saka 1738 = a.d. 1816. Incom¬ 
plete (bhuvanesvaraprayogasanti). 

RORI (Udaipur) 5740. Ff. 2-11 and 13-15. Copied 
by Lak§mana Bhatta Patavardhana in Saka 1744 
= A.D. 1822. Incomplete. 

BHU B.1249. 21ff. Copied in Sam. 1884 = A.D. 
1827. Incomplete (sraddhaprayoga). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


177 


VSM (Upadhye) 12188. 222ff. (ff. 1-13 and 54-71 
missing). Copied by Yasavanta Sapre in Saka 
1752 = A.D. 1830. Incomplete. 

BHU B.4399. 257ff. Copied in Sam. 1895 = A.D. 
1838. Incomplete (samskaraprayoga). 

VSM (Upadhye) 12244. 139ff. Copied by Subrah- 
manya Alvani in Saka 1763 = A.D. 1841. For¬ 
merly property of Kr§nabhatta Adhyapaka. 

BHU C.1843. 90ff. Copied in Sam. 1913 = A.D. 
1856. Incomplete (jalasayotsargatadagotsarga- 
paddhati). 

VSM (Upadhye) 12293. 8ff. Copied in Saka 1780 = 
A.D. 1858. Incomplete (vr§otsarga). 

AS Bengal I 3.666 = IM Calcutta 3239. Ff. 1-24. 
Copied in Sam. 1932 = A.D. 1875. Incomplete 
(punyahavacana). 

PrSB 3314 (Berlin or. oct. 691). 6ff. Copied by Go- 
pala Sarman, the son of Ramacandra Kakirde, on 
a Monday in the krsnapak^a of Jye§tha in Saka 
1810 = 28 May or 10 June 1888. 

AS Bengal I.E.84; and III.F.152. 

AS Bengal I 3.663 = IM Calcutta 6749. Ff. 1-4 and 
18-28. Incomplete. 

AS Bengal I 3.664 = IM Calcutta 8807. Ff. 14-20. 
Incomplete. 

AS Bengal I 3.665 = IM Calcutta 8493. Ff. 1-8; 1-8; 
1-6; 1-4; and 8-34. Incomplete. 

AS Bengal I 3.747 = IM Calcutta 3148. Ff. 1-10. 
Incomplete (vr§otsargapaddhati). 

AS Bengal 2511 (G.6048). 30ff. Incomplete (jalasa- 
yotsargavidhi). Property of Balamukunda on 8 
suklapaksa of A§adha in Sarn. 1933 = ca. 29 
June 1876. 

Baroda 5747. lOff. Incomplete (punahsandhana- 
vidhi). 

Benares (1953) 2383. Ff. 2-21, 24-61, and 61b-125. 
Incomplete. 

Benares (1953) 2404. 144ff. Incomplete. 

Benares (1953) 2465. Ff. 1-169. 

Benares (1953) 2481. Ff. 1-290. Incomplete. 

Benares (1953) 2558. Ff. 1-15. Incomplete. 

Benares (1953) 2593. Ff. 1-9. Incomplete (cuda- 
karma to samavartana). 

Benares (1953) 2605. Ff. 1-48. Incomplete (ends 
with vadhugrhapravesa). 

Benares (1953) 2615. Ff. 70-79. Incomplete (garbha- 
dhana). 

Benares (1953) 2634. Ff. 1-10. Incomplete (kamya- 
vr§otsarga). 

Benares (1953) 2649. Ff. 1-18, 39-74, and 76. 
Incomplete (astakavikrtisraddha). 

Benares (1953) 2660. Ff. 6-12, 17-46, 55-62, and 
65-66. Incomplete. 


Benares (1953) 2661. Ff. 25-56. Incomplete. 

Benares (1953) 7076. Ff. 1-20. Incomplete (kamya- 
sraddha). 

Benares (1953) 7752. Ff. 1-100. 

Benares (1953) 7754. Ff. 1-89. 

Benares (1953) 7861. Ff. 1-18. Incomplete. 

Benares (1953) 7864. Ff. 1-14. Incomplete. 

BHU B.227. 63ff. Incomplete. 

BHU B.234. 28ff. Incomplete. 

BHU B.837. 4ff. Incomplete (pindapitryajha). 

BHU B.1294. 6ff. Incomplete (parvanasthalipaka- 
prayoga). 

BHU B.1369. 7ff. Incomplete (jalasayaramapra- 
ti§thavidhi). 

BHU B.1429. 22ff. Incomplete (vapikupotsarga- 
vidhi). 

BHU B.1676. 231ff. 

BHU B.1980. 47ff. Incomplete (tadagotsargavidhi). 

BHU B.2891. 5ff. Incomplete (tulamahadanapra- 
yoga). 

BHU B.3700. 72ff. Incomplete. 

BHU B.4400. 26ff. Incomplete. 

BHU B.4406. 8ff. Incomplete. 

BORI 514(ii) of 1883/84 = BORI (Dharma) 451. 
8ff. Incomplete (caulopanayanaprayoga). 

GOME Madras D. 15697. 148ff. 

GOME Madras R. 198(a). Ff. 1-27. Telugu. Incom¬ 
plete. Presented in 1910/11 by T. Ramanuja Rao 
of Triplicane. 

HE Oxford 13. Ff. 1-44. Purchased in 1886. 

Mysore ORI B.977. Ff. 1-287. Telugu. (Prayoga- 
sara). 

Mysore ORI C. 142. 45ff. Incomplete (ends with 
prayascitta). 

Mysore ORI C.151. Ff. 1-233. Incomplete. 

Mysore ORI C.196. Ff. 1-380. Incomplete (ends 
with varsasraddha). 

Mysore ORI *C.848. Ff. 1-22. Incomplete (ends 
with a^takasraddha). 

Mysore ORI C.1646. Ff. 1-221. 

Mysore ORI C.2514/2b. Ff. 1-3. Incomplete (garbha- 
dhana). 

Mysore ORI C.2546/12. Ff. 1-22. Incomplete (gar- 
bhadhana to samavartana). 

Mysore ORI P.4225/1. Ff. 1-148. Telugu. 

Mysore ORI P.7022/1. Ff. 1-25. Telugu. 

Mysore ORI P.8310/1. Ff. 1-180. NandinagarL 

PrSB 3315 (Berlin or. oct. 667). 19ff. Incomplete 
(punyahavacana to kautukabandha). 

RORI Cat. II 5565. 25ff. Incomplete (sraddhapra- 
yoga). 

RORI Cat. XVI 36866. 65ff. (ff. 41-43 missing). 
Incomplete. 


178 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Alwar) 3342. 99ff. (ff. 29 and 71-92 miss¬ 
ing). Incomplete. 

RORI (Alwar) 3617. 15ff. Incomplete (pindapitrya- 
jna). 

RORI (Alwar) 3650. 207ff. Incomplete. 

RORI (Jaipur) 4323. 20ff. Incomplete (parvana- 
sthalipaka). 

RORI (Jaipur) 4765. 23ff. Incomplete (navagrahaya- 
jna). 

RORI (Udaipur) 268. 74ff. 

VSM (Upadhye) 12185. 262ff. 

VSM (Upadhye) 12245. 54ff. Incomplete. 

VSM (Upadhye) 12362. 33ff. Incomplete (nava- 
grahamakha). 

WHMRL E.ll.h. Ff. 3-59. Incomplete (ends with 
parvanasthal i pakahoma). 

3. Narayana also wrote a Laksahomapaddhati. 

Manuscript: 

Calcutta Sanskrit College (Smrti) 477. 23ff. 


^NARAYANA (/?. 1525/1559) 

This author (see CESS A 3, 157b, and A 4, 137a) 
refers in his Amrtakumbha to eclipses of both Sarn. 
1616 = A.D. 1559. and of Sam. 1582 = a.d. 1525 
which he had previously described, so that the 
Amrtakumbha is his third such work; in it he dis¬ 
cusses eclipses of Saka 1481 = a.d. 1559, Sam. 1684 
= A.D. 1627, etc. The work requires further investi¬ 
gation. Additional manuscript: 

BORI 413 of 1895/98. Ff. l-3v. Incomplete. 


-^NARAYANA (fl. ca. 1525/1610) 

2. Additional manuscript of his Uparagakriyakrama 
(see CESS A 3, 150b-151a, and A 4, 137a): 

Visvabharati (Adyar) 1055(b). 5ff. Grantha. Incom¬ 
plete. Perhaps identical with *Visvabharati 1389. 

3. Additional manuscript of his Karmapradlpika 
(see CESS A 3, 151a, and A 4, 137a-137b): 

Madras Univ. R.K.S.458. See NCC, vol. 10, p. 78. 


^^NARAYANA {fl. 1571/1578) 

1. Additional manuscripts of his Muhunamartanda 

(see CESS A 3, 157b-163a, and A 4, 137b-138b): * 

RORI Cat. XVI 34682. 162ff. Copied in Sam. 1798 
= A.D. 1741. With his own t ika. 

VSM (Upadhye) 12823. 185ff. Copied by Rama- 
kr§na Dik§ita in Saka 1663 = a.d. 1741. With 
his own tika. 

RORI Cat. IX 29134. 73ff. Copied by Sevarama Josi 
at Haridurga in Sarn. 1824 = a.d. 1767. With his 
own tika. 

RORI Cat. IX 29317. 23ff. Copied in Sam. 1829 = 
A.D. 1772. 

Rattan II 5671. 43ff. Copied in Sarn. 1849 = a.d. 
1792. 

RORI Cat. XVI 34290. 22ff. (f. 6 missing). Copied 
in Sarn. 1852 = a.d. 1795. Incomplete. 

RORI (Jaipur) 4592. 2Iff. Copied by Baijanatha Josi 
in Sarn. 1856 = a.d. 1799. 

BHU B.4250. 13ff. Copied in Sam. 1857 = a.d. 
1800. 

*Poleman 4993 (Columbia, Smith Indie 162). Ff. 
1-19. Copied by KaUnatha Kattikara, the son of 
Ramacandra, on Thursday 2 kr§napak§a of Pau§a 
in Saka 1722 = 1 January 1801. 

PrSB 3668 (Berlin or. fol. 2784). 153ff. Copied by 
Sambhurama Dadhica, a Brahmana, at Jayanaga- 
ra for Devadattaji Misraji on Thursday 11 
krsnapak^a of Magha in Sarn. 1865, Saka 1730 = 
9 February 1809. With his own tika. 

RORI (Udaipur) 6234. 34ff. Copied in Sarn. 1868 = 
A.D. 1811. With a stabaka. 

VSM (Upadhye) 12827. 153ff. Copied in Saka 1738 
= A.D. 1816. With his own tika. 

Oxford CSS I 412 (*c. 315 (1)). Ff. 1-12. Copied on 
Sunday 6 suklapak§a of Margasir§a in Sarn. 1874 
= 14 December 1817. 

RORI (Jaipur) 4025. 56ff. Copied at Jirnapura in 
Sam. 1875 = a.d. 1818. With his own tika. 
Incomplete (to garbhadhana). 

WHMRL 7 235. Ff. 1-21. Copied in Sam. 1878, 
Saka 1743 = a.d. 1821. 

BHU C.3019. 24ff. Copied in Sam. 1881 = a.d. 
1824. 

RORI Cat. IV 21910. 69ff. (ff. 2-5 missing). Copied 
by Ganesa, the son of BapQ Bhatta, in Sam. 
1881 = A.D. 1824. With his own tika. Incom¬ 
plete. 

Oxford CSS I 413 (*c. 316 (4)). Ff. 1-23. Copied by 
(for?) Syovagasa (?), the son of Gopala, for (by?) 
his brother Chotilala Pamnalala on Monday 4 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


179 


kr^napak^a of Phalguna in Sam. 1887, Saka 1752 
= 28 February 1831. 

RORI (Udaipur) 4939. 96ff. (ff. 25, 31-40, 42-43, 
and 65-71 missing). Copied by Motirama Josi at 
Kucamana in Sam. 1888 = a.d. 1831 during the 
reign of Ranajitasimha. With his own fika. 
Incomplete. 

Oxford CSS I 414 (*c. 315 (8)). Ff. 1-17. Copied on 
14 suklapak$a of Bhadrapada in Sam. 1890 = ca. 
28 August 1833. 

RORI Cat. IX 28286. 136ff. (f. 10 missing). Copied 
in Sarn. 1904 = A.D. 1847. With his own fika. 

RORI (Alwar) 2908. 102ff. Copied in Sam. 1912 = 
A.D. 1855. With his own flka. 

VSM (Upadhye) 12826. 122ff. Copied by Rama- 
candra Navathye in Saka 1787 = a.d. 1865. With 
his own tika. 

VSM (Upadhye) 12824. 15ff. Copied by Damodara 
Navathye at Ganjagrama on 8 kr§napak§a of 
Pau§a in Saka 1787 = ca. 9 January 1866. 

RORI Cat. IX 29788. 12ff. Copied by Bakhatavara- 
mala at Nagapura in Sarn. 1923 = a.d. 1866. 

Nagaur 1016. 95ff. Copied in Sarn. 1931 = a.d. 
1874. With his own fika. 

BHU B.2002. 77ff. With his own fika. 

BHU C.1641. 11 Iff. With his own fika. Incomplete. 

BHU C.2002. 15ff. 

BHU C.2379. lOff. Incomplete. 

BHU C.2557. 60ff. With his own tika. Incomplete. 

BHU C.3188. 6ff. Incomplete. 

BHU C.3268. 2ff. Incomplete. 

GJRI 8604/829. Ff. 1-19. 

^Jaipur (Khasmohor) 5140; 5286 (1) (both yatrapra- 
karana); and 5430. 

Mysore ORI *C.590/a. Ff. 10-60. Incomplete. 

Mysore ORI C.2258/1. Ff. 1-66. 

Mysore ORI C.3031. Ff. 1-27. Incomplete (ends 
with saiikrantiprakarana). 

Mysore ORI C.4029/1. Ff. 1-131. 

Mysore ORI C.4585/3. Ff. 1-7. Incomplete 
(samskaraprakarana). 

Mysore ORI C.4585/19. Ff. 1-8. Incomplete (vivaha- 
prakarana). 

Mysore ORI C.4648/6a. Ff. 1-43; and 1-75. 

Mysore ORI C.4665/9. Ff. 1-9. Incomplete (ends 
with prathamartava). 

Mysore ORI C.4666/2. Ff. 1-20. Kannac^a. Incom¬ 
plete (ends with yatraprakarana). 

Mysore ORI P.5368/1. Ff. 1-117. Telugu. 

Mysore ORI P.7954/1. Ff. 1-60. Kannada. Incom¬ 
plete (ends with sarnskaraprakarana). 

Mysore and Coorg 309. 500 granthas. With a vyakh- 
yana. (Martanda). No author mentioned. Property 


of Mahadeva Joyisa of Sringeri. 

NPS (Sanskrit) 8177. 6ff. Incomplete. 

Oxford CSS I 415 (*d. 767 (9)). Ff. 1-21. 

*Paris BN 212 H. F.102. With his own tika. Incom¬ 
plete (8, 5-6). 

Pattan II 13293. 105ff. With his own fika. 

*Poleman 4992 (Columbia, Smith Indie 89). Ff. 1-4, 
7-10, 12-16, and 22. Incomplete (1,1-3, 13; 4, 
11-41; 4, 49-7, 11; and 12, 1-13, 4). Formerly 
property of Devidayalu. 

RORI Cat. IV 20869. 18ff. Incomplete. No author 
mentioned. 

RORI Cat. IV 21297. 19ff. With a tika. Incomplete. 
No author mentioned. 

RORI Cat. VII 26090. 13ff. Incomplete (samskara¬ 
prakarana). 

RORI (Alwar) 2907. 65ff. With his own tika. 
Incomplete. 

RORI (Chittorgarh) 2441. 65ff. With his own tika. 
Incomplete. 

RORI (Chittorgarh) 2966. 5ff. Incomplete. 

RORI (Chittorgarh) 4764. 23ff. 

RORI (Jaipur) 5601. 169ff. (ff. 80-90 missing; and 
ff. 160-171 from a different manuscript). With 
his own tika. Incomplete. 

RORI (Jaipur) 10063. 20ff. (ff. 10, 12, and 18 miss¬ 
ing). Incomplete. 

VSM (Upadhye) 12822. 92ff. With his own tika. 
VSM (Upadhye) 12825. 5ff. Incomplete. 

The Muhunamartanda with the Hindi tika, Su- 
bodhini, of Ganesadatta Pafhaka was published at 
Varanasi [N. D.]. 

2. Additional manuscript of his Laghumuhiirta- 
manaijda (see CESS A 3, 163a, and A 4, 138b): 

IM Calcutta 10367. See NCC, vol. 10, p. 90. 

3. Additional manuscripts of his Martandavallabha 
(see CESS A 3, 163b-165b, and A 4, 138b-139a): 

RORI Cat. XVI 34682. 162ff. Copied in Sam. 1798 
= A.D. 1741. 

VSM (Upadhye) 12823. 185ff. Copied by Rama- 
kr§na Diksita in Saka 1663 = a.d. 1741. 

RORI Cat. IX 29134. 73ff. Copied by Sevarama Josi 
at Haridurga in Sarn. 1824 = a.d. 1767. 

PrSB 3668 (Berlin or. fol. 2784). 153ff. Copied by 
Sambhurama Dadhica, a Brahmana, at Jayanaga- 
ra for Devadattaji Misraji on Thursday 11 
kr§napak§a of Magha in Sarn. 1865, Saka 1730 = 
9 February 1809. 


180 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


VSM (Upadhye) 12827. 153ff. Copied in Saka 1738 
= A.D. 1816. 

RORI (Jaipur) 4025. 56ff. Copied at Jirnapura in 
Sarn. 1875 = A.D. 1818. Incomplete (to garbha- 
dhana). 

RORI Cat. IV 21910. 69ff. (ff. 2-5 missing). Copied 
by Ganesa, the son of BapQ Bhatfa, in Sarn. 
1881 = A.D. 1824. 

RORI (Udaipur) 4939. 96ff. (ff. 25, 31-40, 42-43, 
and 65-71 missing). Copied by Motirama Josi at 
Kucamana in Sam. 1888 = A.D. 1831 during the 
reign of Ranajitasimha. Incomplete. 

RORI Cat. IX 28286. 136ff. (f. 10 missing). Copied 
in Sarn. 1904 = A.D. 1847. 

RORI (Alwar) 2908. 102ff. Copied in Sarn. 1912 = 
A.D. 1855. 

VSM (Upadhye) 12826. 122ff. Copied by Rama- 
candra Navathye in Saka 1787 = A.D. 1865. 

Nagaur 1016. 95ff. Copied in Sarn. 1931 = A.D. 
1874. 

AS Bengal I.A.58. 

BHU B.2002. 77ff. 

BHU C.164i. niff. Incomplete. 

BHU C.2557. 60ff. Incomplete. 

^Jaipur (Khasmohor) 5432. 

Mysore ORI *C.590/b. Ff. 10-60. Incomplete 

(purnsavana to yatraprakarana). 

Mysore ORI C. 4029/2. Ff. 1-131. 

Mysore ORI C.4648/6b. Ff. 1-43; and 1-74. 

Mysore ORI C.4665/10. Ff. 1-9. Incomplete (ends 
with prathamartavaprakarana). 

Mysore ORI *P. 1766/1. Ff. 1-89. Nandinagari. 

Incomplete (ends with uparaganirupana). 

Mysore ORI P.5368/2. Ff. 1-117. Telugu. 

Mysore ORI P.6860. Ff. 1-111. Nandinagari. Incom¬ 
plete (ends with agnyadhanaprakarana). 

Mysore and Coorg 309. 500 granthas. No author 
mentioned. Property of Mahadeva Joyisa of 
Sringeri. 

Oxford CSS I 416 (*d. 763 (1)). Ff. 1-41 and 

43-149. Incomplete (ends in 10, 2). 

*Paris BN 212 H. F.102. Incomplete (8, 5-6). 

Pattan II 13293. 105ff. 

RORI (Alwar) 2907. 65ff. Incomplete. 

RORI (Chittorgarh) 2441. 65ff. Incomplete. 

RORI (Jaipur) 5601. 169ff. (ff. 80-90 missing; and 
ff. 160-171 from a different manuscript). Incom¬ 
plete. 

RORI (Udaipur) 5598. 7ff. Incomplete. No author 
mentioned. 

VSM (Upadhye) 12822. 92ff. 

4. Narayana also composed a Kundamandapadar- 

pana at Taparagrama in Saka 1500 = A.D. 1578. 


Manuscripts: 

Anup 1751. 3ff. Copied by Ganesa Bhafta in Saka 
1516 = A.D. 1594. 

GVS 341 (3127). 2ff. Copied on Thursday 15 sukla- 
pak§a of Vaisakha in Sarn. 1862, Saka 1728 = 1 
May 1806. 

AS Bombay 418. 16ff. Copied in Saka 1788 = a.d. 
1866. With the tika of Gahgadhara. From Bhau 
Daji. 

Anup 1750. 4ff. Copied at Paragrama. 

AS Bengal 1116 (G. 10246). 3ff. (f. 2 missing). 

The Kundamandapadarpana was published in 
Vi^haladlk^itaviracitd mandapakundasiddhi/i, Kal- 
yana-Murnbai Sarn. 1982, Saka 1847 = a.d. 1925, 
pp. 33-36. Verses 41-43 are: 

asit kausikavarasevite manaure 
kr^nah kausikakulavaridhau lalamah // 
tatputro harir api tadrso ’sya putro 
’nanto ’gnipratinidhir ahitagnir asya //41// 
srinarayanakavir aiigajas cakara 
suksmam mandapavidhidarpanarn sukundam // 
yan nyunarn tad dhi ca sastrato ’vagamyam 
tu^yantu kratubhuja etaya maduktya //42// 
sataghnatithibhis tulye salivahasakabdake // 
grantho ’yarn faparagrame racito bahudhanyake 
//43// 


^NARAYANA (fl. ca. 1635/1678) 

2. Additional manuscripts of his Jdtakakaustubha 
(see CESS A 3, 165b-166a, and A 4, 139a-139b): 

RORI (Jaipur) 5506. 82ff. Copied in Sarn. 1830 = 
A.D. 1773. 

PrSB 2935 (Gottingen, Sansc. Sham 48). 72ff. Cop¬ 
ied in Sarn. 1879 = A.D. 1822. 

Mysore ORI *P.2301/1. Ff. 133-202. Telugu. 

Mysore ORI P.6352/2. Ff. 1-77. Telugu. 


^GAJAPATI NARAYANA DEVA {fl. 1649/1667) 

This author was the Maharajadhiraja of Parlakhe- 
medi in the Gahjam District of Orissa from 1649 till 
after 1667. Additional manuscript of his Ayurddya- 
kaumudi (see CESS A 3, 152b): 

Bhubaneswar IV 2 (Jy/20a). 95ff. Oriya. From Parla- 
khemedi, Ganjam District. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


181 


The colophon begins: iti srimadgajapatinarayana- 
devamaharajadhirajaviracitayam. 

*NARAYANA VANDYAGHATIYA (fl. 1681) 

Additional manuscripts of his Smrtisarvasva (see 
CESS A 3, 166b, and A 4, 139b): 

Varendra 133. Ff. 1-13. Bengali. Copied on 18 Sra- 
vana of Sal. San 1271 = ca. 22 July 1864 
(Suddhitattvakarika). 

AS Bengal I.B.45. Bengali. 

Vangiya Sahitya Pari^at 1332. Ff. 1-13. Bengali. 
(Suddhitattvakarika). 

Vangiya Sahitya Pari§at 1524. Ff. 1-10. Bengali. 
(Suddhitattvakarika). 

Vangiya Sahitya Pari^at 1610. Ff. 1-11. Bengali. 
(Suddhitattvakarika-, incomplete). 

*NARAYANA PANDIT A (fl. 1699) 

Narayana (see CESS A 3, 152b) uses as the epoch 
of his Padmalilavilasini Saka 1621 = a.d. 1699. 
There are 11 adhikaras: madhyama, spa§ta, tri- 
prasna, candragrahana, suryagrahana, grahacchaya, 
naksatracchaya, candradarsana, candrasrhgonnati, 
udayasta, and pata. Additional information concern¬ 
ing a manuscript: 

*BORI 162 of A 1883/84. Ff. 1-6. Copied by Guru- 
dasa on a Thursday in the krsnapaksa of Vaisa- 
kha in Saka 1748 = 25 May or 1 June 1826. 

The colophon begins: iti srimatpanditanarayana- 
krta. 

^NARAYANA SAMUDRIKA (fl. ca. 1725) 

1. Additional manuscripts of his Horasudhanidhi 
(see CESS A 3, 166b-167a, and A 4, 139b): 

BHU B.688. 53ff. 

BHU B.3178. 68ff. (Sudhanidhi). 

GJRI 926/38. Ff. 1-12. (Jatakasudhakara of Samu- 
drika). Incomplete. 

Vrndavana 8731. 58ff. (Jatakasudhanidhi). 

2. Additional manuscripts of his Karmaprakasi- 
kavrtti (see CESS A 3, 167a-167b, and A 4, 139b): 


1853, Saka 1718 = a.d. 1796. No author men¬ 
tioned. 

RORI Cat. IX 28622. 83ff. Copied in Sarn. 1879 = 
A.D. 1822. No author mentioned. 

RORI Cat. VIII 26872. 54ff. Copied by Varnsidhara 
Sarman at Ajayadurga in Sarn. 1903 = a.d. 1846. 
Incomplete (to adhyaya 20). Ascribed to Samara- 
sirnha. 

GVS 2865 (863). 6ff. Incomplete (ni§ekadhikara). 

IM Calcutta 1009 C. See NCC, vol. 10, p. 88. 

Oxford CSS I 345 (*d. 802 (1)). Ff. 1-19 and 21-42. 
Incomplete. 

RORI (Udaipur) 4780. Ff. 1-10 and 25-47. Incom¬ 
plete. 

NARAYANA (fl. 1815) 

Author of a Siddhantaratna for Kr^naraja Wode- 
yar (fl. 1799/1868) in Saka 1737 = a.d. 1815. Manu¬ 
script: 

Mysore ORI P.5166/1. Ff. 1-9. Grantha. 

The last verse is: 

sailagnyadrimahimite sakasaratsahghe gate hayane 
yuni srimahisurakr§nanrpateh karunyapathoni- 
dheh // 

labdhajha racitakrtir mrdupada narayanakhyajupa 
sotkantharn kavina mude ’stu vidusarn siddhanta- 
ratnabhidha // 


NARAYANA JOSl (fl. 1877) 

The scribe of many manuscripts (see the final 
volume of CESS) at Tonka in the third quarter of 
the nineteenth century, Narayana prepared an anu- 
kramanika to the Janmapatrlpaddhati of Mana- 
sagara. Manuscript: 

RORI Cat. IV 19009. 4ff. at the end. 


NARAYANA RAMA ACARYA (fl. 1949) 

Author of a tippani on the Nirnayasindhu of 
Kamalakara Bhalta (fl. 1613). The 5th ed. was pub¬ 
lished at Murnbai in 1949. He also wrote a tippani 
on the Yajhavalkyasmrti and the Mitak^ara of 
Vijhanesvara; the 5th ed. was published at Murnbai 
in 1949. 


Benares (1963) 36401. Ff. 1-47. Copied in Sarn. 


182 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


NARAYANA MISRA (fl. 1983) 

Reader in Sarnskrta and Pali at the Kasi Hindu 
Visvavidyalaya, Narayana wrote a tippani in Hindi 
on the Yajhavalkyasmrti, published in the ed. of the 
mula by Umesacandra Pandeya as KSS 178, 3rd ed., 
Varanasi 1983, pp. 643-696, 

NARAYANADATTA DAVE SRI MALI (fl. 
1978/1985) 

A resident of Jodhapura in Rajasthana, Narayana- 
datta has written a series of works on jyoti§a in 
Hindi. These include: Jyoti^a yoga candrika, 6th ed., 
Dilli 1978; Dasaphala darpana, 4th ed., Dilli 1978; 
Phalita j'yotisa, 4th ed., Dilli 1978; Bharatiya jyo- 
ti^a, 10th ed., Dilli 1978; and Ahka j’yotisa, 11th ed., 
Dilli 1979. The 3rd ed. of his work on graphology, 
Hasiaksara vijhdna, was published at Dilli in 1978. 
He also wrote the ganita sections of the Jyotisa aura 
jlvana of Kamalesa Kumara Dave, which was pub¬ 
lished at Jodhapura in 1985. 

*NARAYANADASA SIDDHA GOSVAMIN (fl. ca. 
1525?) 

Additional manuscripts of his Prasnavaisnava 
(see CESS A 3, 168b-171a, and A 4, 140a-140b): 

RORI Cat. V 22321. 51ff. Copied in Sam. 1811 = 
A.D. 1754. 

RORI Cat. IV 21501. 4ff. Copied by Saubhagyavi- 
naya at Thoba in Sarn. 1813 = A.D. 1756. No 
author mentioned. With a Grahadasdphala. 

RORI (Alwar) 2823. 28ff. Copied in Sam. 1826 = 
A.D. 1769. 

BHU C.3314. 9ff. Copied in Sam. 1836 = a.d. 1779. 
Incomplete. 

PrSB 3675 (Berlin or. fol. 2829). Ff. 1-25, 34, 36, 
and 38-52. Copied by Taracanda on Tuesday 10 
suklapak§a of Caitra in Sam. 1845 = 15 April 
1788. Incomplete. 

BHU B.1041. 25ff. Copied in Sam. 1896 = a.d. 
1839. 

RORI Cat. XVI 35642. 51ff. Copied by Vajerama 
Velaji Sukla for Budhamajiro Travadi on 
Sunday 7 kr§napak§a of Puru^ottamamasa (?) in 
Sam. 1909 = a.d. 1852. 

RORI Cat. IV 19468. 26ff. Copied at Pali in Sarn. 
1914 = A.D. 1857. 

BHU C.272. 36ff. Sarada. Incomplete. 

BHU C.937. 51ff. Sarada. 


BHU C.1551. 82ff. 

BHU C.2249. 33ff. Incomplete. No author men¬ 
tioned. 

BHU C.3156. 26ff. Incomplete. 

BHU C.3461. 32ff. Incomplete. 

BHU C.3549. 5ff. Incomplete. 

*Jaipur (Khasmohor) 5274. 

Jodhpur 810 (A). 12ff. Incomplete. 

Mysore (1905) 755. Pp. 122-137. Telugu. Incomplete 
(adhyayas 12-17). 

Mysore (1905) 804. Pp. 11-69. 

Mysore ORI P.6112/2. Ff. 1-42. Telugu. 

Mysore ORI P.6345. Ff. 1-34. Nandinagari. 

Mysore ORI P.7016. Ff. 1-11. Telugu. Incomplete 
(to 3, 13). 

Oxford CSS I 503 (*d. 771 (10)). Ff. 1-2, 5-11, and 
25-34. Incomplete (1, 1-23; 2, 11-5, 2; and 9, 
47-13, 61). 

Oxford CSS I 504 (*d. 772 (4)). Ff. 1-6. Incomplete 
(adhyaya 6). 

Oxford CSS I 505 (*d. 780 (2)). Ff. 1-30. Incom¬ 
plete (ends in 14, 18). 

Oxford CSS I 506 (*d. 785 (7)). Ff. 1/2 and 3-47. 
Incomplete (ends in 15, 35). 

Oxford CSS I 507 (*d. 924 (11) A). Ff. 1-5. Ben¬ 
gali. Incomplete (ends in 2, 17). 

Oxford CSS I 508 (d. 924 (11) B). Ff. 101-104. Ben¬ 
gali. Incomplete (7 col.-8, 52). 

RORI Cat. IV 20714. 5ff. Incomplete. 

RORI Cat. V 23374. 53ff. 

RORI (Alwar) 2822. 31ff. 

RORI (Bikaner) 14664. 34ff. 

RORI (Bikaner) 14692. 39ff. 

RORI (Chittorgarh) 2083. 25ff. Incomplete. No 
author mentioned. 

RORI (Jaipur) 8233. 62ff. (ff. 32-43 missing). 
Incomplete. 

RORI (Jaipur) 9419. 28ff. Incomplete. 

RORI (Udaipur) 5221. 35ff. 

Vrndavana 8381. Ff. 8, 15-18, 84-87, and 94. 
Incomplete. 


^'NARAYANAPRASADA MISRA (fl. 1907/1915) 

The ed. of his Camatkdrajyoti^a (see CESS A 3, 
171a-17lb, and A 4, 140b) was reprinted at Kalya- 
na-Bambai in 1986. From this it appears that he was 
a resident of Lak§mipura, Ayodhya, and completed 
the Camatkarajyoti^a on Thursday 9 kr§napak§a of 
Vaisakha in Sarn. 1972 = 8 April 1915. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


183 


NARMADA (fl. before ca. 750) 

A mathematician mentioned by Sridhara in sutra 
23 of his Ganitapahcavimsi. 

*NARM AD A (fl. ca. 1375) 

Additional manuscripts of his Nabhogasiddhi 
(see CESS A 3, 171b): 

Anup 4783. 25ff. Incomplete. No author mentioned. 
Formerly property of the Maharajas Karnasirnha 
(1631-1669) and AnQpasimha (1669-1698). 

Anup 4784. 36ff. Incomplete. No author mentioned. 


*NAHNIDATTA 

Additional manuscripts of his Bdlavivekinl (see 
CESS A 3, 171b-172b, and A 4, 140b): 

RORI Cat. IV 21323. 4ff. Copied by Samayanidhana 
in Sam. 1713 = A.D. 1656. 

Jodhpur 810 (B). 3ff. Copied in Sarn. 1727 = A.D. 

1670. Incomplete. No author mentioned. 

Oxford CSS I 409 (*d. 767 (2)). Ff. 1-4. Copied on 
Tuesday 14 kr§napak§a of Jye§tha in Sam. 1824 
= 16 (?) June 1767. 

Calcutta Sanskrit College 185. 3ff. Copied in Sarn. 

1853 = A.D. 1796. Ascribed to Sripati. 

GJRI 11059/1113. Ff. 1-8. Maithili. Copied in Sal. 
San 1212 = A.D. 1804. 

Oxford CSS I 410 (*b. 52). Ff. 1-12. Copied by 
Ramadayalu Giri at Girijapura in Vindhyak§etra 
on Tuesday 12 krsnapak^a of Margasir^a in 
Sarn. 1865 = 13 December 1808. With a tika. 
BHU C.2077. 7ff. Copied in Sarn. 1872 = A.D. 1815. 
No author mentioned. 

WHMRL K.3.j.b and K.3.C.B. Ff. 1-6. Copied on 
Sunday 10 kr§napak§a of Asvina in Sarn. 1874, 
Saka 1739 = 2 November 1817. With a tika. 
GJRI 8496/721. Ff. 1-8. Maithili. Copied in Saka 
1761 = A.D. 1839. 

GJRI 11062/1116. Ff. 1-7. Maithili. Copied in Sal. 
San. 1272 = A.D. 1864. 

GJRI 11064/1118. Ff. 1-5. Maithili. Copied in Saka 
1815 = A.D. 1893. 

Baroda 13453(j). Ff. 20v-27. Nandinagari. 

BHU C.43. llff. No author mentioned. 

BHU C.3029. 4ff. No author mentioned. 

GJRI 3183/395. Ff. 1-12. No author mentioned. 

GJRI 8388/613. Ff. 16v-21. Maithili. 


GJRI 8492/717. Ff. 1-3. Maithili. 

GJRI 8494/719. Ff. 1-13. 

GJRI 8495/720. Ff. 1-5. Maithili. 

GJRI 8497/722. Ff. 1-10. Incomplete (ends in verse 
23). 

GJRI 8498/723. Ff. 2-8. Incomplete. 

GJRI 8570/795. Ff. 1-4. Maithili. 

GJRI 11063/1117. Ff. 3-4. Maithili. Incomplete. 
GJRI 11089/1143. Ff. 2-14. Maithili. Incomplete. 
*Jaipur (Khasmohor) 5311 and 5433. Both ascribed 
to Vahnidatta. 

Kathmandu (1965) 111 (638). No ff. given. Nevari. 

Ascribed to Lahnidatta. 

Oxford CSS I 411 (*d. 751 (12)). Ff. 1-5.^ 

RORI (Alwar) 5486 (2). 8ff. Ascribed to Sridatta. 
WHMRL 7 236. Ff. 1-5. 

The Pahcavimsatika was published with the 
Hindi vyakhya, Indumatl, of Ramacandra Jha as 
Kisora GM 1, Varanasi 1981; and with the Sanskrit 
and Hindi tika, Gambhlrd, of Radhakanta Thak- 
kura as Harajlvanadasa SG 34, Varanasi 1985. 

*NIKA^A RAK^ASI 

Additional manuscripts of her Prasnasdra (see 
CESS A 3, 172b-173a, and A 4, 140b): 

Oxford CSS I 523 (b. 98 (1) B.I). Ff. 148-153v. Ben¬ 
gali. 

Oxford CSS I 524 (d. 924 (7)). Ff. 1-6. Bengali. 


^NITYANANDA 

Additional manuscripts of his Is takdlasodhana 
(see CESS A 3, 173a-173b, and A 4, i41a): 

RORI (Chittorgarh) 2579. 2ff. Copied in Sarn. 1900 
= A.D. 1843. 

Kathmandu (1964) 23 (2892). 3ff. Copied by Rudra- 
deva in Saka 1786, Sarn. 1921 = A.D. 1864. With 
the udaharaiia of <Malajit> Vedarigaraya. 

RORI Cat. IV 20805. 9ff. (ff. 7-8 missing). Copied 
in Sarn. 1921 = A.D. 1864. (I^ (asodhanoddha- 

rana). 

BHU C.4854. 2ff. Sarada. (Janmasamayoddharana). 
BHU C.4855. 2ff. Sarada. Incomplete. 

Kathmandu (1964) 24 (2893). 3ff. Incomplete. 


184 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


-^NITYANANDA (fl. 1628/1639) 

1. Additional manuscripts of his Siddhantasindhu = 

Sdrani Sahajahdni (see CESS A 3, 173b): 

RORI (Alwar) 2627 = *Alwar 2014. 44Iff. Copied 
in Sarn. 1912 = a.d. 1855. 

^Jaipur (Khasmohor) 4960; 4961; and 4962. 

2. Additional manuscripts of his Siddhdntardja (see 

CESS A 3, 173b-174a, and A 4, 141b): 

*AS Bombay 264. 8ff. Copied by Sukhananda, the 
son of Vahalaji Josi, at Nafipadra on Saturday 7 
krsnapak§a of Magha in Sarn. 1725, Saka 1590 = 
13 February 1669. 

RORI (Alwar) 2619 = *Alwar 2005. 61ff. Copied 
on Thursday 10 suklapaksa of Karttika in Sarn. 
1903 = 29 October 1846. 

Poona, Mandlik. Jyotisha 15. 54ff. Copied from a 
Jayapura manuscript, allegedly in Sarn. 1696 = 
A.D. 1639 (the date of composition). 

IM Calcutta 5511. (Siddhantasdra). Incomplete. See 
NCC, vol. 10, p. 123. 

RORI (Udaipur) 3150. 21ff. Incomplete. 


^'NITYANANDA PANT A PARVATIYA (fl. 

1922/1932) 

Author also (see CESS A 3, 174a, and A 4, 141b) 
of a Saniskdradtpaka, which includes a section on 
grahayaga. The Samskdradlpaka was edited by 
Ramacandra Panasikara Sastrin as KSS 95, 2nd. ed., 
Benares 1946 (the preface is dated Sam. 1989 = a.d. 
1932). 

NIDHIPANI 

Author of a tippani on the Samarasdra of 
Ramacandra. Manuscript: 

Mithila. See NCC, vol. 10, p. 130. 


NIMAICARANA 

Author of a Ganita. Manuscripts: 

Bhubaneswar 2.Cy/302. In Oriya. 
Bhubaneswar 2.G/84. 


NIMBADEVA (fl. 1721) 

Author in Saka 1643 = a.d. 1721 of an Oriya 
t ika on the Suryasiddhdnta. Manuscripts: 

Bhubaneswar 2.Cy/383. 

Bhubaneswar IV 189 (Jy/5). 157ff. Oriya. From 
Puri. 

Bhubaneswar IV 191 (Jy/42) 168ff. Oriya. From 
Parlekhemindi, Ganjam District. 


^NIRBHAYARAMA BHAJJA 

A resident of Kakaroli near Dvarika, Nirbhaya- 
rama wrote a Vratotsavanirnaya = Vratotsavaparva- 
tithinirnaya, which is apparently identical with his 
Sarnvatsarotsavakdlanirnaya (see CESS A 4, 
141b-142a). Manuscripts: 

Baroda 9062. 20ff. Copied in Sarn. 1894 = a.d. 
1837. 

Baroda 4252. 29ff. 

Baroda 9624. 16ff. 

IM Calcutta 3037. See NCC, vol. 10, p. 151. 

NPS (Sanskrit) 9130. 20ff. 

RORI Cat. Ill 18037. 22ff. 

RORI Cat. XVI 37482. 19ff. 

RORI (Udaipur) 4956. Ff. 1-16 and 19-38. Incom¬ 
plete. 


VARARAJANA NIRMALAKANTHA 

Author of an Adhimdsaganand. Manuscript: 
BHU C.1536. 42ff. 


NILAKANTHA 

Author of an Ak^avidydparlksd. Manuscript: 
Mysore (1905) 395. 7pp. Grantha. 


^NILAKANTHA 

Additional manuscripts of his Grahaldghava- 
sdrant (see CESS A 3, 174b, and A 4, 142a): 

BHU C.3311. 68ff. (Navagrahakouhaka). 

RORI Cat. IV 21580. 2ff. 

RORI (Chittorgarh) 1242. 2ff. Incomplete. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


185 


RORI (Udaipur) 542. 16ff. Incomplete. 


*NILAKANTHA 

Additional manuscript of his Jatakapaddhati (see 
CESS A 3, 174b): 

GJRI 8424/649. Ff. 1-8. Maithili. 


NlLAKANTHA 

Author of a fika, Makaranddscarya, on the 
Makaranda of Makaranda {fl. 1478). Manuscript: 

Patan II 2781. Ff. 1-3. 

Verse 2 is: 

gururatnam si§tapadabjayugmarn 
dhyatva bhato labdhamatih prasadat // 
srinilakantho vivrnoti padyair 
bhavanti gudha makarandasuktah HIH 


NlLAKANTHA 

Author of a Laghulampdka, presumably based on 
the Lampdka of Padmanabha. Manuscripts: 

Mysore (1905) 395. 6pp. Grantha. 

Mysore (1905) 835. 26pp. (5 adhyayas). 


NlLAKANTHA 

Collaborator in composing a Vdmphlnala in 
Oriya. Manuscript: 

Bhubaneswar IV ganita 57 (G/40). 50ff. Oriya. 
Incomplete. From Bhubaneswar, Puri District. 

NlLAKANTHA 

Author of a lika, Sujnato^inl, on the Llldvatl 
of Bhaskara (b. 1114). Manuscript: 

PrSB 2916 (Tubingen Ma I 747). 208ff. Oriya. 


NlLAKANTHA DASA 

Collaborator in composing a Ganita in Oriya. 
Manuscript: 

Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 
From Ranapur, Puri District. 

NlLAKANTHA PATJANAYAKA 

Collaborator in composing a Pd(hasamudra in 
Oriya. Manuscript: 

Bhubaneswar IV ganita 45 (G/42). 119ff. Oriya. 
From Turintra, Balianta, Puri District. 


NlLAKANTHA BHATT^ 

Author of a Sanistoira. Manuscript: 

RORI (Jaipur) 8480. If. Copied by Nirbhayarama 
Vyasa in Sarn. 1892 = A.D. 1835. 


* NlLAKANTHA BHATTA 

Author of a Sahksiptatithyddinirnaya\ cf. the 
Tithiratnamdld and Tithyddikrtya of Nilakantha 
(see CESS A 3, 175a). Manuscript: 

Benares (1956) 13587. Ff. 1-15. Copied in Sarn. 
1817 = A.D. 1760. 


NlLAKANTHA MOLHE 

Author of Vihdrakdrikds on sulba. Manuscripts: 

Baroda 8429. 8ff. Copied in Saka 1686 = A.D. 1764. 
With a vyakhya. 

Baroda 2292. lOff. Copied in Saka 1727 = A.D. 
1805. With a vyakhya. 

AS Bengal 1131 (G.1012). 5ff. With a vivarana. For¬ 
merly property of Rama Bhafta, the son of Bala- 
sarasvati Bhatta, the son of Pheni BhaUa Gah- 
kara. 

Baroda 5959. 5ff. With a vyakhya. Incomplete. 
Baroda 8470. 9ff. With a vyakhya. 

WRI 3695. 4ff. 

Wai 2652. 2ff. 


The last verse is: 


186 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


giyate sulbavihita pitryajnasya karika // 
nilakanthena vidu§a nirmitah karika imah // 

*GARGYAKERALA NILAKANTHA SOMAYAJIN 
(b. ca. 14 June 1444) 

6. Additional manuscripts of his Tantrasahgraha 
(see CESS A 3, 176a-177a, and A 4, 142b): 

PrSB 2921 (Miinchen Malay. 9). 280ff. Malayalam. 
Copied by Cunhish (Whish) at Calicut on 10 May 
1827. With a Malayalam tika. 

Hoshiarpur, K. V. Sarma (now at Adyar, Madras). 
Copied from the Tripunithura manuscript by 
Rama Varma Maru Thampuran in 1941. With 
the Laghuvivrti of Sankara. See ed. Sarma, p. 
xviii. 

Kerala — (16932 A). 13ff. Malayalam. From KiH- 
manur. See ed. Sarma, pp. xix-xx. 

Tripunithura 543 B. Malayalam. With the Laghuvi¬ 
vrti of Sankara. See ed. Sarma, p. xviii. 

WRI 3810. 195ff. Malayalam. With the Laghuvivrti 
of Sankara. Formerly property of the Varanasi 
family of Namputiri Brahmanas. See ed. Sarma, 
pp. xvii-xviii. 

7. Additional manuscript of his AryabhaGyabhasya 
(see CESS A 3, 177a-177b, and A 4, 142b): 

GOML Madras R.5175. 38ff. Grantha. Copied in 
1925/26 from a manuscript of Tippan Nambudi- 
rippad of Ponnurkottamana, Perumbavur, 
Travancore State. Incomplete (on ganita 12 only). 

*NILAKANTHA (Ji. 1569/1587) 

1. Additional manuscripts of his Jyotihsaukhya (see 
CESS A 3, 177b-179a, and A 4, 142b): 

Mysore ORI C.2488. Ff. 1-118. Copied on Thurs¬ 
day 5 suklapak§a of A^adha in Saka 1865 = 5 
August 1943. (Sarnhitasaukhya). 

*Jaipur (Khasmohor) 5271. Incomplete (adhyaya 28, 
na§tajataka, of the Horasaukhya). 

Poleman 4902 (Columbia, Smith Indie 152). Ff. 
1-10. Incomplete (vilasa 10, rahucara, of the 
Sarnhitaskandha). No author mentioned. 

RORI (Alwar) 3928 = *Alwar 1795. 121ff. (Samhi- 
tdskandha). 

2. Additional information concerning a manuscript 
of his Samayasaukhya (see CESS A 3, 179b): 


RORI (Alwar) 3927 = * Alwar 1525. 29ff. (ff. 1-4 
missing). Incomplete. 

Additional manuscripts of his Tdjikanllakanihi 

(see CESS A 3, 180a-189a, and A 4, 143a-144b): 

Oxford CSS I 357 (*d. 808 (5)). Ff. 1-26. Copied by 
Narayana on Wednesday 1 suklapak§a of Sarad I 
in Saka 1584 = 3 September 1662. (sarnjha). 

BHU C.4822. 52ff. Copied in Sam. 1725 = a.d. 
1668. 

RORI Cat. VI 24330. 27ff. Copied at Pafana in Sam. 
1736 = A.D. 1679. With the fika of Visvanatha. 

RORI Cat. XVI 34368. 76ff. (ff. 37-39 and 41 miss¬ 
ing). Copied by Caturbhuja Vyasa at Vikrama- 
nagara in Sam. 1785 = a.d. 1728. With the tika 
of Visvanatha. Incomplete. 

RORI Cat. XVI 36334. 18ff. Copied by Candradhara 
in Sam. 1787 = A.D. 1730. (sarnjha). 

RORI (Udaipur) 6500. llOff. (ff. 81-84 missing). 
Copied by Devanatha in Sam. 1800 = a.d. 1743. 
With the tika of Visvanatha. (varsa; 
incomplete). 

Oxford CSS I 358 (*d. 766 (8)). Ff. 1-21 and 
<22-31 >; and ff. 12-17. Copied by Premarama 
on Tuesday 13 suklapak§a of Magha in Sarn. 
1813, Saka 1678 = 1 February 1757. Incomplete 
(var§a 6,55-sarnjha 2, 76 missing). 

RORI (Chittorgarh) 1777. 43ff. (f. 1 missing). Cop¬ 
ied by Gahgavi§nu in Sarn. 1821 = a.d. 1764. 
Incomplete. 

RORI (Chittorgarh) 2272. 5ff. Copied by Harasah- 
kara in Sam. 1824 = a.d. 1767. Incomplete 
(§odasayogavicara). 

RORI (Jaipur) 5818. 37ff. Copied at Yodhanagara in 
Sam. 1840 = a.d. 1783. 

RORI (Jaipur) 9667. 28ff. Copied by Dula, the son 
of Jasakarana, at Nagora in Sarn. 1840 = a.d. 
1783. 

RORI (Alwar) 2809. 41ff. Copied in Sam. 1846 = 
A.D. 1789. (phalatantra). 

BHU C.3429. 78ff. Copied in Sam. 1847 = a.d. 
1790. With the tika of Visvanatha. 

Oxford CSS I 359 (*d. 750 (3)). Ff. 1-20. Copied by 
Purnendu at Hari’s house in Kasi on Monday 
amavasya of the kr§napak§a of Bhadrapada in 
Sam. 1848 = 26 December 1791. (var§a). 

RORI (Chittorgarh) 555. 17ff. Copied by Jasarupa 
R§i in Sam. 1848 = a.d. 1791. 

RORI (Alwar) 2804. 59ff. Copied in Sam. 1853 = 
A.D. 1796. (var§a). 

Vrndavana 10846. 19ff. Copied by Bhagavanadasa in 
Sarn. 1853 = A.D. 1796. (prasna). 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


187 


RORI Cat. VI 24621. 49ff. Copied in Sam. 1860 = 
A.D. 1803. With the tika of Visvanatha. (samjha). 

RORI Cat. XVI 34393. 315ff. Copied in Sam. 1863 
= A.D. 1806. With the tika of Govinda. 

AS Bengal I 3.85 (I.D.23 (3)). 2ff. Copied in Sam. 
1865, Saka 1731 = A.D. 1808/9. (samjha). 

RORI (Jaipur) 3489. 52ff. (ff. 1-8 missing). Copied 
in Sarn. 1865 = A.D. 1808. Incomplete. 

RORI (Jaipur) 3877. 39ff. Copied by Sankara Ma- 
thena at Rupanagara in Sarn. 1865 = A.D. 1808. 

PrSB 2958 (Gottingen Sanscr. Sham 50). 4Iff. Cop¬ 
ied by Nathamalla in the suklapak§a of Jye§tha 
in Saka 1733 = ca. 21 May-5 June 1811. (sarnjha 
and var§a). 

Oxford CSS I 511 (*d. 766 (9)). Ff. 1-42. Copied on 
Friday 2 kr§napak§a of Karttika in Sam. 1868, 
Saka 1733 = 1 November 1811. (Prasnakau- 
mudi). 

RORI Cat. IV 19127. 102ff. Copied in Sarn. 1869 = 
A.D. 1812. With the tika of Visvanatha. (varsa). 

RORI Cat. IV 19010. 45ff. Copied by Ramaratna 
Misra in Sarn. 1883 = A.D. 1826. With the tika 
of Visvanatha. (var§a). 

Vrndavana 3428. 37ff. Copied by Vrndavanadasa in 
Sarn. 1883 = A.D. 1826. 

*Poleman 5002 (Columbia, Smith Indie 160, part 3). 
Ff. 1-2 and 2b-13. Copied by Ramadina Misra 
on Sunday 2 krsnapak§a of Caitra in Sarn. 1895 
(read 1885), ^aka 1750 = 19 April 1829. 

(prasna). 

GJRI 8485/710. Ff. 20-34. Maithili. Copied in Saka 
1754 = A.D. 1832. Incomplete. 

RORI (Jaipur) 2591. 35ff. (ff. 28-29 missing). Cop¬ 
ied in Sam. 1890 = A.D. 1833. 

PrSB 3680 (Berlin or. fol. 2296). 25ff. Copied by 
Haridasa, a Vai$nava, at Jayapura, for Vyasaji 
Prasadaji in Sarn. 1892 = A.D. 1835. (var§a). 

RORI (Jaipur) 2511. 50ff. Copied by Kr§nalala in 
Sam. 1892 = a.d. 1835. 

Oxford CSS I 360 (*d. 750 (2)). Ff. 1-21. Copied by 
Narayana Bhafta on Monday 9 suklapak§a of 
Suti° in Sarn. 1895, Saka 1760 = 2 July 1838 
from Oxford CSS I 359. (var§a). 

BHU C.3091. 13ff. Copied in Sam. 1896 = a.d. 
1839. Incomplete. 

BHU C.3139. 23ff. Copied in Sam. 1899 = a.d. 
1842. Incomplete. 

RORI (Jaipur) 9645. 46ff. Copied in Sarn. 1907 = 
A.D. 1850. With the tika of Visvanatha. (var$a). 

RORI (Alwar) 2856. 50ff. Copied in Sarn. 1910 = 
A.D. 1853. (prasna). 

RORI (Alwar) 2806. 38ff. Copied by Ramalala in 
Sarn. 1912 = a.d. 1855. (samjha). 

RORI (Alwar) 5515. 48ff. Copied in Sarn. 1915 = 


A.D. 1858. (var^a). 

BHU C.2674. 14ff. Copied in Sam. 1917 = a.d. 
1860. 

RORI (Alwar) 6192. 37ff. Copied by Sivadayala in 
Sarn. 1917 = a.d. 1860. (varsa). 

Vrndavana 8842. 16ff. (ff. 7-8, 12, and 14 missing). 
Copied in Sarn. 1917 = a.d. 1860. (samjha; 
incomplete). 

RORI Cat. VI 24003. 24ff. Copied by Bhagavana- 
canda at Canoda in Sarn. 1923 = a.d. 1866. With 
the tika of Visvanatha. (sarnjha). 

RORI Cat. IX 29876. 28ff. Copied in Sam. 1923 = 
A.D. 1866. 

GJRI 8427/652. Ff. 1-16. Copied in Sarn. 1925 = 
A.D. 1868. (sarnjha). 

RORI Cat. II 6703. 48ff. Copied in Sam. 1925 = 
A.D. 1868. (PrasnakaumuePi). No author men¬ 
tioned. 

RORI (Udaipur) 6115. 19ff. and 4ff. Copied by 
Haridatta in Sarn. 1927 = a.d. 1870. (sarnjha). 
RORI Cat. IX 28682. 40ff. Copied by Govindarama 
in Sarn. 1932 = a.d. 1875. With the tika of 
Visvanatha. 

Oxford CSS I 512 (*d. 750 (9)). Ff. 1-29. Copied on 
Wednesday 14 kr§napak§a of Sravana in Sarn. 
1940 = 29 August 1883. (Prasnakaumudl). 
Oxford CSS I 361 and 513 (*d. 801 (4)) A and B. 
Ff. 1-3, 3/4, and 4-15; ff. 1-26; ff. 1-18; and f. 3. 
Copied on Thursday 5 kr§napak§a of Jye^tha in 
Sam. 1954 = 17 June 1897; and on Saturday 7 
krsnapak^a of Jye§tha in Sarn. 1954 = 19 June 
1897. 

RORI (Jaipur) 2596 (2). Ff. 3-4. Copied in Sam. 

1956 = A.D. 1899. Incomplete (var§ari§tavicara). 
ABSP 2396. 64ff. 

ABSP 6024. lOff. Incomplete. 

ABSP 6920. 26ff. 

Allahabad Municipal Museum 23 (1); 23 (2) (prasna; 
incomplete); 24 (with a tika); 88 (incomplete); 
89; and 150 (phala). See NCC, vol. 10, p. 179. 

AS Bengal I.B.9. (var§a; and prasna); III.E.131; and 
III.H.30. All Bengali. And I.D.23. (samjha). 

Berlin 883 (Chambers 513). Ff. 1-11. (prasna; 

incomplete). No author mentioned. 

BHU B.3712. 47ff. 

BHU B.3719. 9ff. Incomplete. 

BHU B.3722. 12ff. Incomplete. 

BHU B.3723. 6ff. Incomplete. 

BHU B.4340. 46ff. Incomplete. 

BHU B.4441. 14ff. Incomplete. 

BHU C.73. 38ff. Sarada. 

BHU C.299. 43ff. (var§a). 

BHU C.1572. 27ff. Incomplete. 


188 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


BHU C.2145. 52ff. With a tika ascribed to Cinta- 
mani. 

BHU C.2730. 21ff. With a tika. Incomplete. 

BHU C.2990. 28ff. Incomplete. 

BHU C.3005. 8ff. Incomplete. 

BHU C.3306. 20ff. 

BHU C.4105. 24ff. Sarada. Incomplete. 

BHU C.4642. 37ff. Sarada. Incomplete. 

BHU C.4683. 34ff. Sarada. 

BM Or. 6825. 

Columbia, Smith Sanskrit 2. Ff. 1-3 and 5-23 (text 
continuous), (prasna, verses 1-179b). 

GJRI 8428/653. Ff. 1-30. 

GJRI 8429/654. Ff. 1-11 and 14-49. Maithili. 

Incomplete. 

GJRI 8430/655. 63ff. Maithili. Incomplete. 

GJRI 8431/656. Ff. 4-10. Incomplete. 

GJRI 8432/657. Ff. 1-11. Maithili. Incomplete. 

GJRI 8433/658. 2ff. Maithili. Incomplete. 

GJRI 8434/659. Ff. 6-56 and 70-77. Maithili. 

Incomplete. 

GJRI 8435/660. Ff. 1-7. Incomplete. 

GJRI 8436/661. Ff. 1-80. Maithili. 

GJRI 8437/662. Ff. 1-22. Maithili. Incomplete. 

GJRI 8438/663. Ff. 1-52. Maithili. (var§a). 

GJRI 8664/889. Ff. 1-24. (varsa). 

GJRI 9705/1015. Ff. 1-25, 27-39, and 50-53. 
(var§a). With the fika of Visvanatha. 
Incomplete. 

GJRI 11045/1099. Ff. 1-4 and 19-56. Maithili. 

Incomplete. 

GJRI 11046/1100. Ff. 1-11 and 14-28. Maithili. 

Incomplete. 

GJRI 11047/1101. Ff. 1-4. Maithili. Incomplete. 

GJRI 11048/1102. Ff. 1-3. Maithili. Incomplete. 

GJRI 11145/1199. 3ff. Maithili. (varsa; incomplete). 
IM Calcutta 9198 (incomplete); and 10121 (var§a). 
See NCC, vol. 10, p. 179. 

*Jaipur (Khasmohor) 1621 (samjha; with the tika of 
Govinda); 1622 (with the tika of Govinda); 5012; 
5270 (samjna; with the fika of Govinda); 5272 
(var§a); 5277; 5278 (var§a); 5417 and 5423 (both 
sarnjha and with the fika of Visvanatha); 5434 
and 5445 (both var§a); 5490; 5523 (var§a; 
ascribed to Dhundiraja); and 5525 (sarnjha; with 
the tika of Visvanatha). 

Kathmandu (1965) 70 (5532). 76ff. 

Kathmandu (1965) 71 (5533). 62ff. 

Kathmandu (1965) 72 (5534). 70ff. Incomplete. 
Kathmandu (1965) 73 (5537). 52ff. 

Kathmandu (1965) 74 (4201). 23ff. (var§a). 
Kathmandu (1965) 75 (4200). 57ff. (sarnjha and 
var§a). 

Kathmandu (1965) 82 (5736). 99ff. With the tika-of 


Visvanatha. 

Leipzig 1131. Ff. 13-15. Incomplete (§odasayoga 
and sahama). 

Mysore ORI C.3870/1. Ff. 1-65. 

Mysore ORI P.989/1. Ff. 1-22. Nandinagari. (var§a). 

Mysore ORI P.1335/4. Ff. 47-139. Telugu. Incom¬ 
plete. 

Mysore ORI P.6307/2. Ff. 33-41. Telugu. Incom¬ 
plete. 

Mysore ORI P.6723. Ff. 1-9. Grantha. 

Mysore ORI P.8816/4. Ff. 127-132. Nandinagari. 

Mysore ORI P.9710/4. Ff. 41-74. Telugu. (var§a). 

Mysore ORI P.10049/2. Ff. 1-37. Nandinagari. 
(var§a). 

Mysore ORI P.10632/1. Ff. 3-17. (samjha); and 
P.10632/2. Ff. 1-19. (var§a). Nandinagari. 

Nagaur 991. 22ff. 

NPS (Sanskrit) 8207. Ff. 1-132; and 25-86. With a 
tika. Incomplete. 

NPS (Sanskrit) 8226. Ff. 2-19. With a tika. Incom¬ 
plete. 

NPS (Sanskrit) 8258. Ff. 6-15. Incomplete. 

NPS (Sanskrit) 8799. Ff. 1-80. With the tika of 
Visvanatha. (var§a). 

NPS (Sanskrit) 8932. 50ff. 

NPS (Sanskrit) 9041. Ff. 1-8. With a tika. Incom¬ 
plete. 

Oxford CSS I 362 (c. 319 (1)). Ff. 1-48. With the 
tika of Visvanatha. (sarnjha 1, 1-3, 10). 

Oxford CSS I 363 (*d. 751 (9)). Ff. 1-12. (samjha). 

Oxford CSS I 364 (*d. 753 (7)). Ff. 1-7, 11-15, and 
26-27; and ff. 3-11 and 16-30. With the tika of 
Visvanatha. (sarnjha 1, 2-17; 1, 45-2, 13; and 2, 
17-50). 

Oxford CSS I 365 (d. 855). Ff. 1-9, 9b-29, 31-32, 
32b-40, and 40b-60; 2ff.; and ff. 69-149. With 
the tika of Harsadhara. (sarnjha). 

Oxford CSS I 514 (*d. 766 (4)). Ff. 1-14. (Prasna- 
kaumudl). 

Poona, Mandlik. Jyotisha 43. 34ff. Incomplete. 

PrSB 3679 (Berlin or. fol. 2172). 56ff. With the tika 
of Visvanatha. (samjha). 

RORI Cat. IV 18961. 59ff. With the tika of Go¬ 
vinda. (samjha). 

RORI Cat. IV 18963. 75ff. With the tika of Go¬ 
vinda. 

RORI Cat. IV 19474. Ff. 28-144. Copied by 
Khusalacanda, the son of Juharamalla. With the 
tika of Govinda. Incomplete (see RORI 21995). 

RORI Cat. IV 21995. 27ff. With the tika of Go¬ 
vinda. Incomplete (see RORI 19474). 

RORI Cat. V 22328. 55ff. With the tika of Visva¬ 
natha. (sarnjha). 

RORI Cat. y 23054. 48ff. Incomplete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


189 


RORI Cat. VI 23750. 8ff. With the tika of Visva- 
natha. (samjha), 

RORI Cat. VI 24386. 60ff. With the tika of Visva- 
natha. 

RORI Cat. VIII 26912. 45ff. 

RORI Cat. IX 28306. lOff. (f. 9 missing). Incom¬ 
plete. (var§aphalotpatti). 

RORI Cat. IX 29798. 25ff. Incomplete. 

RORI Cat. XVI 34171. 108ff. (ff. 19, 47-49, 54, 62, 
and 67 missing). With the tika of Govinda. 
(samjha; incomplete). 

RORI Cat. XVI 36542. 15ff. With a fippana. Incom¬ 
plete. 

RORI Cat. XVI 36730. 36ff. (ff. 13-19, 22, and 35 
missing). With the tika of Harsadhara. 
Incomplete. 

RORI (Alwar) 2803. 145ff. With the tika of 

Madhava. 

RORI (Alwar) 2807. 59ff. (samjha). 

RORI (Alwar) 2810. 37ff. With the tika of 

Madhava. (var§a). 

RORI (Alwar) 2857. 35ff. (prasna). 

RORI (Alwar) 4578. 8ff. Incomplete (paddhati). 

RORI (Alwar) 6239. 28ff. Incomplete (to bhavadh- 
yaya). 

RORI (Bikaner) 14685. 17ff. With the tika of 

Visvanatha. (samjha; incomplete). 

RORI (Bikaner) 14688. 94ff. With the tika of 

Visvanatha. (sarnjha and var§a). 

RORI (Bikaner) 16991. 22ff. Incomplete. 

RORI (Chittorgarh) 35. 42ff. Incomplete (to arista). 

RORI (Chittorgarh) 851. 45ff. (ff. 1 and 24-37 miss¬ 
ing). Copied by Jayacanda. Incomplete. 

RORI (Chittorgarh) 1711. 27ff. 

RORI (Chittorgarh) 2280. 5ff. Incomplete (sodasa- 
yogavicara). 

RORI (Jaipur) 2710. 18ff. (ff. 3-4 missing). Incom¬ 
plete. 

RORI (Jaipur) 3640. 15ff. Incomplete. 

RORI (Jaipur) 3844. 22ff. 

RORI (Jaipur) 7102. 71ff. (f. 1 missing). With the 
tika of Govinda. (bhavadhyaya; incomplete). 

RORI (Jaipur) 8220. 16ff. With the tika of Visva¬ 
natha. (sarnjha; incomplete). 

RORI (Jaipur) 9280. 46ff. Incomplete. 

RORI (Jaipur) 10294. 36ff. (ff. 1, 6, and 8-9 miss¬ 
ing). With the tika of Visvanatha. Incomplete. 

RORI (Jaipur) 11041. 62ff. With a Rajasthani sta- 
baka. Incomplete. 

RORI (Udaipur) 4809. Ff. 2-31. Incomplete. 

RORI (Udaipur) 4948. Ff. 2-47. (var§a; incomplete). 

RORI (Udaipur) 5008. Ff. 18-24, 28-30, and 50-62. 
(var§a; incomplete). 

RORI (Udaipur) 6262. 96ff. (f. 1 missing). With an 


udahrtivyakhya. (sarnjha; incomplete). 

RORI (Udaipur) 6462. 34ff. (ff. 1-8 and 20 miss¬ 
ing). Incomplete. 

Visvabharati (Adyar) 744(a). lOff. Grantha. (var§a; 
ends with ari§tabhahga). 

Vrndavana 220. 28ff. Bengali. Copied by Gaura Ca- 
ranadasa of Udaipur. 

Vrndavana 5875. lOff. {Prasnakaumudi ascribed to 
Divakara). Incomplete. 

Vrndavana 8841. 28ff. Incomplete. 

Vrndavana 8865. 24ff. (ff. 1-4 and 6 missing). Cop¬ 
ied by Hiracanda at Mathura. Incomplete. 
Vrndavana 9833. 22ff. (ff. 6, 12-27, 36-38, 40, and 
42 missing). Incomplete. 

Vrndavana 10927. 14ff. (ff. 1 and 7 missing). 
(Prasnakaumudi; incomplete). No author men¬ 
tioned. 

WHMRL 7 240. Ff. 1-10. (sarnjha 1, 1-2, 14). 

The Tajikanllakanth.1 (including the Prasna¬ 
kaumudi) was published with the tika of Visva¬ 
natha at Kasi in Sarn. 1969 = a.d. 1912; with the 
Hindi tika of Babu Sastri, 3rd. ed., Mumbayi Sam. 
1981, Saka 1846 = a.d. 1924; and with the Hindi 
tika of Mahidhara at Kalyana-Barnbai in Sarn. 
2014, Saka 1879 = a.d. 1957; and was ed. by 
Kedaradatta Josi with the fika of Visvanatha and 
his own Hindi vyakhya, Harinetravallabha, at 
Dilli-Varanasi-Patana in 1979; and was published 
with the Hindi tika of Bharatiya Yogi at Bareli in 
1986. There was a second ed. of the translation of 
the Prasnakaumudi by Govinda Sri Rama Murthi, 
entitled Hindu Horary Astrology, at Srikakulam in 
1973. 

The Bhavaprakasa of Nilakantha (see CESS A 3, 
189a) is apparently identical with the Jlrna- 
pahcahganutanapahcahgotpatti published on ff. 
31v-32 of the Makarandasdranl, lithographed at 
Kasi in Sarn. 1926, Saka 1791 = a.d. 1869. The first 
verse is: 

ganadhisarn namaskrtya jirnapatrad dhi nutane // 
pahcaiige sugamopayo nilakanthena kathyate // 

^NILAKANTHA BHATTA (fl. ca. 1625/1650) 

1. Additional manuscripts of his Sarnskdramayukha 
(see CESS A 4, 145a-145b): 

RORI (Udaipur) 141 (1). 94ff. Copied by Rupaji in 
Sarn. 1752 = a.d. 1695. 


190 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Alwar) 3355. 91ff. Copied in Sam. 1767 = 
A.D. 1710. Incomplete. 

Jaipur (Dharma) 58 (1). 97ff. Copied in Sarn. 1770 
= A.D. 1713. 

Jaipur (Dharma) 59 (1). 83ff. Copied on 9 sukla- 
pak§a of Pau§a in Sam. 1796 = ca. 27 December 
1739. 

Benares (1956) 12012. 67ff. Copied in Sam. 1847 = 
A.D. 1790. Ascribed to Siddhesvara Bhatfa. 

AS Bengal II.A.9. 

Benares (1956) 13152. Ff. 1-76. Incomplete. No 
author mentioned. 

BHU B.144. 70ff. 

Jodhpur 892 (6). 54ff. 

Poona, Mandlik. Smrti and Dharma 83. 69ff. 

RORI (Alwar) 3363. 74ff. 

RORI (Alwar) 3812. 83ff. 

RORI (Udaipur) 142 (1). 95ff. (f. 13 missing; ff. 
14-15 one leaf). 

The Samskaramayukha was ed. by Narahara 
Sastri Sende as Krsnadasa SS 71, Varanasi 1985. 

2. Additional manuscripts of his Acdramayiikha (see 
CESS A 4, 145b-146b): 

*BORI 246 of A 1881/82 = BORI (Dharma) 67. 
56ff. Copied on 11 kr§napak§a of Sravana in 
Sarn. 1717 = ca. 21 August 1650. Formerly 
property of Sivasahkara Harikrsna. 

RORI (Udaipur) 141 (2). 121ff. Copied by Rupaji in 
Sam. 1742 = A.D. 1685. 

Benares (1956) 13728. Ff. 1-47. Copied in Sarn. 
1749 = A.D. 1692. 

*BORI 88 (1) of 1881/82 = BORI (Dharma) 66. 
80ff. Copied by Kesavaji Bhatta, the son of 
Narayana Bhaffa, the son of Damodara BhaUa 
of the Sarasvatajnati, a resident of SOryapura, on 
Tuesday 11 kr$napak§a of Bhadrapada in Sarn. 
1779 = 25 September 1722. 

Jaipur (Dharma) 59 (2). 46ff. Copied in Sam. 1796 
= A.D. 1739. 

VSM (Upadhye) 12201. 73ff. Copied by Satikara 
Tontakar in Saka 1717 = A.D. 1795. 

RORI (Alwar) 3550. 62ff. (ff. 20 and 47-48 miss¬ 
ing). Copied in Sarn. 1912 = A.D. 1855. Incom¬ 
plete. 

*Poona, Mandlik. Smrti and Dharma 84. 66ff. Cop¬ 
ied in Saka 1801 = A.D. 1879. 

RORI (Jaipur) 9960. 8ff. Copied in Sarn. 1956 = 
A.D. 1899. Incomplete (svapnaphala). 

AS Bengal I.B.50; and III.F.300. 

Benares (1956) 11978. Ff. 1-46. 


Benares (1956) 12218. Ff. 1-48 and 48b-64. 

Benares (1956) 12234. Ff. 1-4. Incomplete. 

Benares (1956) 12685. Ff. 1-13. Incomplete (yati- 
dharmopayuktavakyani). 

BHU B.613. 49ff. 

BORI 832 of 1891/95 = BORI (Dharma) 72. Ff. 
1-2 and 5-56. Property of Vasudeva Bhatta 
Sat ha, a resident of Bhavasahgrama, in Saka 
1663 = A.D. 1741. 

BORI 333 of 1891/95 = BORI (Dharma) 71. 20ff. 
Incomplete. 

*BORI 81 of 1892/95 = BORI (Dharma) 69. lOOff. 

With an anukramariika on ff. 99-100. 

*BORI 113 of Vishrambag I = BORI (Dharma) 70. 
76ff. 

*BORI 186 of Vishrambag II = BORI (Dharma) 68. 

Ff. 1-15, 30-39, 41-56, and 67-74. Incomplete. 
Jaipur (Dharma) 57 (1). Ff. 2-36. Incomplete. With 
the seal of Ramasirnha, dated Sarn. 1718 = A.D. 
1661. 

RORI (Alwar) 3813. 115ff. With an anukramariika 
on 6ff. 

RORI (Udaipur) 1687 (1). 61ff. 

3. Additional manuscripts of his Samayamayukha 
(see CESS A 3, 189a-190b, and A 4, 146b-147a): 

RORI (Alwar) 3643. 11 Off. Copied in Sarn. 1723 = 
A.D. 1666. 

RORI Cat. XVI 36735. 129ff. Copied in Sarii.- 1744 
= A.D. 1687. 

Jaipur (Dharma) 59 (3). 87ff. Copied on 9 sukla- 
paksa of Bhadrapada in Sarn. 1796 = ca. 31 
August 1739. 

RORI (Udaipur) 1687 (9). llOff. Copied in Sarn. 
1814 = A.D. 1757. 

RORI Cat. XVI 34221. 236ff. Copied in Sarii. 1819 
= A.D. 1762. 

VSM (Upadhye) 12204. 62ff. Copied by Sarikara 
Toritekar in Saka 1717 = A.D. 1795. 

RORI (Alwar) 3814. lOlff. Copied in Sarn. 1900 = 
A.D. 1843. 

ABSP 4441. 3ff. Incomplete (janma^taminiriiaya). 
Benares (1956) 12115. Ff. 2-6. Incomplete (eka- 
dasiniriiaya; incomplete). No author mentioned. 
Benares (1956) 13448. Ff. 1-8. Incomplete (eka- 
dasinirriaya; a parisi§ta). No author mentioned. 
BHU B. 3592. 80ff. 

CP, Hiralal. Six copies of the ekadasinirriaya. 

622. Property of Govindprasad Sastri of 
Jubbulpore. 

623. Property of Sadasiv Alakulavar of 
Gadbori, Canda District. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


191 


624. Property of Vaijarnbhat of Brahma- 
puri, Canda District. 

625. Property of Ghansyam Vaman Bhat 
of Mangrulpir, Akola District. 

626. Property of Ramcandrarav of Bilas- 

pur. 

627. Property of Dinanath of Singhari, 
Bilaspur District. 

Jaipur (Dharma) 672. 69ff. With the seal of Rama- 
sirnha dated Sam. 1718 = a.d. 1661. 

Jodhpur 892 (H). 79ff. 

Poona, Mandlik. Smrti and Dharma 82. 68ff. 

RORI Cat. IV 20534. 76ff. 

4. Additional manuscripts of his Suddhimayukha 

(see CESS A 4, 147a-147b): 

ABSP 396. 27ff. Copied in Sarn. 1712 = a.d. 1655. 

RORI (Udaipur) 142 (8). 37ff. Copied by Ratnasi in 
Sam. 1740 = a.d. 1683. 

RORI (Udaipur) 1687 (4). 36ff. Copied by Sitarama 
Ramacandra Dasora Misra in Sarn. 1814 = a.d. 
1757. 

Benares (1956) 12692. Ff. 1-29. Copied in Sarn. 
1846 = A.D. 1789. 

Wien UB MN 12 (I 9432). Ff. 1-32. Copied in Sam. 
1858 = A.D. 1801. Bought by E. Hultzsch in 
1884/85. 

RORI (Alwar) 3822. 49ff. Copied in Sarn. 1903 = 
A.D. 1846. 

ABSP 4371. 63ff. Copied on Wednesday 15 sukla- 
paksa of Asvina in Sam. 1909, Saka 1774 = 27 
October 1852. 

Adyar Cat. 38 F 9. 76pp. Incomplete. 

AS Bengal II.A.9. 

Benares (1956) 12147. Ff. 1-10, 10b, lOc-33, 
33b-41, 41b-46, and 46b-51. 

Benares (1956) 12564. Ff. 1-62. 

Benares (1956) 12727. Ff. 1-40. No author men¬ 
tioned. 

Benares (1956) 12793. Ff. 2-20 and 22-34. Incom¬ 
plete. 

Benares (1956) 13671. Ff. 1-42. 

Benares (1956) 13954. Ff. 1-24. 

Benares (1956) 14017. Ff. 1-20. 

BHU B.546. 19ff. Incomplete. 

BHU B.3595. 31ff. Incomplete. 

BHU C.2148. 36ff. 

IIL Oxford 14. 40ff. Purchased in 1886. 

Jaipur (Dharma) 57 (8). 41ff. 

Jaipur (Dharma) 58 (6). 32ff. 

Jaipur (Dharma) 59 (9). 37ff. 

Jaipur (Dharma) 658. 33ff. With the seal of Rama- 
sirpha. 


Jodhpur 892 (F). 19ff. 

Oppert I 3889. (Sudhlmayukha). No author men¬ 
tioned. Property of the Sahkaracarya Mat ha of 
Kumbhaghonam, Tanjore District. 

Poona, Mandlik. Smrti and Dharma 74. 24ff. 

RORI Cat. IV 20539 ! 26ff. 

RORI Cat. VI 23949. 26ff. 

RORI (Alwar) 3785 = Alwar 1489. 45ff. 

RORI (Udaipur) 141 (11). 36ff. 

VSM (Upadhye) 12205. 18ff. 

The Suddhimayukha was edited also by J. R. 

Gharpure, Bombay 1921. 

5. Additional manuscripts of his Nltimayukha (see 

CESS A 4, 148a-148b): 

RORI (Udaipur) 142 (3). 43ff. Copied by Harikr§na 
Bhatta in Sarn. 1720 = a.d. 1663. (Rajanlti). 

RORI (Udaipur) 142 (4). 77ff. Copied in Sam. 1759 
= A.D. 1702. 

Jaipur (Dharma) 59 (5). 73ff. Copied by Jayananda, 
the son of Dhanesvara, on 14 suklapak§a of 
Pausa in Sam. 1781 = ca. 18 December 1724. 

RORI Cat. IV 20437. 47ff. Copied in Sam. 1829 = 
A.D. 1772. 

RORI Cat. IV 20537. 58ff. Copied at Jodhapura in 
Sam. 1870 = a.d. 1813. 

RORI (Alwar) 3816. 82ff. With an anukramanika on 
3ff. Copied in Sarn. 1903 = A.D. 1846. 

AS Bengal II.A.25. Bengali. 

Benares (1956) 12145. Ff. 1-68. 

BISM, Nasik Patawardhan 364. See NCC, vol. 10, p. 
161. 

BORI 297 of 1884/87. 81ff. From Gujarat. 

Cambridge Univ. Add. 2508. See NCC. 

Jaipur (Dharma) 57 (2). Ff. 2-52. With the seal of 
Ramasirnha dated Sarn. 1718 = a.d. 1661. 

Jaipur (Dharma) 57 (3). llff. Incomplete. With the 
seal of Ramasirnha dated Sarn. 1718 = a.d. 1661. 

Jodhpur 892 (B). 45ff. 

Lucknow Museum. See NCC. 

Mitra, Not. 2278. 40ff. (Rajanlti). Property of 
Maharaja Rajendrakisora Sirnha Bahadur of 
Bettiya. 

Mysore ORI C.493/4. 14ff. Kannada. Incomplete 
(rajabhi§eka). 

Mysore ORI C.696/11. If. Incomplete (raja- 
pat tabhi§eka, slokas 1-18). 

Poona, Mandlik. Smrti and Dharma 80. 44ff. 

RORI (Alwar) 3695 = Alwar 1374. lOlff. 

RORI (Udaipur) 141 (5). 70ff. 

RORI (Udaipur) 1687 (5). 66ff. 


192 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


6 . For his Vyavaharamayukha (see CESS A 4, 
148b-150a) see also S. G. Moghe [A5. 1977/78]. 
Additional manuscripts: 

RORI Cat. XVI 34469. 50ff. Copied in Sam. 1696 = 
A.D. 1639. (Vyavaharatattva). 

RORI (Udaipur) 142 (5). 113ff. Copied by Nrsimha 
in Sarn. 1736 = A.D. 1679. 

RORI (Udaipur) 1687 (6). 69ff. Copied in Sarn. 
1814 = A.D. 1757. 

Poona, Mandlik. Smrti and Dharma 79. 205ff. Cop¬ 
ied at Benares in Sarn. 1835 = A.D. 1778. 

VSM (Upadhye) 12197. 52ff. Copied by Saiikara 
Tontekar in Saka 1718, Sarn. 1853 = A.D. 1796. 
Benares (1956) 14143. Ff. 1-38. Copied in Sarn. 
1862 = A.D. 1805. (Vyavaharatattva). Incom¬ 
plete. 

BHU B.3608. 95ff. Copied in Sarn. 1866 = A.D. 
1809. 

^Oxford 655 (Wilson 159 a). Ff. 1-35. Bengali. 
Copied in 18.9 of Saka 1736 = ca. 30 November 
1814. 

RORI (Alwar) 3817. 92ff. Copied in Satn. 1903 = 
A.D. 1846. 

ABSP 4384. 132ff. Copied on Friday 8 suklapak^a 
of Vaisakha in Sarn. 1911 = 5 May 1854. 

ABSP 4412. 83ff. 

Adyar Cat. 10 E 58. 242pp. 

AS Bengal I.B.41. Bengali; and III.E.48 (Vyavahara¬ 
tattva). 

Benares (1956) 12146. Ff. 1-37, 39-52, and 52b-76. 
Incomplete. 

Benares (1956) 13290. Ff. 1-80. 

Benares (1956) 13958. Ff. 1-51. (Vyavaharatattva). 

Incomplete. 

BHU B.3606. 19ff. 

BHU B.3607. 67ff. Incomplete. 

GOME Madras D. 18333. 67ff. Grantha. 

Jaipur (Dharma) 57 (4). 39ff. Incomplete. 

Jaipur (Dharma) 58 (2). 46ff. 

Jaipur (Dharma) 59 (6). 84ff. 

Mysore ORI C.919. Ff. 1-6. Telugu. Incomplete 
(dattaputravidhana). 

Oppert I 3987. 100pp. Grantha. (Dattakamayukha). 
Property of Svamin Sastrin of Kumbhaghonam, 
Tanjore District. 

Poona, Mandlik. Smrti and Dharma 78. 75ff. 

RORI Cat. IV 20536. 78ff. 

RORI (Udaipur) 141 (6). 73ff. (f. 62 repeated). 

The Vyavaharamayukha was translated into Eng¬ 
lish by P. V. Kane and S. G. Patwardhan, Bombay 
1933. 


7. Additional manuscripts of his Danamayukha (see 

CESS A 4, 150a-151a): 

RORI Cat. XVI 34324. 21ff. (f. 1 missing). Copied 
in Sarn. 1773 = A.D. 1716. Incomplete. 

Benares (1956) 13869. Ff. 1-249. Copied in Sarn. 
1805 = A.D. 1748. 

Poona, Mandlik. Smrti and Dharma 76. 141ff. Cop¬ 
ied in Sarn. 1814 = A.D. 1757. 

Benares (1956) 12840. Ff. 1-138. Copied in Sarn. 
1827 = A.D. 1770. 

RORI Cat. V 22560. 105ff. (ff. 10-37 missing). Cop¬ 
ied in Sarn. 1829 = A.D. 1772. Incomplete. 

Benares (1956) 12219. Ff. 1-86, 86b-129, 129b, and 
129C-202. Copied in Sarn. 1849 = A.D. 1792. 

VSM (Upadhye) 12206. lOff. Copied by Safikara 
Toiitekar in Saka 1718, Sarn. 1853 = A.D. 1796. 

RORI (Jaipur) 3910. 231ff. (ff. 88-164 missing). 
Copied by Ummedarama in Sarn. 1876 = A.D. 
1819. Incomplete. 

RORI (Alwar) 3818 = Alwar 1351. 136ff. With an 
anukramariika on 8ff. Copied by Bhagavana at 
Mojapura in Sarn. 1900 = A.D. 1843. 

RORI (Alwar) 6112. 124ff. Copied in Sarn. 1900 = 
A.D. 1843. 

ABSP 4374. 2ff. Copied on Sunday 1 suklapak§a of 
Magha in Sarn. 1903 = 17 January 1847. Incom¬ 
plete. 

ABSP 4299. 250ff. Copied in Sarn. 1909 = A.D. 
1852. 

Benares (1956) 11941. Ff. 1-137 and 137b-171. 
Copied in Sarn. 1935 = A.D. 1878. 

ABSP 137. 5Iff. No author mentioned. 

ABSP 3436. 132ff. 

ABSP 4872. 3ff. (f. 3 missing). Incomplete (safr- 
kalpaprakara). 

ABSP 5125. 4ff. Incomplete (satikalpaprakara). 

Adyar Cat. 34 M 41. 25pp. 

Adyar Cat. 34 M 42. 844pp. 

AS Bengal I.B.50; and III.G.43. 

Benares (1956) 11954. Ff. 2-16, 28-64, 76-129, and 
133-168. Incomplete. 

Benares (1956) 14084. Ff. 26-64, 64b-121, and 
121b-123. Incomplete. 

Benares (1956) 14173. Ff. 61-178. Incomplete. 

BHU C.1765. 4ff. Ascribed to Kamalakara. 

Calcutta Sanskrit College (Smrti) 505. 189ff. (ff. 1-7 
missing). (Danadldhiti). Incomplete. 

Florence 122. 2ff. Copied by Jivananda Hari of the 
Mahara§trajhati. Incomplete (rOpyadituladana- 
prayoga). 

Jaipur (Dharma) 57 (5). 11 Iff. With the seal of 
Ramasirnha dated Sarn. 1718 = a.d. 1661. 

Jaipur (Dharma) 5§ (3). 129ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


193 


Mysore ORI C.4091. Ff. 1-188. Incomplete (to go- 
seva). 

Mysore ORI P.532/1. Ff. 1-8. Telugu. Incomplete 
(tulapuru§apaddhati). 

RORI Cat. IV 20535. 123ff. (f. 26 missing; f. 16 
repeated). 

RORI Cat. VIII 28132. llOff. 

RORI (Jaipur) 8377. 17ff. Incomplete. 

RORI (Jaipur) 9354. 2ff. Incomplete (prayascitta- 
dana). 

RORI (Jaipur) 10802. 2ff. Incomplete (mahi- 
§ipujavidhi). No author mentioned. 

RORI (Udaipur) 141 (7). 161ff. (ff. 104-105 one 
leaf; ff. 63 and 141 repeated). 

Vrndavana 3171. 15ff. Incomplete (tuladanapra- 
yoga). 

The Danamayukha was ed. by V. R. Lele, Bom¬ 
bay 1924. 

8 . Additional manuscripts of his Utsargamayukha 

(see CESS A 4, 151b-152b): 

RORI (Udaipur) 309. 64ff. Copied by Ksetrapati 
Kayastha at KaU in Sarn. 1684 = a.d. 1627. 
(jalasayaramotsarga). 

Benares (1956) 12277. Ff. 1-19. Copied in Sarn. 
1764 = A.D. 1707. 

*BORI 151 of 1886/92 = BORI (Dharma) 174. 30ff. 
Copied by Ramacandra, the son of Ramakrsiia 
Bhatta of the Mahara§trajhati, on Friday 
purnima of Jye^tha in a Rudhirodgarisarnvatsara, 
Sarn. 1798 (read 1800) = 27 May 1743. 

RORI (Jaipur) 4075. 6ff. Copied in Sarn. 1818 = 
A.D. 1761. Incomplete (jalasayaramotsarga). 

VSM (Upadhye) 12199. 12ff. Copied by Saiikara 
Tontekar in Saka 1717 = a.d. 1795. 

Benares (1956) 12307. Ff. 1-22. Copied in Sarn. 
1877 = A.D. 1820. 

RORI (Alwar) 3819. 18ff. Copied by Bhagavana at 
Mojapura in Sarn. 1903 = a.d. 1846. 

RORI (Jaipur) 5457. 22ff. Copied by Bhatarnbhatta, 
the son of Yadupati Bhafta, in Sarn. 1904 = a.d. 
1847. 

Benares (1956) 12276. Ff. 1-25. Copied in Sarn. 
1916 = A.D. 1859. 

RORI Cat. V 22866. 23ff. Copied by Gha- 
maiidirama Ojha at Jodhapura in Sarn. 1928 = 
A.D. 1871. (Jalasaya). 

ABSP 5197. 46ff. Incomplete (jalasaya). 

AS Bengal II.A.9. 

Benares (1956) 11898. Ff. 1-22. 

Benares (1956) 12217. Ff. 1-29. 

Benares (1956) 12547. Ff. 1-6. Incomplete. 


BHU B.1372. 8ff. (jalasayotsarga). 

BHU B.1923. 2Iff. (jalasayotsarga). 

BHU C.606. 33ff. Incomplete. 

*BORI 65 of A 1879/80 = BORI (Dharma) 175. 
19ff. 

BORI 346 of 1887/91 = BORI (Dharma) 178. 23ff. 
*BORI 130 of Vishrambag I = BORI (Dharma) 
179. 23ff. 

*BORI 131 of Vishrambag I = BORI (Dharma) 
177. 20ff. 

*BORI 136 of Vishrambag I = BORI (Dharma) 
176. 2Iff. 

GJRI 5407/438. Ff. 1-17. (jalasayotsarga). 

Jaipur (Dharma) 57 (6). 12ff. With the seal of 
Ramasirnha dated Sarn. 1718 = a.d. 1661. 

Jaipur (Dharma) 58 (4). 13ff. 

Jaipur (Dharma) 59 (7). 26ff. 

Jodhpur 892 (A). 13ff. 

Jodhpur 893 (A). 21ff. 

*Poona, Mandlik. Smrti and Dharma 77. 18ff. 

RORI (Jaipur) 2536. 20ff. (f. 1 missing). Incomplete. 
RORI (Udaipur) 141 (8). 16ff. (jalasayaramotsarga). 
RORI (Udaipur) 142 (6). 26ff. (f. 11 missing). 

(jalasayaramotsarga). 

RORI (Udaipur) 1687 (3). 20ff. 

RORI (Udaipur) 2954. llff. 

9. Additional manuscripts of his Pratis (hamayiikha 
(see CESS A 4, 152b-154a): 

PrSB 3301 (Berlin or. fol. 2332). 24ff. Copied by 
Harilala in the house of Vi§riu in Sarn. 1798 = 
A.D. 1741. 

Benares (1953) 7999. Ff. 1-37. Copied in Sarn. 1807 
= A.D. 1750. 

Benares (1953) 12215. Ff. 1-11, 10b, 1 lb-37, and 
37b-47. Copied in Sarn. 1850 = a.d. 1793. 

VSM (Upadhye) 12202. 22ff. Copied in Saka 1717 
= A.D. 1795. 

ABSP 5213. Ff. 1-31; 1-57; 1-12 and 22-25; 1-23; 
1-3; 1-4; 1-6; 1-4; 1-2; and 1-16. Copied in 
Sarn. 1858 = A.D. 1801; in Sarn. 1859 = a.d. 
1802; and in Saka 1737 = a.d. 1815. 

BHU B.2071. 27ff. Copied in Sarn. 1865 = A.D. 
1808. 

RORI (Jaipur) 5507. 34ff. Copied by Nanurama in 
Sarn. 1869 = A.D. 1812. 

Benares (1953) 8030. Ff. 1-41. Copied in Sarn. 1878 
= A.D. 1821. 

RORI Cat. Ill 13340. 3Iff. Copied by Jivasukha, the 
son of Pranasukha Pancoli, in Sarn. 1885 = a.d. 
1828. Incomplete (sarik§epalifigarcaprati§thapra- 
yoga). Ascribed to Kamalakara BhaUa. 


194 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 5565. 39ff. Copied by Yadupati 
BhaUa in Sarn. 1889 = a.d. 1832. 

RORI Cat. VII 25352. 5Iff. Copied by Lak§mana in 
Sam. 1894 = a.d. 1837. 

ABSP 1055. 26ff. Copied in Sam. 1899, Saka 1764 
= A.D. 1842. 

RORI (Alwar) 3820. 30ff. Copied by Lak^mana at 
Maujapura in Sam. 1900 = A.D. 1843. 

Benares (1953) 8033. Ff. 1-17, 20-45, and 45b-48. 
Copied in Sam. 1918 = a.d. 1861. Incomplete. 

NFS (Sanskrit) 8695. Ff. 1-34. Copied on 7 kr§na- 
pak§a of Sravana in Sarn. 1919 = ca. 16 August 
1862. 

BHU C.4812. 51ff. Copied in Sam. 1926 = a.d. 
1869. 

ABSP 491. Ff. 2-70. Copied in Sam. 1930 = A.D. 
1873. Incomplete. 

ABSP 524. 90ff. Copied in Sam. 1935 = a.d. 1878. 

ABSP 3908. 70ff. 

AS Bengal II.A.9. 

Benares (1953) 8032. Ff. 1-30. 

Benares (1953) 11524: Ff. 22-34. Incomplete. 

Benares (1956) 11900. Ff. 1-7, 7b-8, 10, and 
lOb-15; and 1-14. Incomplete. No author men¬ 
tioned. 

Benares (1956) 12958. Ff. 1-38. 

Benares (1956) 13872. Ff. 1-24. 

GJRI 5360/391. Ff. 1-28. 

Jaipur (Dharma) 57 (7). 30ff. With the seal of 
Ramasirnha dated Sam. 1718 = a.d. 1661. 

Jaipur (Dharma) 589. 44ff. 

Jaipur (Dharma) 590. 80ff. 

Jodhpur 892 (C). 23ff. 

Jodhpur 893 (B). 44ff. 

Poona, Mandlik. Smrti and Dharma 75. 33ff. 

RORI Cat. IX 29514. 32ff. Copied by Narayanasa- 
haya at Maidapattana. 

RORI Cat. XVI 34577. 73ff. 

RORI (Alwar) 3741 = Alwar 1392. 75ff. 

RORI (Alwar) 3759. 3Iff. (Prat'mhaprayoga): 

RORI (Udaipur) 141 (9). 26ff. 

RORI (Udaipur) 1687 (10). 44ff. 

Wien UB MN 31 (I 9815). Ff. 1-23. Bought by E. 
Hultzsch in 1884/85. 

10. Additional manuscripts of his Prayascittama- 

yiikha (see CESS A 4, 154a-155a): 

RORI (Udaipur) 142 (7). 132ff. Copied at Girivara- 
pura in Sam. 1742 = A.D. 1685. 

Benares (1956) 13730. Ff. 1-72 and 72b-98. Copied 
in Sam. 1785 = A.D. 1728. 

VSM (Upadhye) 12198. 142ff. Copied by Sankara 


Tontekar in Saka 1700 = a.d. 1778. 

RORI Cat. XVI 34579. 128ff. Copied in Sam. 1850 
= A.D. 1793. 

Benares (1956) 13871. Ff. 1-120. Copied in Sarn. 
1860 = A.D. 1803. 

RORI Cat. IV 20533. 130ff. Copied by Surajamala 
Mathena at the Mahamandira <in Jodhapura> 
in Sam. 1870 = a.d. 1813. 

RORI (Alwar) 3821. 163ff. With an anukramanika 
on 8ff. Copied in Sam. 1903 = a.d. 1846. 

Jaipur (Dharma) 688. 262ff. Copied by Ramapratapa 
on Thursday 4 kr^napak^a of Phalguna in Sarn. 
1954 = 10 February 1898. 

Adyar Cat. 10 E 7. 300pp. 

AS Bengal I.B.50. 

Benares (1956) 11897. Ff. 253-266 and 268-381. 

Incomplete. No author mentioned. 

Benares (1956) 11960. 147ff. Incomplete. 

Benares (1956) 11977. Ff. 1-51 and 51b-108. 

Benares (1956) 12148. Ff. 1-15. Incomplete. 

Benares (1956) 13316. Ff. 1-26. Incomplete. 

Benares (1956) 13538. Ff. 1-133. 

BHU B.2069. 112ff. 

BHU C.2330. 26ff. 

Jaipur (Dharma) 58 (5). 105ff. 

Jaipur (Dharma) 59 (8). 145ff. 

Jodhpur 892 (D). 117ff. 

RORI Cat. IV 21609. 144ff. 

RORI (Alwar) 3777 = Alwar 1400. 123ff. 

RORI (Jaipur) 9022. 18ff. Incomplete. 

RORI (Udaipur) 141 (10). 89ff.; and 47ff. (ff. 44-45 
missing). Incomplete. 

RORI (Udaipur) 1687 (8). 156ff. 

RORI (Udaipur) 5556. 4ff. Incomplete (sadharana- 
prayascitta). 

The Prayascittamayukha was also edited with his 
own tika, Tattvadarsinl, by Ananta Yajnesvara 
Dhupakara, Bombay 1940. 

11. Additional manuscripts of his Sraddhamayukha 
(see CESS A 4, 155a-156a): 

RORI Cat. XVI 35553. 85ff. Copied in Sam. 1708 = 
A.D. 1651. 

ABSP 397. Ff. 39-83. Copied in Sam. 1712 = a.d. 
1655. Incomplete. 

Benares (1956) 13559. Ff. 1-69. Copied in Sarn. 

1724 = A.D. 1667. Incomplete. 

RORI (Udaipur) 142 (2). 117ff. Copied by Pancjita 
Ratnasiji in Sarn. 1740 = a.d. 1683. 

RORI (Alwar) 3692 = Alwar 1506. 94ff. Copied in 
SaiTi. 1745 = a.d. 1688. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


195 


IIL Oxford 15. 86ff. Copied on Thursday 12 kr§na- 
pak§a of Phalguna in Sam. 1809 = 21 March 
1754. 

RORI Cat. VI 23950. 69ff. Copied in Sarn. 1829 = 
A.D. 1772. 

RORI Cat. IV 20538. 73ff. (f. 31 repeated). Copied 
at Yodhanagara in Sam. 1870 = A.D. 1813. 

RORI (Alwar) 3815. 95ff. Copied in Sam. 1903 = 
A.D. 1846. 

ABSP 4370. 123ff. Copied by Isvariprasada Pafha- 
ka at Karranagara Badalesaraya on Thursday 3 
suklapak$a of Pau§a in Sarn. 1908 = 25 Decem¬ 
ber 1851. 

AS Bengal I.F.16. Bengali. 

Benares (1956) 12144. Ff. 1-60, 51b-53b, 55b-106, 
106b-112, and 112b-127. Incomplete. 

BHU B.1288. 7ff. Incomplete (parvanasraddha- 
nirnaya). 

BHU C.3077. 3ff. 

Jaipur (Dharma) 59 (4). Ff. 1-22, 54-74, and 77-87. 
Incomplete. 

Jaipur (Dharma) 677. 72ff. With the seal of Rama- 
sirnha dated Sarn. 1718 = A.D. 1661. 

Poona, Mandlik. Smrti and Dharma 81. 32ff. 

RORI Cat. XVI 34578. lOlff. (ff. 22-23 missing). 
Incomplete. 

RORI (Udaipur) 141 (4). 91ff. 

RORI (Udaipur) 1687 (11). lOOff. 

Udaipur RVSS 1802. 23ff. 

12. Additional manuscripts of his Santimayukha (see 

CESS A 3, 190b-191a, and A 4, 156a-157a): 

RORI (Udaipur) 1687 (2). 169ff. Copied by Dayala- 
dasa in Sarn. 1743 = A.D. 1686. 

Benares (1956) 12498. Ff. 1-84 and 90-105. Copied 
in Sarn. 1771 = A.D. 1714. Incomplete. 

RORI (Alwar) 3796 = Alwar 1480. 50ff. Copied in 
Sain. 1819 = a.d. 1762. 

RORI (Udaipur) 4857. Ff. 156-165 (?). Copied by 
Kojurama Josi in Sarn. 1819 = a.d. 1762. 

VSM (Upadhye) 12537. 6ff. Copied by Vitfhala 
Ghaffisasa in Saka 1705 = a.d. 1783. Incom¬ 
plete (vinayakasanti). 

Benares (1956) 12220. Ff. 1-139, 139b-147/148, and 
149-185. Copied in Sarn. 1850 = a.d. 1793. 

VSM (Upadhye) 12200. 63ff. Copied by Saiikara 
Dik§ita in Saka 1718 = a.d. 1796. 

RORI (Udaipur) 3658. 126ff. Copied by Kasinatha 
Deva Bhatta at Avantika in Sarn. 1855 = a.d. 
1798. 

Benares (1953) 10454. Ff. 1-12. Copied in Sarn. 
1860, Saka 1725 = a.d. 1803. Incomplete (vi- 
nayakasantipaddhati). 


BHU B.3598. 67ff. Copied in Sarn. 1865 = a.d. 
1808. 

RORI Cat. IV 20540. 8Iff. Copied at Yodhanagara 
in Sarn. 1870 = A.D. 1813. 

Benares (1953) 9077. Ff. 1-130 and 135-143. Cop¬ 
ied in Sarn. 1881 = a.d.1824. Incomplete. 

Goiidal (Karmakaiida) 403. 182ff. Copied on Satur¬ 
day amavasi of Phalguna in Sarn. 1887 = 12 
February 1831. 

Poona, Mandlik. Smrti and Dharma 86. 148ff. Cop¬ 
ied at Ratnagiri in Saka 1801 = a.d. 1879. 

AS Bengal III.D.31. 

AS Bengal I 3.662 = IM Calcutta 8849. Ff. 21-45 
and If. Incomplete. No author mentioned. 

Benares (1953) 8921. llff. Incomplete. No author 
mentioned. 

Benares (1953) 10694. Ff. 1-4. Incomplete (mulas- 
le§asanti). 

Benares (1956) 12677. Ff. 1-6. Incomplete. No 
author mentioned. 

BHU B.210. 3ff. Incomplete. No author mentioned. 

BHU B.1586. If. Incomplete (arkavivaha). 

BHU B.3597. 31ff. Incomplete. 

GJRI 5864/667. Ff. 1-4. Incomplete (vinayakasanti- 
paddhati). 

IM Calcutta 3018 (santiparibha^aprayoga); and 6082 
(santiparisista). See NCC, vol. 10, p. 174. 

Jaipur (Dharma) 57 (9). 72ff. With the seal of 
Ramasirnha dated Sarn. 1718 = a.d. 1661. 

Jaipur (Dharma) 59 (10). lOlff. 

Jodhpur 892 (E). 84ff. 

Jodhpur 893 (C). 120ff. 

Poona, Mandlik. Smrti and Dharma 85. 43ff. 

RORI Cat. I 1512. 4ff. Incomplete (vaidhrtavya- 
tipatasahkrantisanti). 

RORI (Alwar) 3823. 170ff. With an anukramanika 
on 3ff. 

RORI (Alwar) 3824. 152ff. With an anukramaiiika 
on 4ff. Copied by Sivarama. 

RORI (Jaipur) 3611. 118ff. (f. 67 repeated). 

RORI (Jaipur) 8963. 3ff. Incomplete (kakamaithuna- 
darsanasanti). 

RORI (Udaipur) 141 (12). 98ff. (ff. 63 and 64 
repeated). 

Vrndavana 3394. 135ff. Incomplete. 

VSM (Upadhye) 12538. 2ff. Incomplete (jye§thaja- 
nanasanti). 

VSM (Upadhye) 12541. llff. Incomplete (mulasle- 
§asanti). 

WRI 401. 2ff. Incomplete (arkavivahaprayoga). 

WHMRL j3 290 = *1.120. Ff. 1-7, 12-81, 83-108, 
and 112. An abbreviated version. Incomplete. 


196 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


13. Manuscripts of unspecified or unidentified 
portions of the Bhagavantabhaskara (see CESS A 4, 
157a-157b). 

RORI (Udaipur) 141 (3). 76ff. (ff. 6-24 and 29-30 
missing). Copied by Mathura Vajapeyin in Sana. 
1705 = A.D. 1648; corrected by Giridhara Bhatfa 
Aiikolakara. (Vidhimayukha). Incomplete. 

RORI Cat. IX 29777. 48ff. Copied by Jethamala in 
Sam. 1747 = A.D. 1690. 

RORI Cat. IV 19991. 188ff. (ff. 13 and 69 missing). 
Copied by Bhanudatta Mehata in Sarn. 1900 = 
A.D. 1843. 

Benares (1956) 13287, Ff. 1-159. (Bhdskarani- 
bandha). 

BM Or. 6828-6831. Incomplete. 

CP, Hiralal 2600. (Nirnayabhdskara). Property of 

Ajodhyaprasad of Harda, Hoshangabad District. 
RORI (Udaipur) 1687 (7). 93ff. (ff. 20-21 one leaf). 

14. Nilakantha also wrote at Kasi a Kundadyota = 
Kundoddyota = Kuijdamandapanirmdna, on which 
his son, Saiikara (fl. 1660/1671) wrote two vivrtis, 
entitled Darsana and Prakasa. Manuscripts: 

Jammu 4514. 18ff. Copied in Sarn. 1755 = A.D. 

1698. (Kundamandapanirnaya). 

Oxford CSS d. 637 (8). Ff. 1-52. Copied by Govin- 
darama, a Kayastha, at Kasi near Agastyesvara 
on Wednesday 7 kr§napak§a of Karttika in Sam. 
1767 = 1 November 1710 from a manuscript 
copied by Vaijanatha Sarman, the son of Diva- 
kara of the Bharadvajagotra. With the Darsana of 
Satikara. 

lO 3166 (617b). 47ff. Copied in A.D. 1802. With the 
Darsana of Sankara. From H. T. Colebrooke. 
Baroda 891. 23ff. Copied in Sam. 1896 = A.D. 1839. 
With a vivrti of Sankara. 

Baroda 4616(a). 15ff. Copied in Sarn. 1910 = a.d. 

1853. (Kundamandapanirnaya). 

RORI (Alwar) 3752. 30ff. Copied by Kundanalala in 
Sarn. 1911 = A.D. 1854. With a fika of Saiikara. 
Jammu 11-ga-l. 32ff. Copied in Sarn. 1983 = a.d. 

1926. (Kundamandapanirnaya). 

Adyar Cat. 34 M 60. 12pp. (Kundodyoga). 

AS Bengal 1109 (G.5773). 65ff. With a vivrti of 
Saiikara. 

AS Bombay 416. 3ff. With a vivrti of Saiikara. 
Incomplete (verses 58-61). 

Benares (1953) 3969. Ff. 1-24. With a vivrti of 
Saiikara. 

BORI 46 of 1883/84. 17ff. (Kundamandapasiddhi). 
IM Calcutta 5781. (Kundamandapanirnaya). See 


NCC, vol. 4, pp. 179 and 181, and vol. 10, p. 174. 
IM Calcutta 5815. (Kunddrka). With a tika. See 
NCC, vol. 10, p. 175. 

lO 3162 (1521 g). 9ff. From H. T. Colebrooke. 
lO 3163 (2667 a). Ff. 1-14, 16-29, and 31-40. With 
the Prakasa of Saiikara. Incomplete. From H. T. 
Colebrooke. 

lO 3164 (610 a). 19ff. With the Darsana of Saii¬ 
kara. From H. T. Colebrooke. 
lO 3165 (1810). Ff. 1-15 and 18-31. With the 
Darsana of Saiikara. Incomplete. From H. T. 
Colebrooke. 

Jammu 4008. 39ff. 

Kerala 3797 (7181), 500 granthas. With a vyakhya. 

(Kuti4^mandapanirmdnakdrikdh). Incomplete. 
Osmania University 345/a. 15ff. Telugu. (Kunda¬ 
mandapanirnaya). 

Oxford CSS c. 273 (3). Ff. 1-26 and 28-39. With the 
Darsana of Saiikara. Incomplete (verse 61 miss¬ 
ing). 

Oxford CSS d. 637 (9). Ff. 1-26. With the Darsana 
of Saiikara. 

PUL II App. 603. 33ff. With a vivrti of Saiikara. 
Tanjore D. 11887 = Tanjore BL 234. 22ff. (Kunda¬ 
mandapanirnaya). 

Tanjore D. 11888 = Tanjore BL 12328. (Kutida- 
mandapanirpaya). 

Tanjore D. 11889 = Tanjore JL 1121. (Kunda¬ 
mandapanirnaya ). 

The Kundoddyota was published in Vi^hala- 
dlksitaviracitd mandapakundasiddhih, Kalyana- 
Mumbai Sam. 1982, Saka 1847 = a.d. 1925, pp. 
90-98. Verses 2-4 are: 

dvijarajaikamurddhanyarn vrsadhyaksarn 
sivanvitam // 

kasyam sarvopade§tararn bhavaye saiikararn gurum 

1121/ 

virodhimargadvayadarsanartharn 
dvedha babhuvatra parah puman yah // 
srisaiikaro bhaUa ihaikarupo 
mimarnsakadvaitam uricakara 113)11 
kundamandapanirmanakarika upakarikah // 
nilakanthakrtah santu kanthe tah karmathaih krtah 
//4// 

Verse 70 is: 

dvitrivedaiigulotsedham saikam tadarpanonnatam // 
kundodyotam amurn bhattanilakantho vyacikarat // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


197 


^NILAKANJHA CATURDHARA (fl. ca. 1675/1700) 

Nilakantha was the son of Phullambika and Go- 
vinda of the Gautamagotra, a resident of KQrpara- 
nagara on the Godavari, His gurus were Gopala, 
Siva, Lak§manarya, Tirthanarayana, Pola Gahga- 
dhara, and Cintamani. He is most famous as the 
author of the tika, Bharatabhavadipa, on the Ma- 
habhdrata\ see P. K. Gode [A5, ?] and [A5. 1942] 
and N. Gangadharan [A5. 1978], Additional 

manuscripts of his Saurapaurdnikamatasamarthana 
(see CESS A 3, 191a-191b, and A 4, 157b): 

CP, Hiralal 6683. Property of Kanhaiyalal Guru of 
Saugor. 

IM Calcutta 2828. Incomplete. See NCC, vol. 10, p. 
171. 


*NlLAKANTHA REGMI (fl. 1754) 

Additional manuscripts of his Subodhinl (see 
CESS A 3, 191b-192b, and A 4, 157b-158a): 

Oxford CSS I 305 (*d. 779 (4)). Ff. 1-63. Copied in 
Sam, 1869 = a.d. 1812. Incomplete (adhyayas 
1 - 2 ). 

RORI Cat. IV 18962. 32ff. Copied in Sam. 1912 = 
A.D. 1855. 

GJRI 8364/589. 3ff. Maithili. Incomplete (2, 3-2, 4). 
Kathmandu (1965) 22 (2827). 63ff. 

Mysore ORI C.3862/2. Ff. 1-36. Incomplete (adhya¬ 
yas 1-2). 

PrSB 2918 (G5ttingen Sanscr.Madh 2). 48ff. 

RORI Cat. IV 18612. 30ff. No author mentioned. 
RORI Cat. XVI 36638. 21ff. 

RORI (Alwar) 2723. 39ff. Incomplete. 


'^'NILAMBARA (fl. 1277) 

The son of Satikar^ana, Nilambara mentions 
Saka 1199 = a.d. 1277 in his Srdddhaprakdsikd; see 
NCC, vol. 10, p. 184. Additional manuscript of his 
Kalakaumudi (see CESS A 3, 193a): 

Coochbehar 56 A. 80ff. 


^NILAMBARA JHA (b. 18 July 1823) 

1. Manuscript of his Golaprakdsa (see CESS A 3, 
193b): 


RORI (Alwar) 3021. 92ff. Incomplete. 

The goliyarekhaganita and the capiyatrikona- 
ganita sections of this were published with the 
vyakhya of Candrasekhara Jha (fl. 1923/1924) and 
the fippani of Munindra Jha as MM 269, 2nd. ed., 
Kasi 1956. 

4, 6, 8, 9, or 11. Manuscript of a fika on the Sid- 
dhdntasiromani without specification of what section 
thereof: 

GJRI 8740/965. Ff. 1-5. Maithili. Incomplete. 

4. Additional manuscript of his Jyotpattiflikd (see 
CESS A 3, 194a): 

GJRI 9191/19. Ff. 1-18. Maithili. 

6. Additional manuscripts of his Drkkarmopapatti 
(see CESS A 3, 194a-194b): 

GJRI 8453/678. Ff. 1-29. Maithili. (Drs tikarmopa- 
patti). Incomplete. 

GJRI 8454/679. Ff. 1-12. Maithili. Incomplete. 

11. Nilambara is said to have written a tika on the 
triprasnadhikara of the Siddhdntasiromani, though 
possibly there is some confusion with his 5, a 
vyakhya on the prasnadhikara of Kamalakara’s Sid- 
dhdntatattvaviveka (see CESS A 3, 194a), or with his 
8, a vyakhya on the prasnottara of the Siddhdntasi- 
romani (see CESS A 3, 194b). Manuscript: 

GJRI 8535/760. Ff. 1-20. Maithili. (prasnadhi- 
karafika). Incomplete (prasna 1 only). 

12. He also wrote a Grahaldghavopapatti on 
Ganesa’s Grahaldghava. Manuscript: 

GJRI 8316/541. Ff. 1-11. Maithili. 

13. And he was the author of a Vidvajjanama- 
norahjana. Manuscript: 

GJRI 9211/39. Ff. 1-5. Maithili. Copied in Saka 
1783 = A.D. 1861. 


NILOTPATA 

Alleged author of a tika, Subodhinl, on the 
Brhajjdtaka of Varahamihira (fl. ca. 550). Manu¬ 
scripts: 


198 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore (1905) 30. 140pp. Grantha. Incomplete (12 
adhyayas). 

Mysore (1905) 747. Pp. 228-331. Incomplete (adh¬ 
yayas 13-25). 

Mysore (1905) 789. 227pp. 


*AKUMALLA NRSIMHA 

Additional manuscripts of his Arthaprakasika 
(see CESS A 3, 195a): 

Mysore (1905) 575. 24pp. Telugu. Ascribed to 
Nrsirnhasuri. 

Mysore ORI *B.592. Ff. 1-46. Kannada. 

PrSB 2920 (Berlin or. 6348). Ff. 73-86v. Nandina- 
gari. 


*NRS1MHA 

Additional manuscripts of his KMaprakasika (see 

CESS A 3, 195a-197b, and A 4, 158a-158b): 

Mysore (1905) 18. 162 and 82pp. Grantha. 

Mysore ORI C.2977. Ff. 1-56. 

Mysore ORI C.3674. Ff. 97-123. Incomplete. 

Mysore ORI *P.824/1. Ff. 1-90. Grantha. Incom¬ 
plete (adhyayas 1-35). 

Mysore ORI *P.1624/1. Ff. 1-77. Kannada. 

Mysore ORI *P.2044. Ff. 1-259. Grantha. 

Mysore ORI P.2110. Ff. 1-62. Grantha. Incomplete 
(adhyayas 1-40). 

Mysore ORI *P.3488/1. Ff. 1-59. Grantha. Incom¬ 
plete (adhyayas 1-36). 

Mysore ORI *P.3900. Ff. 1-100. Grantha. Incom¬ 
plete (adhyayas 1-40). 

Mysore ORI *P.4096/3. Ff. 2-91. Grantha. 

Mysore ORI *P.4317. Ff. 1-65. Telugu. Incomplete 
(adhyayas 1-53). 

Mysore ORI P.5884/12. Ff. 25-32. Nandinagari. 
Incomplete (adhyaya 5). 

Mysore ORI P.6169/2. Ff. 61-76. Grantha. Incom¬ 
plete (adhyayas 1-31). 

Mysore ORI P.6749/1. Ff. 1-37. Grantha. 

Mysore ORI P.6939. Ff. 1-204. Grantha. 

Mysore ORI P.7442/2. Ff. 1-88. Telugu. 

Mysore ORI P.8473/2. Ff. 1-100. Grantha. 

Mysore ORI P.10593/1. Ff. 1-84. Grantha. Incom¬ 
plete (adhyayas 1-39). 

Pondicherry 101.1. Ff. l-37v. Grantha. From Deva- 
kottai. 

PrSB 2694 (Berlin or. 6323). Ff. 1-113. Grantha. 

PrSB 2940 (Hamburg Palmbl. I 111). lOlff. Gran¬ 


tha. Copied by Tirumalacalu, the son of Nemmili 
Se§adri of the Kasyapagotra, on Wednesday 7 
kr§napak§a of A^adha in a Dundubhisamvatsara. 

Visvabharati (Adyar) 730(c). 50ff. Grantha. Incom¬ 
plete (adhyayas 3-5 and 15-30). 


^NRSIMHA 

Nrsirnha was the pupil of Gopala. Additional 
information concerning the manuscript of his Gra- 
hasamullasa (see CESS A 3, 197b): 

Mysore ORI *P. 1798/4. Ff. 1-6. Nandinagari. 

The last verse is: 

gopaladaivavicchi§yanrsimhena pradarsitam // 
granthe grahasamullase patavaidhrtisadhanam // 


^NRSIMHA 

Additional manuscript of his Jatakamahjar'i (see 
CESS A 3, 198a, and A 4, 158a-158b): 

Kathmandu (1965) 7 (5898). 32ff. 


^NRSIMHA 

Additional manuscript of his Nibandhasiromani 
(see CESS A 3, 198b, and A 4, 158b): 

IM Calcutta 7813. (sarnvatsaraphala). See NCC, vol. 
10, p. 131. 


NRSIMHA 

Author of a Prasddasantyutsarga. Manuscript: 
PUL I Dharma 433. 7ff. Incomplete. 


^NRSIMHA 

Additional manuscript of his Phalakalpalata (see 
CESS A 3, 199a): 

Jesalmere II Pothi 112, no. 1829. 12ff. Copied in 
Sarn. 1844 = a.d. 1787. No author mentioned. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


199 


NRSIMHA 

Author of a Mangala^faka published by Hari- 
kr§na in his Mahgala^ (aka, Aurahgabada 1885, f. 9. 


NRSIMHA 

Author of a Yogagha(itagrahat^adhikara, clearly a 
part of some larger work. Manuscript: 

PrSB 3597 (Berlin or. 6328). F. 86. Telugu. 


^NRSIMHA 

Additional manuscripts of his Vehka(adrindthlya 
(see CESS A 3, 199a): 

Mysore ORI *P.2559/2. Ff. 9-26. Telugu. 

Mysore ORI P.4440/1. Ff. 1-7. Telugu. 

Mysore ORI P.6803. Ff. 1-4. Kannada. Incomplete 
(adhikaras 1-2). 

Mysore ORI P.6829/1. Ff. 1-11. Telugu. 


NRSIMHA 

The son of Satyananda, Nrsirnha wrote a tika, 
sometimes called Dipika, on the Sandilyatattva of 
the Vdyupurat}a\ a part of this is the Mdgha- 
mahdtmya. Manuscripts: 

Adyar Cat. 36 D 16. 243pp. 

BORI 182 of 1884/87. 86ff. No author mentioned. 
From Mahara§tra. 

Mysore ORI C.1673/2. Ff. 1-17. Incomplete 
(Mdghamdhdtmya(lkd\ to II 51). 


NRSIMHA 

The son of Siddhabhatta and a resident of Kasi, 
Nrsirnha wrote a Saixiskdraratnavali. Manuscript: 

RORI (Alwar) 445. 120ff. Incomplete. 

The last verse and a half are: 

srikr§nacaranadvandvam adhaya hrdayambuje // 
siddhabhattatanujena kasipuranivasina // 
racitah srinrsirnhena pravasavidhinirnayah // 


^NRSIMHA KHEDAKARA (or KHETANKARA) 

Additional manuscripts of his vyakhya on the 
Upadesasutra of Jaimini (see CESS A 3, 199b): 

Mysore ORI *B.593/2. Ff. 1-44 and 1-18. Telugu. 
Mysore ORI P.5654/9b. Ff. 1-79. Nandinagari. 

NRSIMHA NAGARA 

Author of a Kundavdstusahgraha. Manuscript: 

Dahilak§mi XIV 95. See NCC, vol. 4, p. 186, and 
vol. 10, p. 189. 


^NRSIMHA BHATTA 

Additional manuscripts of his Vidhdnamdla (see 

CESS A 3, 199b-200a, and A 4, 158b-159b): 

Benares (1953) 8822. Ff. 1-127. Copied in Sarn. 
1652 = A.D. 1595. 

RORI (Udaipur) 186. 237ff. (f. 204 missing). Copied 
by Jagajivana in Sarn. 1677 = A.D. 1620. 

Benares (1953) 11515. Ff. 1-5. Copied in Sam. 1715 
= A.D. 1658. Incomplete (rudranusfhanavi- 
dhana). 

Jaipur (Dharma) 305. 323ff. Copied by Ramanatha 
Sarman on 2 kr§napak§a of Karttika in Sarn. 
1732, Saka 1597 = ca. 25 October 1675. 

RORI Cat. XVI 35555. 182ff. Copied by Gokula- 
natha at Jayapura in Sarn. 1887 = A.D. 1830 dur¬ 
ing the reign of Savai Jayasirnha. 

Gondal (Karmakaiida) 368. 353ff. Copied by Nanda- 
kesvara, the son of Dosa Bhafa of the Giri- 
narayaiiajhati, at Vairata on Thursday 2 kr§iia- 
pak§a of Asvina in Sarn. 1889 = 11 October 
1832. With an anukramaiiika. 

RORI (Jaipur) 10969. 177ff. (f. 1 missing). Copied 
by Narayana Bhatta at Rupanagara in Sarn. 1896 
= A.D. 1839. Incomplete. No author mentioned. 

RORI (Alwar) 3435 = Alwar 1446. 284ff. Copied in 
Sarn. 1909 = A.D. 1852. 

RORI (Jaipur) 10315. 6ff. Copied by Sitarama 
Nagara in Sarn. 1938 = A.D. 1881. Incomplete 
(vinayakasanti). No author mentioned. 

Sastri, Not. 1900. 245. 8ff. Copied by Kr§ria Cauve 
(?) on Sunday 12 Phalguna of Sarn. 1943 = 6 
March 1887. Formerly property of Kaliprasada 
Mahalla of Govarddhana Sarai, Kasi. Incomplete 
(balagrahasamanavidhana). Property of Paric^ita 


200 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Vindhyesvariprasada Dube of Govardhana Sarai, 
Benares. 

Benares (1953) 8724. Ff. 1-157. 

Dahilak§mi XXXIV 11. Incomplete (jye^fhamQ- 
lasle§asantayah). See NCC, vol. 10, p. 204. 

Mysore ORI C.4291/8. lOff. Incomplete (nak§a- 
trasanti). 

Oppert II 8090. Property of Raghubhafla of 
Bhattugosvamivattara, Tanjore District. 

RORI Cat. VI 23992. 183ff. (ff. 1-2, 15-16, 28, 43, 
79-80, 83, 101-103, 105-106, 110-121, and 
170-173 missing). No author mentioned. 

RORI (Alwar) 3436. 71ff. Incomplete. 

RORI (Jaipur) 8770 (3). Ff. 4-5. Copied by Ruda- 
mala. Incomplete (samanak^etrajanitavighnanasa- 
vidhana). No author mentioned. 

RORI (Jaipur) 8959. 2ff. Incomplete (yatrapujavi- 
dhana). No author mentioned. 

Sastri, Not. 1900. 332. 47ff. Incomplete. Property of 
Pandita Vindhyesvariprasada Dube of Go¬ 
vardhana Sarai, Benares. 

VSM (Upadhye) 12230. 120ff. No author mentioned. 

VSM (Upadhye) 12231. 204ff. 

VSM (Upadhye) 12232. 112ff. 

VSM (Upadhye) 12233. 2ff. Incomplete (vi§ayanu- 
kramanika). 

*NRSIMHA sum 

Additional manuscripts of his Jatakayogavali 

(see CESS A 3, 200a, and A 4, 159b): 

Mysore ORI C.2628. Ff. 1-10. 

Mysore ORI *P.299/1. Ff. 1-9. Telugu. 

Mysore ORI *P.370/13. Ff. 109-117. Nandinagari. 
Incomplete. 

Mysore ORI *P.1804/20. Ff. 48-57. Telugu. 

Mysore ORI *P.1813/10. 13ff. Telugu. 

Mysore ORI *P.2053/1. Ff. 1-142. Telugu. Incom¬ 
plete (ends with gurudasa). 

Mysore ORI *P.2589/1. Ff. 15-29. Nandinagari. 

Mysore ORI P.4244/3. Ff. 4-10. Telugu. Incomplete 
(ends with vanijyayoga). 

Mysore ORI P.4480/19. Ff. 54-65. Nandinagari. 

Mysore ORI *P.4751/2. Ff. 1-63; and 12ff. Nandina¬ 
gari and Telugu. 

Mysore ORI P.5693/9. Ff. 1-2. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.5884/1. Ff. 1-10. Nandinagari. 

Mysore ORI P.6383/1. Ff. 20-32. Telugu. Incom¬ 
plete (ends with strisaubhagyayoga). 

Mysore ORI P.6414/2. Ff. 1-15. Nandinagari. 

Mysore ORI P.7410/6. Ff. 58-69. Grantha. 


Mysore ORI P.7415/4. Ff. 50-64. Telugu. 

Mysore ORI P.8816/3. Ff. 97-126. Nandinagari. 
Mysore ORI P.9607/7. Ff. 13-36. Telugu. 

Incomplete (madhyagrahavakya; incomplete). 
PrSB 2936 (Berlin or. 6320). Ff. 68-82v. Nandina¬ 
gari. 

PrSB 2971 (Berlin or. 6349). Ff. 66-79v. Grantha. 
No author mentioned. 


^CHALARI NRSIMHA {fl. 1198?) 

According to NCC, vol. 10, p. 212, he lived in 
the 17th century. Additional manuscripts of his 
Smnyanhasagara (see CESS A 3, 200b, and A 4, 
159b-160a): 

Mysore ORI C.2693. Ff. 1-50. Copied on Sunday 10 
suklapak§a of A§adha in Saka 1677 = 17 August 
1755. 

BHU C.1340. 9ff. Incomplete (sarvatithisadharana- 
nirnaya). 

Mysore ORI C.1643. lOff. Incomplete. 

Mysore ORI C.1891. Ff. 1-55. Incomplete (to ta- 
rahga 2). 

Mysore ORI *P.3362/28. Ff. 1-79. Nandinagari. 
Sastri, Not. 1907. 360. 71ff. Property of Pandita 
Babacari Sastri of Tikari Fort. 


^NRSIMHA {fl. between ca. 1360 and 1435) 

Additional manuscripts of his Prayogaparijata 

(see CESS A 3, 200b, and A 4, 160a-161b): 

Alwar 1494. (sraddhakanda). 

Benares (1956) 11973. 274ff. Incomplete. With an 
anukramanika. No author mentioned. 

Benares (1956) 12367. Ff. 1-3. Incomplete (karna- 
vedhavidhana). No author mentioned. 

Benares (1956) 12369. Ff. 1-4. Incomplete (punar- 
upanayanavidhana). No author mentioned. 

BM Or. 6859 F. Nandinagari. Incomplete (§odasa- 
karma). 

GOME Madras D.3721. 161ff. Nandinagari. With an 
anukramanika. 

GOME Madras D.3722. Ff. l-353v. Nandinagari. 
Incomplete (ends with anupanitaprakarana). 

Mysore ORI A.637. Ff. 1-101. Kannada. Incomplete. 

Mysore ORI C.lll. 550ff. Incomplete (to paka- 
yajha). 

Mysore ORI C.149. Ff. 1-12, 17-28, 35-54, 59-63, 
69-70, 77-78, and 81-107. Incomplete (sraddha¬ 
kanda). 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


201 


Mysore ORI P.430. Ff. 1-289. Grantha. Incomplete. 
Mysore ORI P.1134/3. Ff. 1-112. Nandinagari. 

Incomplete (ahnikakan(^a). 

Mysore ORI *P.2611/1. Ff. 15-236. Nandinagari. 

Incomplete (to punarupanayanavidhi). 

Mysore ORI P.2959. Ff. 1-195. Telugu. Incomplete 
(to prayascitta). 

Mysore ORI *P.3371/1. Ff. 1-111. Nandinagari. 

Incomplete (ahnikakangla). 

Mysore ORI P.4335/5. Ff. 174-182. Nandinagari. 
Incomplete. 

Mysore ORI P.4393. Ff. 1-187. Nandinagari. Incom¬ 
plete (kandas 1-2). 

Mysore ORI P.4615. Ff. 1-240 and 29ff. Nandina¬ 
gari. Incomplete (to vajapeya). 

Mysore ORI P.4805/2. If. Grantha. Incomplete 

(upakarmanirnaya). 

Mysore ORI P.5588/2. Ff. 9-110. Nandinagari. 

Incomplete (vratatrayaprakarana). 

Mysore ORI P.5800/2. Ff. 1-70. Telugu. Incomplete 
(sraddhakanda). 

Mysore ORI P.6134/1. Ff. 1-69. Nandinagari. 

Incomplete (sodasakarmakanda). 

Mysore ORI P.7555. Ff. 1-183. Kannada. 

Mysore ORI P.7785. Ff. 1-178. Nandinagari. Incom¬ 
plete (to grhapravesa). 

Mysore ORI P.8836. Ff. 1-138. Nandinagari. Incom¬ 
plete (to sadakumbha). 

Mysore ORI P.9456. Ff. 1-166. Nandinagari. Incom¬ 
plete. 

PrSB 3309 (Berlin or. 6288). 291ff. Nandinagari. 
PrSB 3310 (Berlin or. 6287). 275ff. Nandinagari. 
PrSB 3311 (Berlin or. 6285). Ff. 2-151. Nandina¬ 
gari. 

PrSB 3312 (Berlin or. 6286). Ff. 3-167. Nandina¬ 
gari. 

RORI (Alwar) 4535. 258ff. Incomplete (ahnika). 
RORI (Alwar) 4536. 465ff. Incomplete (sarnskara). 
RORI (Alwar) 4636. 136ff. Incomplete (pakayajna). 
Visvabharati (Adyar) 370. 233ff. (ff. 77, 133, 
210-229, 235, and 256 missing). Nandinagari. 
Incomplete. 


^NRSIMHA (fl. 1409) 

1. Additional manuscripts of his Kdlanirnayadlpi- 
kdvivarana (see CESS A 3, 201a-202b, and A 4, 
161b-162a): 

*WHMRL M.14.b. Ff. 1-7; 2ff.; and ff. 1-141. Cop¬ 
ied by Damodara Dviveda at Kanvalayapura on 
Thursday 8 kr§napak§a of Sravana in Sam. 1546 
= 31 July 1488. With an anukramanika. 


Pattan II 5139. Ff. 7-99. Copied in Sam. 1570 = 
A.D. 1513. 

Oxford (Vyasa) 5. Ff. 140-147, <149>, 152-153, 
155, 158-161, and 164; and If. Copied for Sya- 
mala Du<ve> of the Srimalijhati on Sunday 2 
suklapak§a of A§adha in A§adhadi Sam. 1577 = 
17 June 1520. Incomplete. 

*BORI 91 of 1882/83 = BORI (Dharma) 270. Ff. 
1-148, 148b-158, and 161-172. Copied on 5 suk- 
lapak^a of Phalguna in Sarn. 1621, Saka 1485 = 
ca. 5 February 1565. 

RORI (Udaipur) 4341 (1). Ff. 1-111. Copied by Go- 
vinda, the son of Mudgala Jyotirvid, at Nidhivasa 
in Saka 1504 = a.d. 1582. 

*BORI 222 of 1879/80 = BORI (Dharma) 268. Ff. 

1- 19, 21-172, and 181-191. Copied by a resident 
of Stambhatirtha on Thursday amavasi of Jye§- 
tha in Sarn. 1641 = 28 May 1584. 

RORI (Alwar) 2623. 126ff. Copied in Sam. 1646 = 
A.D. 1589. 

*BORI 92 of 1882/83 = BORI (Dharma) 269. Ff. 

2- 7 and 13-111. Copied by Natha Misra at KaU 
for Raghunatha Dik§ita on Thursday 9 
suklapaksa of Asvina in Sarn. 1651 = 12 Sep¬ 
tember 1594. Incomplete. 

RORI (Alwar) 3625. 161ff. (f. 1 missing). Copied in 
Sarn. 1654 = a.d. 1597. Incomplete. 

Oxford (Vyasa) 6. Ff. 4-12, 15-38, 41, 45-65, 67-74, 
76-104, 106-110, 115, 117, 119-121, 125, and 
130-132. Copied by Govinda Pandya, the son of 
Vakidasa Pandya, a Brahmana of the Puskara- 
jhati and a resident of Navanagara, for PrayogajI 
Bhata, the son of Srikantha Bhata, at Halara- 
grama on Friday 14 suklapak§a of Karttika in 
A§adhadi Sarn. 1658 = 30 October 1601. Incom¬ 
plete. Formerly property of Mulaji Vyasa. 

RORI (Udaipur) 192. 136ff. Copied by Balakr^na, 
the son of Ballala, at Kasi in Sarn. 1707 = a.d. 
1650. 

Vrndavana 64. 119ff. Copied by Jagannatha Pande 
at Devanagari on Wednesday 9 suklapaksa of 
Caitra in Sarn. 1722 = 15 March 1665. Incom¬ 
plete. 

*BORI 161 of 1886/92 = BORI (Dharma) 274. Ff. 
1-26, 30-34, 37-49, and 51-66. Copied by Uma- 
parama Bhatta of the Gaudanvaya, a resident of 
Tarapura, in the kr§napaksa of Magha in Sarn. 
1855 = ca. 20 February-5 March 1799. 

RORI (Alwar) 3624. 96ff. Copied by Mathuranatha 
at Jayapura in Sarn. 1909 = a.d. 1852. 

*BORI 66 of 1895/98 = BORI (Dharma) 273. Ff. 
1-62 and 62b-91; and 3ff. With an anukramanika 
that was copied in Saka 1781 = a.d. 1859. 

AS Bengal III.G.33. (ff. 1-8 missing). 


202 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Benares (1956) 13976. Ff. 10-35, 37, 45-58/59, 
60-72, 74, 76-83, and 85-96. Incomplete. No 
author mentioned. 

*BORI 99 of 1871/72 = BORI (Dharma) 265. 170ff. 
*BORI 327 of 1880/81 = BORI (Dharma) 267. Ff. 

1-56, 59-118, and 120. Incomplete. 

*BORI 252 of A 1881/82 = BORI (Dharma) 272. 
Ff. 1-13 and 13b-91. 

*BORI 524 of 1883/84 = BORI (Dharma) 266. Ff. 
1-12 and 14-113. 

*BORI 290 of 1884/87 = BORI (Dharma) 271. 
157ff. 

BORI 140 of Vishrambag I = BORI (Dharma) 275. 

Ff. 1-63 and 63b-91. 

Harvard Indie 2461. Ff. 7-8. Incomplete. 

Jaipur (Dharma) 150. 143ff. 

Mysore ORI A.677. Ff. 1-124. Kannada. 

Mysore ORI C. 178/2. Ff. 1-123. 

Mysore ORI *C.966. Ff. 2-117. 

Mysore ORI *C.1026. Ff. 1-41. Nandinagari. 
Incomplete. 

Mysore ORI C.2979/2. Ff. 1-108. 

Mysore ORI *P.2847. Ff. 209-265. Kannada. Incom¬ 
plete (malamasanirnaya to sraddhakalanirnaya). 

3. Additional manuscripts of his Govindarnava (see 
CESS A 4, 162a): 

Benares (1956) 13370. Ff. 1-166. Incomplete (ends 
with sarnskaravici). 

*BORI 139 of Vishrambag I = BORI (Dharma) 
259. 133ff. (kalanirnaya). Different from the 
Kalanirnayadlpikavivarana, under which it was 
mistakenly listed in CESS A 3, 202a. 

Jaipur (Dharma) 65. 159ff. (sarnskaravici); 54ff. 
(ahnikavici; incomplete); 142ff. (kalanirnaya- 
vici); and 197ff. (prayascittavici). 

Jaipur (Dharma) 663. 90ff. (suddhivici). 

RORl Cat. XVI 34485. 40ff. (dharmatattvaloka). 
RORI (Alwar) 3669. 113ff. (sarnskaravici; incom¬ 
plete). 

RORI (Alwar) 3781. 170ff. (sraddhavici). 


*NRSIMHA (b. 1548) 

1. Additional manuscript of his Grahakaumudi (see 
CESS A 3, 202b-203a, and A 4, 162b): 

VSM (Upadhye) 12796. 75ff. 

The Grahakaumudi was ed. in D. Pingree [A5. 
1980]. 


2. The Kheiamuktdvall (see CESS A 3, 203a, and A 

4. 162b) was ed. in D. Pingree [A5. 1980]. 

5. Additional information concerning a manuscript 
of his Var^aphaladipikd (see CESS A 3, 203a-203b, 
and A 4, 162b): 

Oxford CSS I 288 (*e. 147 (4) I). Ff. 1-5. Copied in 
Sam. <17 >49 = A.D. <16 >92. 

6. Additional manuscripts of his Harsakaumudl (see 
CESS A 3, 203b, and A 4, 162b): 

RORI Cat. IX 29768. 35ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Udaipur) 6853. Ff. 1-43, 45, 47-61, and 
68-90. Incomplete. 

7. Additional manuscripts of his Hillajadlpika (see 
CESS A 3, 203b-204a, and A 4, 162b): 

Varendra 50. 16ff. Copied by Rama Puri on 10 
Magha of Sarn. 1877 = ca. 11 February 1821. 
RORI (Alwar) 2815 = * Alwar 2031. 15ff. 


*NRSIMHA (b. 1586) 

1. Additional manuscripts of his Saurabhd^ya (see 

CESS A 3, 204a-205a, and A 4, 162b-163a): 

*BORI 601 of 1895/1902. Ff. 1-160. Copied by Go- 
pala at Indraprastha on Wednesday 7 suklapak§a 
of Jye§tha in Sarn. 1689, Saka 1554 = 16 May 
1632. 

RORI Cat. IV 21612. 40ff. (ff. 8-13 repeated). Cop¬ 
ied in Sam. 1798 = A.D. 1741. 

RORI Cat. VI 24816. 105ff. Copied by Sivanatha 
Dadhica in Sam. 1824 = A.D. 1767. 

AS Bengal I.B.16; and III.G. 103. Both Bengali. 

GJRI 8750/975. Ff. 1-83. Maithili. 

GJRI 9767/1022. Ff. 1-40. Incomplete. 

Jaipur (Khasmohor) 5188. 

Mysore ORI *P.16. 61ff. Kannada. Incomplete. 

Poona, Mandlik. Jyotisha 25. 155ff. 

RORI Cat. VII 25166. 18Iff. (ff. 1-14 and 33-52 
missing). Incomplete. 

RORI Cat. XVI 34672. 136ff. 

RORI (Udaipur) 5231. 37ff. (f. 24 missing). Incom¬ 
plete. 

The manuscripts which ascribe a Suryasiddhan- 

ta(lka to Kr§na do not contain Nrsimha’s Saurya- 

bhd^ya. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


203 


2. Additional manuscripts of his Vasanavarttika (see 
CESS A 3, 205a-206a, and A 4, 163a): 

RORI (Udaipur) 3105. 69ff. Copied by Harisukha 
Dadhica at Savai Jayapura in Sana. 1843 = A.D. 
1786. 

AS Bengal I.A.67; and I.B.3. Both Bengali. 

Benares 98113. Ff. 1-51. 

Benares 98116. Ff. 1-118. 

Benares 98259. Ff. 1-123. 

Benares 98721. Ff. 1-63 and 65-127. 

BHU B.708. 7ff. Incomplete. 

RORI (Alwar) 2581. 92ff. 

RORI (Alwar) 2582. 156ff. (ff. 1-3 missing). Incom¬ 
plete. 

The Vasanavarttika was ed. from Benares 35628, 
35761, 98113, 98116, 98259, and 98721 by Mura- 
lidhara Caturveda at Varanasi in 1981. 

3. Nrsirnha, it is now clear, was also the author of 
the Jatakasaradlpa (see CESS A 3, 198a-198b, and 
A 4, 158b). Additional manuscripts: 

AS Bengal I.A.59. 

Oxford CSS I 287 (*d. 775 (11)). Ff. 1-17 and 
21-22. Incomplete (32, 37-38, 17; and 39, 
11-41). 

RORI (Alwar) 2745 = * Alwar 1768. 212ff. Incom¬ 
plete. 

^YANAMANDRA NRSIMHA SURI (fl. ca. 1650) 

Additional manuscript of his Daivajhabhusana 
(see CESS A 3, 206b): 

Mysore ORI P.2588/8. Ff. 123-124. Telugu. Incom¬ 
plete (adhikara 1). Mistakenly catalogued as the 
Bijagatiita of Bhaskara. 

*NRSIMHADATTA MISRA (fl. 1837) 

This author (see CESS A 3, 206b-207a) also 
wrote a Grahadipika. Manuscript: 

GJRI 8302/527. Ff. 1-11. Maithili. 

Additional manuscript of his Makarandopapatti 
= Makarandasdrdnupapatti (see CESS A 3, 206b): 

GJRI 8578/803. Ff. 1-12. Maithili. 


A part of this may be his Sve^ tadinapahcdhga- 
sMhanayukti. Manuscript: 

GJRI 8765/990. F. 1. Maithili. 

Additional manuscript of his Jdtakaratnasahgra- 
ha (see CESS A 3, 207a, and A 4, 163a): 

GJRI 8350/575. Ff. 1-8. Maithili. Copied by Bhaga- 
vanadatta, the son of Somadatta. (Jdtakaratndka- 
ra). Ascribed to Nrsirnhabhafta, the son of Hara- 
datta. 

A part of this may be his Dasdtrayavibhaga. 
Manuscript: 

GJRI 8448/673. Ff. 1-2. Maithili. 


^NRSIMHAVARYA D1K$ITA 

Additional manuscripts of his Jatakakalmidhi 
(see CESS A 3, 207a, and A 4, 163a): 

Mysore ORI B.576/39. Ff. 176-179. Kannada. 

Incomplete (adhyaya 5). 

Mysore ORI P.750/1. If. Telugu. Incomplete. 

Mysore ORI P.1110/2. Ff. 1-59. Telugu. Incomplete. 
Mysore ORI P.2084/6. Ff. 164-208. Telugu. Incom¬ 
plete. 

Mysore ORI P.3186/2. Ff. 40-51. Grantha. 

Mysore ORI P.3254. Ff. 1-65. Grantha. Incomplete 
(ends with dvadasabhavaphala). 

Mysore ORI P.6401/24. If. Telugu. Incomplete. 
Mysore ORI P.7559/11. F. 44. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.7610/1. Ff. 1-131. Grantha. Incom¬ 
plete. 


NEKANATHA (= EKANATHA?) 

A resident of Amarapura, Nekanatha wrote a 
fika on the Grahalaghava of Ganesa (b. 1507). 
Manuscript: 

Poona, Mandlik. Jyotisha 32. 53ff. 


^NEMICANDRA (fl. ca. 975) 

Concerning his Trilokasdra (see CESS A 3, 
207a-208b, and A 4, 163a-164a) see also N. Jaina 


204 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


[A5. 1939/40a] and [A5. 1942]; and A. K. Roy [A5. 
1974]. Additional manuscripts: 

Nagaur 1702. 20ff. Copied on 12 suklapak§a of 
Karttika in Sarn. 1510 = ca. 14 October 1463. 
Nagaur 1701. 76ff. Copied on Monday 15 sukla- 
pak§a of Magha in Sarn. 1551 = 9 February 
1495. 

Nagaur 1704. 85ff. Copied on Thursday 11 kr§na- 
pak§a of Jyestha in Sarn. 1565 = 25 May 1508. 
With the tika of Sahasrakirti. 

Delhi Jaina (Dharmapura) 310 (a 18 (ka)). 72ff. 
Copied in Sarn. 1574 = a.d. 1517. With the tika 
of Sahasrakirti. 

Nagaur 1703. 85ff. Copied on Monday 11 sukla- 
pak§a of Bhadrapada in Sarn. 1584 (the date is 
irregular). With the tika of Sahasrakirti. 

AS Bengal XIII 346 (G.1512). 257ff. With the tika 
of Madhavacandra. 

Nagaur 1698. 289ff. (Trilokaprajnapti). 

Nagaur 1700. 23ff. 

Nagaur 1705. 46ff. With the tika of Brahmasruta. 
Nagaur 1706. 22Iff. With a tika entitled Tattvapra- 
dlpika. 

■■^NEMICANDRA SASTRIN (fl. 1949/1956) 

Author (see CESS A 3, 208b) also of a transla¬ 
tion of and commentary on the Kevalajhdnaprasna- 
cudamani, published as JMJSG 7, 4th ed., New Delhi 
1984; Nemicandra’s prastavana is dated Mahavira- 
nirvana 2475 = a.d. 1949. 

■■^PAKSADHARA MISRA (fl. 1450?) 

2. Additional manuscripts of his Tithicandrikd (see 
CESS A 4, 164b-165a): 

GJRI 5280/311. Ff. 1-7. Maithili. Copied in Saka 
1799 = A.D. 1877. 

GJRI 5297/328. Ff. 1-15. Incomplete. 

3. This Pak§adhara is also the author of a Jyotisasu- 
bodha, which is identical with the Sisubodha (see 
CESS A 4, 164a). Manuscript: 

GJRI 8420/645. Ff. 1-10 and 12-13. Maithili. Cop¬ 
ied by Pahcesvara Vatu on Wednesday 12 kr§na- 
pak§a of Margasir§a in Saka 1811 = 20 Novem¬ 
ber 1889. 


PATTEHALALA (fl. 1804) 

The pupil of Sadasukha, the pupil of Yaso- 
dananda Svamin, and a resident of Savai Jayapura, 
Pattehalala completed the Tinloka varnana in Hindi 
on 2 suklapak§a of Sravana in Sarn. 1861 = ca. 7 
August 1804. Manuscript: 

JGB p. 36 (Jatti Yashoda Nandji Temple Granth 
Bhandar 5). 96ff. Copied by Gopala Vyasa on 10 
suklapaksa of Bhadrapada in Sarn. 1911 = ca. 1 
September 1854. 


^PADMANANDIN (fl. ca. 975) 

Concerning this author (see CESS A 4, 
165b-166b) see also K. P. Jaina [A5. 1938/39]. 


PADMANABHA 

Author of a Jdtakakarmapaddhau. Manuscript: 
Mysore (1905) 842. Pp. 52-68. 


^PADMANABHA 

Additional manuscripts of the southern recension 
of the Lampaka (see CESS A 4, 167a-168a): 

Mysore ORI *B.576/5. Ff. 4-20. Kannada. 

Mysore ORI C.200/1. Ff. 1-15. Telugu. Incomplete 
(ends in adhyaya 3). 

Mysore ORI C.3023/1. Ff. 1-25. Nandinagari. With 
a vyakhya. 

Mysore ORI *P.2589/2. Ff. 1-8. Nandinagari. 

Mysore ORI *P.2589/3. Ff. 1-54. Nandinagari. 
Incomplete. 

Mysore ORI P.4333/4. Ff. 23-33. Nandinagari. 
Mysore ORI P.4438/1. Ff. 54-58. Nandinagari. 
Mysore ORI P.6558/1. Ff. 1-26. Telugu. 

Mysore ORI P.6847/16. Ff. 282-288. Telugu. Incom¬ 
plete (adhyayas 1-7). 

Mysore ORI P.7514/1. Ff. 1-55. Kannagla. With a 
Kannada tika. 

Mysore ORI P.10527/9. 7ff. Grantha. Incomplete. 
Pondicherry 22.1. Ff. 1-6. Grantha. From Tiru- 
nelveli. 

PrSB 3732 (Berlin or. 6314). 77ff. Grantha. No 
author mentioned. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


205 


Visvabharati (Adyar) 737(j). 24ff. Grantha. Copied 
by Ramabhadra. With a vyakhyana. 

Additional information concerning manuscripts 
of the second version (see CESS A 4, 168a-169a): 

RORI (Alwar) 2725 = *Alwar 1948. 32ff. Copied in 
Sarn. 1909 = a.d. 1852. With his own (?) tika. 
Oxford CSS I 212 (*d. 799 (9)). Ff. 1-38. With the 
tika of Sadasiva. 


^PADMANABHA 

Additional manuscripts of his Hillajayurdaya (see 
CESS A 4, 169a): 

Oxford CSS I 366 (*d. 791 (4)). Ff. 1-3. Copied by 
the son of Murari Bhatta on 3 kr§napaksa of 
Caitra in Saka 1621 = ca. 6 April 1699. For¬ 
merly property of Bhaskara Josi. 

Oxford CSS I 367 (d. 776 (9)). Ff. lv-7. With a 
tika. 

Oxford CSS I 368 (d. 802 (3) A). If. Incomplete 
(begins with verse 25). 

PADMANABHA UPASANI 

Author of a Kuijdasiddhi. Manuscript: 

Wai 10326. 6ff. 


'^PADMANABHA DIKSITA 

Additional manuscripts of his Prayogadarpana 
(see CESS A 4, 169a-169b): 

RORI (Jaipur) 9130. 9ff. Copied by Ambalala in 
Sarn. 1891 = a.d. 1834. Incomplete (rajodarsa- 
nasanti). 

NFS (Sanskrit) 9258. 41ff. Copied by Hlopadvala- 
muka (?), a Srimali Brahmana, at Pathana on 
Tuesday 3 krsnapak^a of Caitra in Sam. 1911 = 
3 April 1855. 

Alwar 1393. 

Benares (1956) 11919. Ff. 1-24, 26-31, and 31b-67. 
Incomplete. 

BORI 136 of 1895/1902. 77ff. 

WRI 4579. 54ff. Incomplete (sarnskarapaddhati). 


^PADMANABHA (/?. ca. 1400) 

1. Concerning his Ndrmadl (see CESS A 4, 
170a-170b) see also D. Pingree [A5. 1985] 165-167. 
Additional manuscripts: 

RORI (Alwar) 2674 = * Alwar 1877. 85ff. Copied in 
Sarn. 1859 = a.d. 1802. 

BHU C.1610. 63ff. Incomplete. 

^Jaipur (Khasmohor) 5055. 

Jodiya II 130. See NCC, vol. 10, p. 109, and vol. 11, 
p. 125. 

2. Additional manuscripts of his Yantraratnavall 
(see CESS A 4, 170b-171b): 

*Baroda 3160. Ff. 1-2. Copied by Kamalakara on 
Thursday 15 suklapak^a of Margasirsa in Sam. 
1639, Saka 1504 = 29 November 1582. 

(Diksddhanayantra). 

*AS Bombay 245 I. Ff. lv-7v. Copied on Monday 
14 suklapaksa of Magha in Sarn. 1716 = 16 Jan¬ 
uary 1660. 

RORI Cat. VIII 26682. 9ff. Copied by Narayana in 
Sarn. 1898 = a.d. 1841. With a tika. No author 
mentioned. (Dhruvabhramayantra). 

RORI Cat. II 5751. 9ff. Copied by Vrajavasin at Ja- 
yapura in Sarn. 1914 = a.d. 1857. With a tika. 
No author mentioned. (Dhruvabhramayantra). 
BORI 329 of 1882/83. Ff. 1-5. Ascribed to Yajha by 
the catalogue. (Dhruvabhramayantra). Followed 
by a Cakrayantra in 4 verses. 

IM Calcutta 1592. (Dhruvabhramayantra). See NCC, 
vol. 11, p. 125. 

Jaipur (Khasmohor) 5206. (Dhruvabhramayantra). 
Oxford CSS I 81 (*d. 801 (2)). Ff. 1-7. With his 
own tika. 

^PADMANABHA MISRA (/?. 1512) 

Additional manuscripts of his Vyavaharapradtpa 
(see CESS A 4, 172a-172b): 

RORI (Udaipur) 4168 (1). Ff. 2-33. Incomplete. 

IM Calcutta 5476. See NCC, vol. 11, p. 126. 


'^PADMANABHA MISRA BHATTACARYA (fl. ca. 
1560) 

Additional manuscript of his Samayaloka (see 
CESS A 4, 172b-173b): 


206 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


AS Bengal III.F.240. 

^PADMAPRABHA SURI (fl. 1164) 

Additional manuscripts of his Bhuvanadipaka 

(see CESS A 4, 173b-179a): 

RORI Cat. VIII 27030. 13ff. Copied by Naracandra 
in Sam. 1493 = a.d. 1436. With a Rajasthani 
Baldvabodha. 

Oxford CSS I 494 (*d. 805 (1)). Ff. 1-16. Copied on 
Friday 12 suklapak§a of Bhadrapada in Sarn. 
1527 = 7 September 1470. With a fika in bha§a. 

RORI Cat. IV 19556 (1). Ff. 1-7. Copied in Sam. 
1602 = A.D. 1545. With a Rajasthani Baldva¬ 
bodha. 

RORI Cat. XVI 37160. 7ff. (ff. 2-3 and 6 missing). 
Copied by Sometirama at Nagaura in Sarn. 1649 
= A.D. 1592. With a Rajasthani tika. Incom¬ 
plete. 

RORI Cat. V 22186. 5ff. Copied by Dharmavijaya in 
Sarn. 1657 = A.D. 1600. 

BM Or. 13635. Copied in Sarn. 1711 = A.D. 1654. 

Panjab JB I 1997 (Patti 357). 12ff. Copied in Sam. 
1715 = A.D. 1658. No author mentioned. 

RORI Cat. XVI 34436. 13ff. Copied by Jhakura at 
Puspavatinagara in Sarn. 1718 = a.d. 1661. With 
a Rajasthani stabaka. 

RORI (Bikaner) 15912. 8ff. Copied by Lalaji at 
Ratalama in Sarn. 1724 = A.D. 1667. 

RORI (Jaipur) 4611. 14ff. Copied by Labdhimandira 
Muni in Sarn. 1729 = A.D. 1672. With a Raja¬ 
sthani stabaka. 

RORI (Jaipur) 6936. 13ff. Copied by Ratnasirnha at 
Jaisalamera in Sarn. 1744 = a.d. 1687. With a 
Rajasthani stabaka. 

RORI Cat. IV 18668. 5ff. Copied by Jinavijaya Gaiii, 
the pupil of Kirtivijaya Gaiii, at Gundavacanaga- 
ra in Sarn. 1745 = A.D. 1688. 

RORI (Bikaner) 14630. 9ff. Copied at Sarasapatfaiia 
in Sarn. 1747 = A.D. 1690. 

Kathmandu (1965) 165 (4069). Ff. 1-11. Copied by 
Nandarama on a Wednesday in the kr§napak§a 
of Jye§tha in Sarn. 1748 = 3 or 10 June 1691. 

RORI (Chittorgarh) 5163. 93ff. Copied by Catur- 
bhuja Vyasa, the son of Narahari, at Kr§iiagadha 
in Sarn. 1754 = a.d. 1697. With the fika of 
Sirnhatilaka Suri. 

Pattan II 14163. Ff. 2-18. Copied in Sarn. 1757 = 
A.D. 1700. 

RORI (Chittorgarh) 1574. 6ff. Copied by Har§a- 
labha in Sarn. 1760 = A.D. 1703. 


PrSB 3610 (Berlin or. fol. 1884). 53ff. Copied on 
Thursday 2 suklapak^a of Bhadrapada in Sarn. 

1763 = 29 August 1706. With the vrtti of Sirnha¬ 
tilaka. 

RORI Cat. VI 23703. 5Iff. Copied by Tulasirama on 
Thursday 11 suklapak§a of Vaisakha in Sarn. 

1764 = 1 May 1707. With the fika of Sirnhatila¬ 
ka. 

Kathmandu (1965) 164 (4069). Ff. 1-7. Copied by 
Ratnakara, the son of Mahadeva BhaUa, at Kasi 
on Monday 11 suklapak^a of Margasir^a in Sarn. 
1764, Saka 1629 = 24 November 1707. 

RORI Cat. V 22673. 7ff. Copied by Premaraja at 
Khidarapura in Sarn. 1764 = a.d. 1707. 

RORI (Udaipur) 4364 (4). If. Copied by Devirama 
at Sahipura in Sarn. 1767 = a.d. 1710. No 
author mentioned. 

RORI (Chittorgarh) 1946. 5ff. Copied in Sarn. 1799 
= A.D. 1742. 

RORI Cat. VI 24120 (1). Ff. 1-6. Copied by Siva- 
varddhana in Sarn. 1808 = a.d. 1751. Incom¬ 
plete. 

RORI Cat. VII 25336. 7ff. Copied in Sarn. 1808 = 
A.D. 1751. 

RORI (Alwar) 5424. 18ff. Copied by Garigarama 
Paiide in Sarn. 1814 = a.d. 1757. 

Jodhpur 811. 17ff. Copied in Sarn. 1818 = a.d. 
1761. 

RORI Cat. IV 20001. 27ff. Copied by Kanakaharnsa 
Garii, the pupil of Saubhagyaharnsa Gatii, in Sarn. 
1818 = A.D. 1761. 

RORI (Chittorgarh) 2952. 21ff. Copied in Sarn. 1824 
= A.D. 1767. 

*WHMRL G.74.Z. Ff. 1-8. Copied on 1 suklapak^a 
of Pau§a in Sarn. 1828 = ca. 4 January 1772. 
With an interlinear gloss. 

RORI (Jaipur) 9587. 13ff. (ff. 1-4 missing). Copied 
in Sarn. 1829 = a.d. 1772. Incomplete. 

RORI Cat. XVI 36541. 6ff. Copied in Sarn. 1837 = 
A.D. 1780. 

RORI (Alwar) 2864. 12ff. Copied in Sarn. 1838 = 
A.D. 1781. 

RORI (Jaipur) 5677. 16ff. (f. 1 missing). Copied in 
Sarn. 1841 = a.d. 1784. Incomplete. 

RORI (Udaipur) 6254. 31ff. (ff. 1 and 30 missing; f. 
14 repeated). Copied by Devendra in Sarn. 1842 
= A.D. 1785. With a tika. Incomplete. 

Pattan II 14266. 25ff. Copied in Sarn. 1851 = a.d. 

1794. With a Gujarati stabaka. 

PrSB 3609 (Berlin or. oct. 523). Copied by Parika 
of the Gaiigavisavidyarthijhati at Mathura in 
Asvina of Sarn. 1851 = 24 September-22 Octo¬ 
ber 1794. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


207 


RORI (Bikaner) 14632. 15ff. Copied by Dola at 
Mandavibandara in Sam. 1851 = a.d. 1794. 
With a Rajasthani stabaka. 

RORI (Chittorgarh) 742. Off. Copied by Vijayasaga- 
ra in Sarn. 1851 = a.d. 1794. 

RORI (Udaipur) 6468. Off. Copied by Lacchirama 
in Sam. 1851 = A.D. 1794. 

Rattan II 13931. 5ff. Copied in Sarn. 1861 = a.d. 
1804. 

RORI Cat. IV 18773 (1). Ff. 1-8. Copied in Sam. 
1861 = A.D. 1804. 

Panjab JB I 1998 (Zira 400). 14ff. Copied in Sarn. 
1865 = A.D. 1808. No author mentioned. 

RORI Cat. XVI 34789. 47ff. Copied by BhairOmalla 
in Sarn. 1865 = a.d. 1808. With the tika of 
Lak§mivinaya. 

RORI Cat. XVI 37151. 16ff. Copied by Lalacandra 
in Sam. 1872 = a.d. 1815. With a Rajasthani 
tippana. 

RORI Cat. IX 29737. 8ff. Copied by Rathasagara, 
the pupil of Rupasagara, at Khimela in Sarn. 
1878 = A.D. 1821. 

Udaipur RVSS 296. Off. Copied in Sam. 1878 = 
A.D. 1821. 

Rattan II 14178. Off. Copied in Sarn. 1879 = a.d. 
1822. With a Gujarati stabaka. 

BHU C.2870. 4ff. Copied in Sam. 1889 = a.d. 1832. 
Incomplete. 

RORI (Udaipur) 5359. 103ff. Copied by Garudadvija 
Ramanujadasa Gula Josi, a resident of 
Kucamana, in Sarn. 1892 = a.d. 1835. With a 
tika. Incomplete. 

RORI Cat. VIII 28042. 35ff. Copied by Punyabhakti 
Muni at Amarasara in Sarn. 1893 = a.d. 1836. 

BHU C.3665. 27ff. Copied in Sarn. 1895 = a.d. 
1838. With a tika. No author mentioned. 

RORI Cat. IX 29854. 9ff. Copied by Hamiracandra 
Rsi in Sarn. 1897 = a.d. 1840. 

Oxford CSS I 495 (*d. 746 (9)). Ff. 1-41. Copied by 
Ganesabhatta Arahkara on Monday 11 krsna- 
pak§a of Phalguna in Sarn. 1898, Saka 1763 = 4 
April 1842. With a tika. 

RORI Cat. VIII 27505. 16ff. Copied by Amaracandra 
Ojha at Nasiravada on Monday 8 suklapaksa of 
Phalguna in Sarn. 1900 = 26 February 1844. 

BHU B.818. llff. Copied in Sarn. 1905 = A.D. 1848. 

RORI (Chittorgarh) 2568. 7ff. Copied at Pitambari 
in Sarn. 1906 = a.d. 1849. 

RORI (Alwar) 2863. 89ff. Copied in Sain. 1912 = 
A.D. 1855. With a tika. 

Vrndavana 10148. Ff. 17-22. Copied by Vastirama 
Sarasvata Jaitli in Sarn. 1914 = a.d. 1857. 
Incomplete. 


RORI Cat. XVI 34639. 19ff. Copied by Vrddhicanda 
at Kucamaiia in Sarn. 1917 = a.d. 1860. With a 
Rajasthani lika. 

RORI Cat. XVI 34108. 19ff. Copied in Sarn. 1931 = 
A.D. 1874. 

RORI (Alwar) 5468 (11). Ff. 107-114. Copied by 
Kr§iialala in Sarn. 1942 = a.d. 1885. 

RORI Cat. XVI 35468. 24ff. Copied at Ramasiiia in 
Sarn. 1974 = A.D. 1917. 

RORI (Chittorgarh) 2562. 15ff. Copied by Sivadana 
Dave at Vavalapura in Sarn. 1979 = a.d. 1922. 

RORI (Chittorgarh) 4303. 18ff. Copied by Hemaraja 
at Citrakuta in Sarn. 1990 = a.d. 1933. With a 
Rajasthani stabaka. 

AS Bengal I.A.56. Bengali; and III.A.58. With a 
tika. No author mentioned. 

BHU C.1621. 3ff. With a tika. Incomplete. No 
author mentioned. 

BHU C.1701. 3ff. Incomplete (bhojanaprakaraiia). 

BHU C.4495. 20ff. Incomplete. No author men¬ 
tioned. 

BHU C.5044. 4ff. Incomplete. No author mentioned. 

BHU C.5069. 4ff. Incomplete. No author mentioned. 

BHU C.5331. 45ff. No author mentioned. 

BHU C.5353. 13ff. Incomplete. No author men¬ 
tioned. 

IM Calcutta 9553. See NCC, vol. 11, p. 148. 

*Jaipur (Khasmohor) 5037; 5148 (subhasubhavi- 
cara); 5310; and 5376. 

Jodhpur 812. 5ff. Incomplete. 

Jodhpur 813. lOff. 

Jodhpur 814 (A). 4ff. Incomplete. 

Jodhpur 814 (B). 16ff. Copied by Manoharavijaya at 
Medinipura. With a Rajasthani tika. 

Kathmandu (1965) 166 (4070). 20ff. With the 
Satpahcasika of Prthuyasas. 

Mysore (1905) 590. Pp. 174-193. Telugu. No author 
mentioned. 

Mysore ORI P.4860/1. Ff. 30-44. Nandinagari. 
Incomplete (verses 1-73). 

Nagaur 1013. 16ff. 

NPS (Sanskrit) 8352. 14ff. No author mentioned. 

Oxford CSS I 496 (*d. 746 (8)). Ff. 1-31. With a 
tika. 

Oxford CSS I 497 (*d. 759 II). F. lllv. Incomplete 
(ends in verse 8). 

Oxford CSS I 498 (*d. 773 (13)). Ff. 1-5. 

Oxford CSS I 499 (*d. 775 (4)). Ff. 1-15. With a 
tika. Incomplete (verses 1-161, 125-162, 164, 
and 171). 

Oxford CSS I 500 (*e. 143 (2)). F. 17 and 8ff. 
Incomplete (ends in verse 114). 

Panjab JB I 1996 (Zira 499). 20ff. 


208 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Panjab JB I 1999 (Nakodar 95). 15ff. No author 
mentioned. 

Rattan II 1953. Ff. 3-9. With a Gujarati Dhundhika. 
Pattan II 6815 (1). 4ff. 

Rattan II 8843. 13ff. With a Gujarati Dhundhika. 
Pattan II 8847. 5ff. Incomplete. No author men¬ 
tioned. 

Pattan II 9528. 56ff. With a Gujarati stabaka. 

Incomplete. No author mentioned. 

Pattan II 9736. 17ff. With a Gujarati Bdldvabodha. 
No author mentioned. 

Pattan II 10724. 8ff. With the vrtti of Sirnhatilaka. 
Pattan II 10747. 5ff. 

Pattan II 12532. 9ff. With a Gujarati Baldvabodha. 
No author mentioned. 

Pattan II 12949. 6ff. With a Gujarati Bdldvabodha. 
Pattan II 14263. 19ff. With a Gujarati stabaka. 

PrSB 3611 (Berlin or. 6301). Ff. 65-74v. Telugu. 
With a Telugu tika. 

RORI Cat. Ill 12473. 3ff. With a tika. Incomplete. 
RORI Cat. Ill 15802. 50ff. (f. 43 missing). Incom¬ 
plete. No author mentioned. 

RORI Cat. IV 18666. 20ff. With an avacuri. 

RORI Cat. V 22872. 5ff. 

RORI Cat. V 23635. 16ff. 

RORI Cat. VI 24076. 12ff. With a stabaka in Old 
Hindi. 

RORI Cat. VI 24082. llff. 

RORI Cat. VI 24497. lOff. With a tika. 

RORI Cat. VII 25620 (5). Ff. 78-88. 

RORI Cat. IX 29728 (1). 9ff. 

RORI Cat. XVI 34057. 6ff. (f. 2 missing). Incom¬ 
plete. 

RORI Cat. XWI 34310 (6). Ff. 55-81. With a 
Rajasthani stabaka. 

RORI Cat. XVI 37094. 16ff. Copied at Ghanerava. 

With a Rajasthani/Hindi Bdldvabodha. 

RORI Cat. XVI 37457 (4). Ff. 33-49. 

RORI (Alwar) 2865. 19ff. 

RORI (Alwar) 5761. 21ff. (ff. 1-4 missing). Incom¬ 
plete. 

RORI (Alwar) 6195. 6ff. (sahk§ipta). 

RORI (Bikaner) 14631. 18ff. With a Rajasthani sta¬ 
baka. With the ^a{pahcdsikd of PHhuyasas. 
RORI (Bikaner) 15875. 6ff. Copied by Har§odaya. 
RORI (Bikaner) 17380. 5ff. 

RORI (Bikaner) 18338. 18ff. With a Rajasthani sta¬ 
baka. 

RORI (Chittorgarh) 22. 8ff. Incomplete. 

RORI (Chittorgarh) 1394. 9ff. With a stabaka. 

RORI (Chittorgarh) 1407. 15ff. 

RORI (Chittorgarh) 2290. 4ff. Incomplete (janmapa- 


travidhi). 

RORI (Jaipur) 4623. 7ff. 

RORI (Jaipur) 7543 (1). 5ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Jaipur) 9499. 13ff. (ff. 2-4 missing). Incom¬ 
plete. 

RORI (Jaipur) 10329. 13ff. (f. 9 missing). Incom¬ 
plete. 

RORI (Jaipur) 11796. 23ff. With a Rajasthani sta¬ 
baka. Incomplete. 

RORI (Udaipur) 6105. 27ff. (f. 1 missing). With an 
avacuri. Incomplete. 

Udaipur RVSS 191. lOff. Incomplete. 

Udaipur RVSS 1265. 8ff. Incomplete. No author 
mentioned. 

Vrndavana 289. 19ff. 

VSM (Upadhye) 12759. 12ff. Copied by Rama. For¬ 
merly property of Ananta Jafhar. 

*WHMRL G.74.X. Ff. 1-11. With an interlinear 
gloss on ff. 1-3. 

WHMRL K.4.e. Ff. 2-15 and 15b. With a vyakhya. 

Incomplete (verses 11-103). 

WHMRL 7 13. Ff. 3-10 and 10b. With an interli¬ 
near gloss in bha§a. Incomplete (begins in 34c). 

The Bhuvanadlpaka was published with the 
Samskrta tika of Siromani and the Hindi tika of 
KaUrama Pathaka at Kalyana-Murnbai in 1987. 

PADMASAGARA 

Author of a Sanaiscaraprabandha. Manuscript: 
Pattan II 9767. 3ff. 


^'PADMASUNDARA {fl. ca. 1575) 

This author (see CESS A 4, 179a) is said to have 
been a pupil of Padmameru of the Nagapuri Ta- 
pagaccha and to have been patronized by Akbar; see 
NCC, vol. 11, p. 151. Additional manuscripts of his 
Hdyanasundara: 

RORI Cat. IV 20717. 9ff. Copied by Srinatha at 
Nagapura in Sarn. 1754 = a.d. 1697. 

Jaipur (Khasmohor) 5126. No author mentioned. 
RORI (Chittorgarh) 4797. 7ff. (f. 6 missing). Incom¬ 
plete. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


209 


*PANAKKATTV {fl. 1650) 

Additional manuscript of his Prasnamarga (see 
CESS A 3, 147a [sub Natha (?)], and A 4, 
179a-179b): 

PrSB 2237 (Calw, Hermann Gundert Museum Gu A 
6). Ff. 50v-58. Malayalam. Incomplete (adhyaya 
14). 

The Prasnamarga was published with the Hindi 
tika of Sukadeva Caturvedin and the English 
translation of J. N. Bhasin at Dilli in 3 vols.: vol. 1 
(adhyayas 1-12) in 1978, vol. 2 (adhyayas 13-16) [N. 
D.], and vol. 3 (adhyayas 17-32) [N. D.]. 


^PARAM A MISRA {fl. 1534) 

Additional manuscripts of his Mukundavijaya 
(see CESS A 4, 181a-181b): 

BHU C.3001. 31ff. Copied in Satn. 1919 = A.D. 
1862. Incomplete. 

BHU B.4445. 140ff. Copied in Sarn. 1935 = A.D. 
1878. 

BHU C.153. 34ff. Incomplete. 

Jammu 813 ka. 56ff. No author mentioned. 

RORI Cat. V 23420. 45ff. (f. 43 missing). Incom¬ 
plete. 

RORI Cat. XVI 37208. 61ff. 

RORI (Alwar) 2982. 56ff. 

RORI (Alwar) 2983. 54ff. 


^PARAMAKARUNIKA 

Additional manuscripts of his BMabodhinl on 
the Jyodsaratnamdla of Sripati (fl. 1040/1056) (see 
CESS A 4, 181b-182a): 

AS Bengal (Vern.) 368 (G.6413). 60ff. 

RORI (Udaipur) 3186. 59ff. 


*PARAMASUKHA UP ADHYAYA (1768/1838) 

1. Additional manuscripts of his Ramalanavaratna 
(see CESS A 4, 182a-183b): 

GJRI 8627/852. Ff. 10-38. Copied in Sarn. 1902 = 
A.D. 1845. Incomplete. 

RORI Cat. IX 28683. 28ff. Copied in Sam. 1902 = 


A.D. 1845. 

RORI (Jaipur) 5321. 4ff. Copied in Sarn. 1910 = 
A.D. 1853. Incomplete (caturtharatna and caura- 
prasna). 

Oxford CSS I 224 (*d. 796 (2)). Ff. 1-57. Copied on 
Thursday 13 suklapak$a of Caitra in Sarn. 1912 
= 29 March 1855. 

RORI (Alwar) 2877 = *AIwar 1931. 89ff. Copied in 
Sarn. 1912 = A.D. 1855. 

Vrndavana 7153. 33ff. Copied in Sarn. 1920 = A.D. 
1863. 

NFS (Sanskrit) 8938. Ff. 1-44. Copied by Ramadasa 
at Kasi on 5 kr§riapak§a of Magha in Sarn. 1926 
= ca. 18 February 1870. 

BHU B. 4451. lOff. Incomplete. 

BHU B. 4456. llff. Incomplete. 

BHU C. 4125. 87ff. Sarada. 

GJRI 8628/853. Ff. 1-2, 4-14, 17-23, and 25-31. 
Incomplete. 

Oxford CSS I 225 (*d. 852 (1)). Ff. 1-52. 

RORI Cat. IV 19688. llff. Incomplete. 

RORI Cat. IV 20432. lOff. (ff. 1-4 missing). Incom¬ 
plete. No author mentioned. 

RORI Cat. IV 21926. If. Copied by Mukundaraja. 

No author mentioned. 

RORI Cat. IV 22040. 7ff. 

RORI Cat. VIII 26683. 5ff. 

RORI Cat. IX 29342. 36ff. (f. 4 repeated). 

RORI (Bikaner) 16948. 34ff. 

The Ramalanavaratna was published with the 
Hindi artha of Budha Vasatirama at Murnbai in 
Sarn. 1950 = A.D. 1893. 

2. Additional information coricerning a manuscript 
of his Marlci (see CESS A 4, 183b): 

RORI (Alwar) 2873 = *Alwar 1928. lOff. Incom¬ 
plete (var^aphalodaharaiia). 

3. Additional manuscripts of his Hindi Ududayapra- 
dtpaflka (see CESS A 4, 183b-184a): 

Oxford CSS I 246 (*d. 1013 (6)). Ff. 1-11. Copied 
by Sivacaraiia Bra<hmaiia> on Wednesday 6 
suklapaksa of Magha in Sarn. 1887 = 19 January 
1831. 

RORI Cat. II 8225. 8ff. Copied by Ruparama in 
Sarn. 1908 = A.D. 1851. Ascribed to Vi§iiudasa. 
IM Calcutta 964. See NCC, vol. 11, p. 172. 

RORI (Alwar) 2700. 8ff. 

Vrndavana 236. Ff. 1-9. Copied by Vi§tiudasa. 


210 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


4. Additional manuscripts of his Sarnskrta Ududaya- 
pradlpafika (see CESS A 4, 184a-184b): 

Kathmandu (1965) 150 (5906) = Kathmandu (1964) 
27. lOff. Copied on Tuesday 4 kr§napak§a of 
Asvina in Sarn. 1904, Saka 1769 = 25 October 
1847. 

RORI (Udaipur) 6493. 16ff. Copied by Maganirama 
in Sarn. 1904 = a.d. 1847. 

5. Additional information concerning a manuscript 
of his tika on the Pahcasvard of Prajapatidasa (see 
CESS A 4, 184b-185a): 

RORI (Alwar) 2979 = *Alwar 1832. 9ff. Copied in 
Sam. 1908 = a.d. 1851. 


*PARAMAHAMSA PARIVRAJAKACARYA 

Additional manuscripts of his Muhunamuktdvali 

(see CESS A 4, 185a-185b): 

RORI (Udaipur) 557. 5ff. Copied by Lak^midasa 
Upadhyaya, the pupil of Pithaji, at Behada in 
Sarn. 1760 = A.D. 1703 during the reign of 
Anupasirpha, the son of Ramacandra. With a 
tika. 

RORI (Jaipur) 4407. 7ff. Copied by Raghava at 
Kelapura in Sam. 1787 = a.d. 1730. With a sta- 
baka. 

RORI (Udaipur) 556. 9ff. Copied in Sarn. 1794 = 
A.D. 1737. With a tika. 

RORI (Udaipur) 5220. 4ff. Copied by Srikanfha 
Jyotirvid for Ambalala at Pu§kara in Sam. 1821 
= A.D. 1764. 

RORI (Bikaner) 16753. Copied by Lacchirama in 
Sam. 1826 = a.d. 1769. With a Rajasthani sta- 
baka. 

RORI (Bikaner) 14650. llff. Copied by Dola at 
BhaggO in Sarn. 1842 = a.d. 1785. With a 
Rajasthani stabaka. 

Oxford CSS I 444 (=T. 53 (2)). Ff. 1-9 and 4ff. Cop¬ 
ied by Haralalaji, a Brahmana, on Sunday 12/13 
kr§napak§a of Pau§a in Sarn. 1870, Saka 1735 = 
16 January 1814. 

Oxford CSS I 445 (*d. 754 (4)). Ff. 1-7. Copied in 
Sarn. 1882 = A.D. 1825. 

RORI Cat. XVI 36198. 27ff. Copied by UmMatta at 
Lasakara in Sarn. 1886 = a.d. 1829. 

RORI Cat. XVI 34301. 12ff. Copied by Somadatta in 
Sarn. 1904 = a.d. 1847. 

RORI (Bikaner) 14663. 8ff. Copied in Sarn. 1906 = 
A.D. 1849. 


RORI (Bikaner) 15867. 12ff. Copied by Magha at 
Bidasara in Sarn. 1908 = a.d. 1851. With a 
Rajasthani stabaka. 

RORI Cat. V 22150. 8ff. Copied in Sarn. 1943 = 
A.D. 1886. With a Bdlavabodha in Old Raja¬ 
sthani. 

BHU C.1826. 13ff. 

Jodhpur 507. See NCC, vol. 11, p. 173. 

Oxford CSS I 446 (*e. 145 (6)). Ff. 2-11. Incom¬ 
plete. 

RORI Cat. VII 25620 (32). Ff. 243-250. With a bha- 
§atika. 

RORI (Bikaner) 14675. 15ff. Copied by Manavijaya. 
RORI (Jaipur) 5490. 8ff. 

RORI (Jaipur) 6413. 9ff. With a Rajasthani stabaka. 
RORI (Jaipur) 6607. lOff. Copied by Manasirnha at 
Khacaroda. With a Rajasthani stabaka. 

PARAMANANDA 

Author of a Muhurtad!pika. Manuscript: 

IM Calcutta 1229. Incomplete. See NCC, vol. 11, p. 
179. 


PARAMANANDA GHANENDRA 

The pupil of Cidananda Brahmendra, Para- 
mananda wrote a Smrtiratnamahodadhi = Smrti- 
sdrasahgraha. Manuscripts: 

GOME Madras R.2258(a). Ff. 4-95. Grantha. Cop¬ 
ied in 1916/17 from a manuscript belonging to 
Edavalli Ramayyavadhanulu of Madigi, Rama- 
chandrapuram Taluk, Godavari District, (acara, 
sraddha, and asauca). 

GOML Madras D.2802. 200pp. Telugu. (safkarma- 
vicara). 

GOML Madras D.2803. 233pp. Grantha. (§atkarma- 
vicara). 

GOML Madras D.2804. 124pp. Grantha. (asauca). 
GOML Madras R.1213(b). Ff. 13-56. Telugu. (acara 
and sraddha). Presented in 1913/14 by K. Rama- 
krsnayya of Masulipatam. 

GOML Madras R.2633. 74ff. Telugu. (asauca). Pre¬ 
sented in 1917/18 by Somanci Yajnesvara Soma- 
yajulugaru of Naracapur, Kistna District. 

The second verse is: 

yatibhih paramanandaghanendrair likhyate ’dhuna // 
asaucanirnayah samyak sandehanarn nivrttaye // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


211 


The colophon begins: iti srimatparamahamsapari- 
vrajakacaryasricidanandabrahmendrasarasvatipujya- 
padasi^yasriparamanandaghanaviracite. 

*paramAnanda SARMAN 

Additional manuscripts of his Prasnamaijikya- 
mala (see CESS A 4, 186a-186b): 

Oxford CSS I 525 (*d. 886 (5)). Ff. 1-13. Incom¬ 
plete (ends in verse 120). 

RORI (Alwar) 2833. 19ff. Incomplete (prakarana 2). 
RORI (Alwar) 2834. 162ff. Incomplete. 

For the last two manuscripts see * Alwar 1853. 

-^PARAMANANDA JYOTISARAYA (fl. 1614) 

Paramananda (see CESS A 4, 186b) was the son 
of Vasudeva. The epoch of his Jahmgiravinoda- 
ratndkara is Saka 1536 = a.d. 1614. It has 8 adhi- 
karas: dhruva, madhyama, spa^ta, triprasna, candra- 
grahana, suryagrahana, parilekha, and candrodaya. 
Additional manuscript: 

RORI Cat. VII 26351. lOff. Copied by Nanurama on 
Saturday 10 suklapak§a of Magha in Sarn. 1884 
= 26 January 1828. 

Verses 2-11 are: 

yo vavaratmaja iti prathayan nijanam 
pradurbabhuva vasudhadhipatir humau // 
satkirttim ambunidhimekhalatarn dharitrim 
purvagatam atha vijitya ripun sasarnsa HIH 
tasyatmajah samabhavan nrpatis ca ganta 
namna hy akav < v > aravaro vasudhavaras ca // 
govipradinasarano nrpadharmagopta 
dustantakrd ravipadabjaratih sukirttih //3// 
aisvaryam nakanathad amrtamayakarat kantim 
ambhojamitrat 

tejorasim ganesan matim atisurabhikalpavrksac ca 
danam // 

gambhiryam varirasir dhanam api dhanadat sarvam 
adaya yatnat 

srimacchrinQradindro hy akavaratanayo nirmitah 
sadvidhatra //4// 

yatkirttir jagatam traye samudita bhati pratapagraga 
yattrasat kanakacalah samadadhat pandutvam uccais 
tanau // 

mitre premnakarat svat sacakitahrdayah 
samprasaryyasu hamso 


deyo naivarddhine ’sav iti sa kathayati sruyatam 
nuradindrah 11511 

vayur varinidhin nivarayati mayatagrate hilanM 
bhumau sarvajanina eva nrpatir 
dikpalasamhandharam // 
utpatas trividhas tatha suraganan sarvarns ca 
santrasayan 

srimatsahajalaladindratanayah sarvam saham 
rak§ati 11611 

yadrajye bhOmipalaih pramuditahrdayaih 
sevyamanarn padabjarn 

yuddhe saundaih sasainyair nrpamukutamanidyota- 
manarn samantat // 

maladyair lak§anadhyarn manisadrsanakham 
kurmapr§iharn bhamurddham 
rekharn bibhrat sabanarn pracalati vasudhadharma- 
samrak§anaya HIH 

tasyagre catimanyah sakalagunakalalahkrtah 
premapatrarn 

trMa dehasya data nrpavaratilakasyapi vi§nuprasa- 
dat// 

santo dine dayavan iti patisakhah khana evetivarah 
satrCnarn capi hanta nijajanadayito jatiloke yasasvl 

// 8 // 

tasyetivarakhanasya yasovyaptam idarn jagat // 
candelavamsajatasya nunarn candro jvalasya ca 11911 
candelanvayacandrama samabhavat khanetivarah 
ksitau 

tena srimadakawaratmajajahahgirasya santustaye // 
granthah panditamandaladrtajahangiradyaratnakaro 
vidvajjyotisarayasarmaparamanandena nirmapitah 

//lO// 

nanajyoti§asarasastraganitair udyotamanah sada 
sadvrttair dvijabhumipaih sukrtibhir manyah 
suratnakarah // 

tasmaj jyoti^araya e§a padavirn labdhvatha 
yatkirttaye 

variprasthasamudbhavah prakurute 
srivasudevatmajah HWH 

PARAMANANDADEVA SARMAN 

Author of a Spandanacaritra. Manuscript: 

Varendra 318. If. Bengali. Copied by Sivaprasada 
Sarman. 


*PARAMESVARA (ca. 1380/1460) 

11. Additional manuscript of his Bha{adlpika (see 
CESS A 4, 189b-190a): 


212 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI Cat. IX 28487 (5). Ff. 42-63. Incomplete. 

12. Additional information concerning a manuscript 
of his Lllavativivarana (see CESS A 4, 190a-190b): 

GOME Madras R.338 (mistakenly called R.388 in 
CESS). Ff. l-34v. Telugu. Presented in 1910/11 
by Potturi Lak§mayya of Guntur. 

17. Additional manuscripts of his Jatakapaddhati 
(see CESS A 4, 191a-191b): 

*Mysore (1905) 646. 10pp. Telugu. (Jatakavartma). 
Mysore ORI P.6847/6. Ff. 242-247. Telugu. 

Mysore ORI P.6847/12. Ff. 261-266. Telugu. (a§ta- 
kavarga based on Lihgana with a vyakhya of 
Paramesvara Jyotirvid). 

In the Jatakapaddhati occur the verses: 

anugrahartharn racayami padyarn 
horakriyayah paramesvaro ’ham // 

X X X X X X X tah samuditah sampanna etair gunaih 
surir lihganadik§ito ’pi nikhilagranthan punar 
vyakarat // 

tatpadamburuhapranamajanitaprajnena jiyan maya 
loke sa paramesvarena racita xxxxxxx// 

19. Additional manuscript of his Acarasahgraha (see 
CESS A 4, 191b-192a): 

Visvabharati (Adyar) 141(a). 15ff. Malayalam. 

21. Additional manuscript of his Balaprabodhini 
(see CESS A 4, 192a): 

Visvabharati 1452(b). (Paddhativyakhyd). Incom¬ 
plete. See NCC, vol. 11, p. 190. 


^PARAMESVARA NAMPVTIRI (1775/1839) 

Additional manuscript of his Varadlpikd (see 
CESS A 4, 192b-193a): 

Trippunittura 1.744. See NCC, vol. 11, p. 192. 


*PARASURAMA 

Additional manuscripts of his Lllavatl {Ika (see 
CESS A 4, 193b-194a): 


*BORI 571 of 1895/1902. Ff. 1-52. Copied on Satur¬ 
day 10 suklapak§a of Asvina in Sam. 1720 = 3 
October 1663 (?). 

Vrndavana 8737. 125ff. Copied in Sarn. 1861 = a.d. 
1804. Incomplete. 

RORI (Alwar) 2589. 106ff. Copied in Sam. 1912 = 
A.D. 1855. 

Allahabad Museum 336/104. Ff. 7-66; and 1-11. 

Incomplete (verses 29-175 and 213-236). 
Dahilak§mi XXXIII 57. Incomplete. See NCC, vol. 
11, p. 196. 

Delhi Jaina (Dharmapura) 425 (No. 22). 44ff. 
Incomplete. 

Mithila III 325. 17ff. Maithili. Incomplete. Property 
of Pandita Raghunatha Jha of Sanakorthu, 
Manigachi, Darbhanga. 

Oxford CSS I 111 (*d. 773 (14)). Ff. 1-13. Incom¬ 
plete (ends in tika on verse 30). 

RORI (Alwar) 2590. 315ff. 

Udaipur RVSS 850. 13ff. Incomplete (ends in tika 
on verse 33). 

^PARASURAMA (fi. 1356) 

The son of Kr§nadeva, a Kanva residing in Nih- 
papa, Nihpaya, or Nihpada (Niphad near Nasikya?), 
Parasurama completed his Bhupalavallabha (see 
CESS A 4, 194a-194b) on Thursday 2 suklapak§a of 
Asadha in Saka 1278 = 30 June 1356. Additional 
manuscripts: 

*SOI 4386. Ff. 1-128 and 131-171. Copied by 
Lacchirama for Raja Vyaghrajit at Pippalika on 
Thursday 9 kr§napak§a of Margasirsa in Sarn. 
1771 = 29 October 1724. Concerning Vyaghrajit 
(that is, Maharaja Sagatavata [ = Saktavat] Bhaga- 
jika), a sardar of Sahgramasimha, who ruled 
Mewar from 1716 till 1734, and concerning 
Pippalika (Piplya), see D. Sharma [A5. 1945a]. 
*SOI 239. Copied from SOI 4386 in 1933 at Ujjayi- 
ni. 

^Jaipur (Khasmohor) 5184. 

RORI Cat. XVI 36588. 24ff. Incomplete. 

*RORI (Udaipur) 505. 608ff. (ff. 3, 90, and 292 
missing). Incomplete. 

Among the verses at the beginning are: 

bhupalavallabho granthah krtah purvarn savistarah // 
tatah parasuramopadesah svalpo viracyate // 
srikr§nadevaputrena parsuramopadesakah // 
grantho ’yarn cativistirnah kriyate bhupavallabhat // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


213 


asin nihpapavasi dvijakulatilakah sarvasastre^v 
adhitah 

kanvah srikr§nadevah parahitanirato 
vedavedaiigavedi // 

tatsunuh parsuramah sakaiaganitavic chrikatak§asya 
si§yah 

si§yaih samprarthyamano narapatidayitam sastram 
etac cakara // 

At the end is the verse: 

srisalivahanasake ’§tamunidvicandra- 
sahkhye prayatayati durmukhanamni var§e // 
a§adhamasasitayugmatithau surejya- 
dhi§nye dine vyaracayad dvijaparsuramah // 

*PARASARA 

Additional manuscripts of his Ududayapradlpa 
(see CESS A 4, 194b-198a): 

Udaipur RVSS 2523. If. Copied in Sam. 1744 = 
A.D. 1687. (Parasarijdtaka). Incomplete. 

Gondal 11. 2ff. Copied in Sarn. 1832 = A.D. 1775. 

Incomplete. No author mentioned. 

RORI (Jaipur) 5069. lOff. Copied in Sarn. 1878 = 
A.D. 1821. With a tika. 

RORI (Jaipur) 4157. llff. Copied in Sarn. 1880 = 
A.D. 1823. With a tika. 

Oxford CSS I 242 (*d. 773 (12)). Ff. 1-3. Copied in 
Sarn. 1889 = A.D. 1832. 

Oxford CSS I 243 (*d. 807 (2)). Ff. 1-5 and 7-9. 
Copied in Sam. 1890 = A.D. 1833. With a tika. 
Incomplete (verses 1-22 and 26-end). 

RORI (Alwar) 6094. 6ff. Copied by Sukadeva Pujari 
in Sam. 1899 = A.D. 1842. 

GJRI 8512/737. Ff. 1-13. Maithili. Copied on Friday 
5 suklapaksa of Asadha in Saka 1766 = a.d. 
1844. 

RORI Cat. XVI 35963. 19ff. Copied in Sam. 1903 = 
A.D. 1846. With the tika of Mayuropadhyaya. 
RORI (Jaipur) 9865. 2ff. Copied in Sarn. 1903 = 
A.D. 1846. (Parasarlhora). 

Kathmandu (1964) 27 (5906). lOff. Copied on Tues¬ 
day 4 kr§napak§a of Asvina in Sarn. 1904, Saka 
1769 = 25 October 1847. With the Sarnskrta 
tika of Paramasukha. 

RORI (Alwar) 2702. 18ff. Copied by Vaidyanatha in 
Sam. 1904 = a.d. 1847. With the tika of Bhaira- 
vadatta. 

RORI (Alwar) 6196. 6ff. Copied in Sarn. 1904 = 
A.D. 1847. 


RORI (Udaipur) 6493. 16ff. Copied by Maganirama 
in Sarn. 1904 = a.d. 1847. With the Sarnskrta 
tika of Paramasukha. 

BHU C.2078. 3ff. Copied in Sam. 1905 = a.d. 1848. 
(Paras arl horapaddhati). 

RORI Cat. XVI 35789. 17ff. Copied at Kofa in Sarn. 
1906 = A.D. 1849. With the tika of Ramadatta. 

BHU B.4337. 5ff. Copied in Sarn. 1907 = A.D. 1850. 
With a tika entitled Subhasinl. (Parasarlja- 
taka). 

BHU C.3473. 15ff. Copied in Sarn. 1907 = a.d. 
1850. (Pardsari). Incomplete. 

Oxford CSS I 244 (*d. 766 (2)). Ff. 2-8. Copied by 
Mahipala on Wednesday 1 kr§iiapak§a of Magha 
in Sarn. 1909 = 9 February 1853. With a tika. 
Incomplete (begins with verse 6). 

RORI Cat. IV 18955 (1). 19ff. Copied by Bhainru- 
lala in Sarn. 1910 = a.d. 1853. With the tika of 
Ramadatta. 

RORI Cat. IV 18955 (2). 9ff. Copied by Balananda, 
the son of Narayana, in Sarn. 1910 = a.d. 1853. 
With a tika. 

GJRI 8513/738. Ff. 1-4. Maithili. Copied in Saka 
1781 = A.D. 1859. 

RORI Cat. IV 21388. 20ff. Copied by Ratirama in 
Sarn. 1916 = a.d. 1859. With the tika of 
Laksmipati. 

RORI Cat. XVI 35643. Ff. 3-8. Copied by Rama- 
narayaria Vyasa at Jodhapura in Sarn. 1917 = 
A.D. 1860. With a tika. Incomplete. 

RORI Cat. XVI 34994. 12ff. Copied at Narayatiasa- 
hara in Sarn. 1918 = a.d. 1861. 

RORI Cat. XVI 35348. 8ff. Copied in Sarn. 1921 = 
A.D. 1864. With a tika. 

RORI (Alwar) 6220. 14ff. Copied by Saligrama in 
Sarn. 1922 = A.D. 1865. With a bha§a tika. 
Incomplete. 

RORI (Chittorgarh) 3248. 4ff. Copied by Devicanda 
in Sarn. 1922 = A.D. 1865. (Parasari). 

GJRI 8514/739. Ff. 1-11. Maithili. Copied on 7 
krstiapak§a of Sravaiia in Saka 1789 = ca. 20 
August 1867. With a bha§a vyakhya. 

RORI (Alwar) 5747. 17ff. Copied in Sarn. 1932 = 
A.D. 1875. With the tika of Bhairavadatta. 

RORI (Alwar) 5433. 8ff. Copied by Baladatta in 
Sarn. 1934 = a.d. 1877. 

RORI (Alwar) 5524. 26ff. Copied in Sarn. 1937 = 
A.D. 1880. With the tika of Bhairavadatta. 

GJRI 8268/493. Ff. 1-3. Maithili. Copied in Saka 
1805 = A.D. 1883. 

RORI (Alwar) 5468 (9). Ff. 76-99. Copied by 
Kr§nalala in Sarn. 1942 = A.D. 1885. With the 
tika of Bhairavadatta. 


214 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 11129. 4ff. Copied by Suryamala in 
Sam. 1947 = a.d. 1890. 

RORI (Chittorgarh) 2107. 5ff. Copied in Sarn. 1953 
= A.D. 1896. With the Rajasthani tika of 
<Budha> Vasatirama. 

RORI (Jaipur) 3660. 6ff. Copied by Citramalla Dvija 
in Sarn. 1963 = A.D. 1906. 

Vrndavana 3580. 14ff. Copied in Sam. 1979 = a.d. 
1922. Incomplete. 

AS Bengal 7042 (G.388 A). Extra 4ff. With a fika. 

BHU B.179. lOff. (Parasari). Incomplete. 

BHU C.799. 13ff. With a tika. (Parasari). Incom¬ 
plete. 

BHU C.852. 3ff. (Parasari). 

BHU C.1697. 8ff. With a tika. (Parasari). Incom¬ 
plete. 

BHU C.3327. 5ff. With a tika. (Parasari). Incom¬ 
plete. 

BHU C.3607. 5ff. (Parasari). Incomplete. 

Calcutta University 351 III. 6ff. Bengali. (Laghu- 
parasarl). 

CP, Kielhorn XXIII 4. 44ff. (Udurayapradlpa). No 
author mentioned. Property of Anamamisra of 
Sammalpur. 

Florence (Add.) 833 B. Ff. 1-6. With a tika. 

GJRI 8267/492. F. 1. Maithili. Incomplete. 

GJRI 8510/735. Ff. 1-7. Maithili. 

GJRI 8511/736. Ff. 1-5. Maithili. 

GJRI 9215/997. 9ff. Maithili. Incomplete. 

GJRI 10975/1029. Ff. 1-5. Maithili. 

GJRI 10976/1030. 3ff. Maithili. Incomplete. 

IM Calcutta 1090 (with a Hindi version); and 8768. 
See NCC, vol. 11, p. 207. 

lO 6407 (Mackenzie III.86c). 4ff. Telugu. (Jdtaka- 
candrika). From Colin Mackenzie. 

^Jaipur (Khasmohor) 5579. (Para'sarIyajdtaka\ with 
a tika). 

Jammu 2927. 15ff. With a tika. No author men¬ 
tioned. 

Kathmandu (1964) 28 (5902). 6ff. With a 'Hindi 
tika. Incomplete. 

Kathmandu (1964) 29 (5893). 27ff. Copied by Veda- 
garbhaka. With the tika of Bhairavadatta. 

Kerala 2351 (13964 A). 75 granthas. No author 
mentioned. 

Kerala 2352 (1521). 900 granthas. With the tika of 
Bhairavadatta. No author mentioned. 

NPS (Sanskrit) 8816. If. With a tika. (Pdrasa- 
rljaiaka). Incomplete. 

Oxford CSS I 245 (*d. 764 (2)). Ff. 1-3. 

Poleman 5186 (Columbia, Smith Indie 188). Ff. 1-2. 
Incomplete (verses 4-43 in an unusual order). 

RJ IV 3024. 3ff. No author mentioned. 

RORI Cat. IV 20866. 3ff. With a tika. (Pdrdsarlya- 


jdtaka). 

RORI Cat. VI 24263. 38ff. With the tika of Bhaira¬ 
vadatta. Copied from the edition published at 
Kasi in [1850]. 

RORI Cat. IX 28806. 6ff. With a tika. (Laghu- 
pardsarl). 

RORI Cat. XVI 34887. 14ff. With a Rajasthani ver¬ 
sion. 

RORI (Alwar) 2698. lOff. With a tika. 

RORI (Alwar) 2699. 7ff. With a tika. 

RORI (Alwar) 2700. 8ff. With the Hindi tika of 
Paramasukha. 

RORI (Alwar) 2701. 23ff. 

RORI (Alwar) 5579. 6ff. With a tika. 

RORI (Alwar) 6090. lOff. Incomplete. 

RORI (Jaipur) 3315. 5ff. (Parasarijdtaka). 

RORI (Jaipur) 8327. 2ff. 

RORI (Jaipur) 9367. 3ff. Incomplete. 

RORI (Jaipur) 9464. 30ff. (f. 4 missing). With a 
tika. Incomplete. 

RORI (Jaipur) 10304. lOff. Incomplete. 

Udaipur RVSS 866. 18ff. Incomplete. 

Udaipur RVSS 879. 8ff. With a Gujarati tika. 
Udaipur RVSS 2271. If. Incomplete. 

Varendra 236. Ff. 1-9. Copied by Vi§nudasa. With 
the Hindi tika of Paramasukha. 

Visvabharati (Adyar) 737(i). llff. Grantha. With a 
vyakhyana. 

Visvabharati (Adyar) 1057(d). 62ff. Nandinagari. 

With other, unidentified material. 

Vrndavana 651. 3ff. 

The Ududdyapradlpa was published with his 
own Hindi tika, Laghupdrdsarlsiddhdnta, by S. G. 
Khota, Dilli-Patana-Varanasi 1976; with a Bengali 
tika by Ramagopala Raya, published at Kalikata in 
Beng. Sarn. 1386 = a.d. 1979; with a Hindi 
vyakhya, Vijayd, by Kedaradatta Josi, 
Dilli-Varanasi-Patana-Madrasa 1984; and with a 
Hindi tika, Tattvabodhinl, by Ramesvara Bhatta, 
Kalyana-Mumbai 1986. 

^'PARASARA 

Additional manuscripts of his Keralasdstra = 
Parasarihord (see CESS A 4, 198a): 

Florence (Add.) 833 A. Ff. 1-6. (Para'sarlyakerala- 
sdra\ karakaprakarana). 

Kathmandu (1964) 41 (7405). 6ff. (Keralasdra; 
karakaprakarana). 

Verse 2 is: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


215 


parasaramunim natva taddhoram ca nirik§ya ca // 
vak§ye ’py ududasamargam purvasastranusaratah // 

*PARASARA 

Additional manuscripts of the Parasarasamhita 
of which GOML Madras D.3260 (see CESS A 4, 
198b) contains a part; 

Mysore ORI P.2239/55. Ff. 66-67. Telugu. (eka- 

masadijananasanti). 

Mysore ORI P.3023/56. Ff. 36-37. Telugu. (eka- 

masadijananasanti). 

Mysore ORI P.4863/47. Ff. 63-64. Telugu. (ku- 

husanti). 

Mysore ORI P.4997/15. Ff. 37-38. Nandinagari. 

(ekamasadijananasanti; incomplete). 

Mysore ORI P.5666/11. Ff. 71-80. Nandinagari. 

(prayanaprakarana). 

Mysore ORI P.5672/7. Ff. 74-76. Nandinagari. 

(navamiprathamartavasanti). 

Mysore ORI P.5672/58. Ff. 94-95. Kannada, (eka¬ 
masadijananasanti). 

Mysore ORI P.5947/10. Ff. 13-14. Kannada, (pra¬ 
yanaprakarana). 

Mysore ORI P.5947/11. F. 15. Kannada, (prayana¬ 
prakarana). 

Mysore ORI P.7401/70. If. Telugu. (ekanaksatra- 
jananasanti). 

Mysore ORI P.9428/30. F. 18. Nandinagari. (pitapu- 
traikamasajananasanti). 

Mysore ORI P.9942/10d. Ff. 148-149. Telugu. 
(purusasamudrika). 

Mysore ORI P.10041/27. Ff. 41-42. Telugu. (eka- 
nak§atrajananasanti). 

*PARASARA 

Additional manuscripts of his Parasarasutra (see 
CESS A 4, 198b): 

RORI (Udaipur) 5215. 18ff. Copied by Sivabakasa 
Caube at Jayapura in Sam. 1899 = a.d. 1842. 
*PUL II 3616. 4ff. Grantha (wrongly listed with the 
U4udayapradipa in CESS A 4, 187a). 

RORI (Udaipur) 3394 (2). 28ff. 


*PARASARA 

Additional manuscript of his Pdrdsarya (see 
CESS A 4, 198b-199a): 

Mysore ORI P.5108/41. Ff. 135-136. Telugu. Incom¬ 
plete (vimanavidya, pafala 1). 

*PARASARA 

The Madhyapdrdsarl (see CESS A 4, 199a) was 
published with a Hindi vyakhya, Vijayd, by Kedara- 
datta Josi, Dilli-Varanasi-Patana-Madrasa 1984. 

PARASARA (/?. before the eleventh century) 

Author of a Krsiparasara on agriculture, but 
containing much on omens; dated to the eleventh 
century by L. Gopal [A5. 1973]. See also G. Wojtilla 
[A5. 1976]. Manuscripts: 

Dacca 4558. Bengali. Copied by Golaka Candradeva 
Sarman in Saka 1719 = a.d. 1797. 

Bhubaneswar IV 138 (Jy/56). 89ff. Oriya. Copied by 
Ramacandra Panigrahin for Harekr^na on Mon¬ 
day 4 kr§napaksa of Caitra in Sal. San. 1243, 
ahka 23 of Ramacandra = 4 April 1836. At the 
end of the manuscript. Formerly property of 
Hari Panigrahin. 

lO 6475 (Tagore 24). 14ff. Bengali. Copied in a.d. 

1848. From Sir S. M. Tagore. 

Bhubaneswar VII 51 (Dh/570). 25ff. Copied on Fri¬ 
day amavasi of the kr§napak§a of Asvina, 20 
Kanya, in Sal. San 1269 = 4 October 1861, dur¬ 
ing the reign of Divyasirnha. Presented by N. K. 
Mahapatra of the S. C. College, Puri. 

Poona, Fergusson College, Mandlik. Copied from a 
manuscript in the Samskrta Pathasala, Calcutta, 
on 4 February 1886. 

Bhubaneswar IV 18 (Jy/17). 58ff. Oriya. From 
GOML Madras. 

Bhubaneswar IV 19 (Jy/18b). 18ff. Oriya. From 
Ranapur, Puri District. 

Bhubaneswar IV 20 (not given). 59ff. Oriya. With an 
Oriya translation. From Parlakhemindi, Ganjam 
District. 

Bhubaneswar IV 157 (Jy/115). 63ff. Oriya. At end of 
manuscript. From Bhubaneswar, Puri District. 
Bhubaneswar IV 184 (Jy/18). 150ff. Oriya. At end of 
manuscript. From Ranapur, Puri District. 


216 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bhubaneswar VII 50 (Dh/542). 47ff. Oriya. With the 
Oriya translation of Mukunda. From Gadamani- 
tri, Begunia, Puri District. 

Bhubaneswar VII 260 (Dh/460). 4Iff. Oriya. With an 
Oriya translation. From Tureintra, Balianta, Puri 
District. 

Cambridge R.15.87. Ff. 2-12. Bengali. Incomplete 
(begins in verse lOd). 

Cuttack 15. See NCC, vol. 4, p. 284. 

GJRI 8273/498. Ff. 1-6. 

lO 3168 (1274 a). 17ff. Bengali. Copied by Kr§na- 
mohana Sarman. From H. T. Colebrooke. 

Mitra, Not. 317. 5ff. Bengali. Property of Maharaja 
Satisacandra of Kr$nanagara, Navadvipa. 

Sanskrit Sahitya Pari§ad, Calcutta 1.1.310. See NCC. 

The Krsiparasara was edited with a Bengali 
translation by Tarakanta Kavyatirtha, Ben. Sarn. 
1322 = A.D. 1914, and with an English translation 
by Girija Prasanna Majumdar and Sures Chandra 
Banerji as BI 285, Calcutta 1960. 

*PARASARA (fl. seventh or eighth century) 

Additional manuscripts, apparently, of his Brhat- 
parasarahora (see CESS A 4, 199b-202b; see also 
Giridharin Lala Gosvamin (fl. 1965/1974)); 

Mysore (1905) 318. 15pp. Telugu. Incomplete (2 
adhyayas from the UtiaraparasarXya). 

Mysore ORI P.370/7. Ff. 58-82. Nandinagari. 
Incomplete (ududasapradipika). In this and the 
remaining Mysore manuscripts the work is 
entitled Vrddhaparasanya. 

Mysore ORI P.528. Ff. 3-84. Grantha. (dasaphala). 
Mysore ORI P.1188/2. Ff. 16-50. Nandinagari. 
(ududasapradipika). 

Mysore ORI P.1188/9. Ff. 1-115. Telugu. With a 
Kannada translation, (adhyayas 1-13). 

Mysore ORI P.1813/8. Ff. 1-3. Telugu. (ududasapra¬ 
dipika). 

Mysore ORI P.3020/2. Ff. 59-120. Grantha. 
(ududasapradipika). 

Mysore ORI P.3166. Ff. 1-107. Grantha. (uttara- 
bhaga). 

Mysore ORI P.3502. Ff. 1-57. Grantha. 

(ududasapradipika). 

Mysore ORI P.4441/1. Ff. 1-20. Telugu. 

(ududasapradipika). 

Mysore ORI P.4481/8. Ff. 27-91. Nandinagari. 
(ududasapradipika). 


Mysore ORI P.5465/6. Ff. 1-46. Telugu. 
(ududasapradipika; to sukradasaphala). 

Mysore ORI P.5651/3. Ff. 49-73. Nandinagari. 

(ududasapradipika; incomplete). 

Mysore ORI P.6392/1. Ff. 72-118. Telugu. 

(ududasapradipika; ravi to sukradasa). 

Mysore ORI P.6480/4. Ff. 79-97. Nandinagari. 

(uttarabhaga; incomplete). 

Mysore ORI P.6788. Ff. 1-44. Grantha. Copied by 
Anandanarayana. (ududasapradipika). 

Mysore ORI P.6800. Ff. 1-7. Kannada, (ududasapra¬ 
dipika; paricchedas 1-7). 

Mysore ORI P.7032. Ff. 1-54. Nandinagari. 

Mysore ORI P.7472/2. Ff. 15-73. Grantha. 

(ududasapradipika). 

Mysore ORI P.7473/2. Ff. 1-57. Kannada, 

(ududasapradipika). 

Mysore ORI P.7514/3. Ff. 1-15. Telugu. 

(ududasapradipika; surya to candradasa). 

Mysore ORI P.7913/17a. Ff. 1-13. Nandinagari. 
Incomplete (slokas 1-88). 

Mysore ORI P.8533/1. Ff. 1-8. Grantha. 

(ududasapradipika; incomplete). 

Mysore ORI P.10367/5. Ff. 1-42. Nandinagari. 
Incomplete (adhyayas 14-20). 

Mysore ORI P.10387/11. F. 8. Nandinagari. 

(ududasapradipika). 

Oppert II 2976. (Vrddhapdrasarya). Property of 

Raja Vellahki Veiikataramasuryaprakasa Row of 
Utukuru, Krsna District. 

Oxford CSS I 236 (*d. 764 (8)). Ff. 1-30. Incom¬ 
plete (purvakhanda, adhyayas 36-45). 

PrSB 2927 (Berlin or. 6320). Ff. 1-96. Nandinagari. 
Incomplete (adhyayas 22-26 of the Vrddha- 
pdrasarya). 

RORI Cat. IX 29512. 168ff. (V r ddhapara sa¬ 

ri samhita). 

RORI (Jaipur) 10183. 22ff. (f. 1 missing). (Vrddha- 
parasarl). Incomplete. 

RORI (Udaipur) 4957. Ff. 1-4. With a vyakhya. 

Vrndavana 234. 74ff. (ff. 1-19 missing). (Pardsara- 
hordjyoti^a). Incomplete. 

VSM (Upadhye) 11251. 67ff. Incomplete. 

VSM (Upadhye) 11252. 69ff. 

VSM (Upadhye) 12786. 27ff. 

VSM (Upadhye) 12787. 13ff. Incomplete. 

The Brhatpdrdsarahord was published with an 

English translation by R. Santhanam, 2 vols., Delhi 

1988. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


217 


PARIPURNANANDA PARAMAHAMSA 
Author of a Dasasara. Manuscript: 

Mysore ORI P.3771/4. Ff. 14-67. Grantha. 

*PARSVACANDRA SURI (1480/1555) 

Additional manuscript of his stabaka on the 
K^etrasamasa of Ratnasekhara (fl. 1370/1390) (see 
CESS A 4, 203b): 

Rattan II 5170. 51ff. Copied in Sarn. 1819 = a.d. 
1762. 


PARSVANATHA 

The pupil of Sricandra, Parsvanatha wrote a 
poem on prasnasastra entitled Hastakanda. Manu¬ 
script: 

RORI (Jaipur) 10319. 4ff. Copied by Jinadeva Suri 
at the Rudrapalliyagaccha in Vigga on Tuesday 
12 krsnapak§a of Asvina in Sarn. 1593 = 10 
October 1536. 

The last verse is: 

sricandracaryasi§yena parsvacandrena dhimata // 
uddhrtyanekasastrebhyo hastakandam vinirmame // 

PALYAPADMA 

A member of the Gautamagotra, a pupil of 
Vidyaranya, and a resident of Kalyanapuri, Palya- 
padma wrote a Pahcahga. Manuscript: 

PrSB 2244 (Hamburg, Palmbl. I 76). Ff. 112-112v. 
Telugu. Incomplete. 

The fourth verse is: 

srilak§minarasirnhapadakamaladhyananusaktah 

paro 

vidyaranyaguroh prasadavibhavad vijhapitajyotisa // 
pancahgam vitanoti pavanatararn sripalyapadmabhi- 
dho 

vidvan gautamagotrajah subhamatih kalyanapuryarn 
vasan // 


PIPPALADA 

Author of a Sanaiscarastotra. Manuscript: 
Mysore ORI P.5788/11. F. 46. Telugu. 


PITAMBARA 

Orissan collaborator in two works on ganita. 

1. Ganita. Manuscript: 

Bhubaneswar 1.0116. 

2. Pdihasamudra. Manuscript: 

Bhubaneswar IV ganita 47 (G/52) = Bhubaneswar 
2.G/52. 102ff. Oriya. Incomplete. From Khurdha, 
Puri District. 


Pi TAM BARA 

A member of the Kasyapagotra, Pitambara wrote 
a fika, Suprakasika, on the Suddhidtpikd of 
Srinivasa. Manuscript: 

Bhubaneswar IV 161 (Jy/6). 129ff. Oriya. From 
Puri. 

The last verse is: 

kasyapagotrasamudbhutapitambaradvijanmana // 
suprakasika tikeyarn si^yartharn likhita maya // 

'^PUNJARAJA (fi. ca. 1700) 

Additional manuscripts of his Sambhuhorapra- 
kdsa (see CESS A 4, 205a-206a): 

RORI Cat. XVI 36751. 24ff. Copied in Sam. 1838 = 
A.D. 1781. No author mentioned. 

RORI (Alwar) 2734 = *Alwar 1976. 209ff. Copied 
in Sarn. 1900 = a.d. 1843. 

RORI (Udaipur) 6445. 4ff. Copied at Alavara in 
Sarn. 1912 = A.D. 1855. No author mentioned. 
BHU C.4680. 42ff. Sarada. 

Kerala — (Travancore Univ. 1283). See NCC, vol. 
12, p. 107. 

New Delhi, N.M. 63/878. 71ff. 


218 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oxford CSS I 301 (*d. 789 (2)). Ff. 1-55. Incom¬ 
plete (ends in 8, 10). 

Oxford CSS I 302 (*d. 802 (5)). Ff. 56-94. With a 
tika. Incomplete (9, 129-20, 9). 

RORI (Udaipur) 3664. 107ff. 

RORI (Udaipur) 6521. lOlff. (ff. 1, 3, and 48 miss¬ 
ing). Incomplete. 

*PUNYASAGARA MAHOPADHYAYA (fl. 
1588H595) 

Additional manuscripts of his vrtti on the Jam- 
budvipaprajhapti (see CESS A 4, 206a-206b): 

RORI (Bikaner) 13013. 260ff. Copied in Sarn. 1689 
= A.D. 1632. 

RORI (Bikaner) 13012. 434ff. Copied in Sam. 1917 
= A.D. 1860. 


PURUSOTTAMA 

Collaborator in composing a Ganita. Manuscript: 

Bhubaneswar IV ganita 19 (G/24). 69ff. Oriya. 
Incomplete. From Jagatsirnhapur, Puri District. 

^PURUSOTTAMA MISRA 

Puru§ottama, who wrote a Jyotisatattvakaumud'i 
(see CESS A 4, 210a), is probably identical with the 
son of Srinivasa Misra to whom a work of the same 
title is attributed. All known manuscripts come from 
Orissa. Manuscripts: 

GOME Madras R.5241. Ff. l-151v. Grantha. Copied 
in 1926/27 from a manuscript belonging to Go- 
vindakaviraju of Pudamari, Ganjam District. 
Incomplete (ends in prakarana 10). 

Bhubaneswar IV 65 (Jy/9). 132ff. Oriya. Incomplete 
(prakasas 1-14). From Puri. 

Bhubaneswar IV 66 (Jy/114). lOlff. Oriya. Incom¬ 
plete (prakasas 1-10). From Subarnapur, Chikiti, 
Ganjam District. 


*PURUSOTTAMA (fl. 1389) 

Additional manuscripts of his Brhatparvamala, 
which agrees with the Suryasiddhdnta (see CESS A 
4, 209b) and whose epoch is Saka 1311 = A.D. 1389: 


BORI 317 of Vishrambag I. Ff. 1-6. Copied by 
Raghava (also Raghunandana), the son of Rama 
of the Gaudajhati, a resident of Vrddhabhuyaja, 
on 9 suklapak§a of Karttika in Sarn. 1599 = ca. 
17 October 1542. 

Benares (1963) 35724. 2ff. Incomplete. No author 
mentioned. 

Verse 1 is: 

suryendusirnhikasunun natvaharn puru§ottamah / 
grathnami parvanarn malarn 
suryasiddhantasammitam // 


^PURUSOTTAMA BHATTA (fl. ca. 1610) 

Additional manuscripts of his Abhinavatdmarasa 
(see CESS A 4, 211a): 

Oxford CSS I 54 (*d. 746 (5)). Ff. 1-12. Copied by 
Kr§na on 11 suklapak^a of Margasirsa in Sarn. 
1680 = ca. 22 November 1623. Formerly prop¬ 
erty of Kr§na, a relative of Govinda Josi, the son 
of Trimalla Bhatta; and of Govinda Josi. 

AS Bengal 6895 (G.7858). 5ff. Copied by Nanda- 
rama Upadhyaya on Saturday 10 krsnapak^a of 
Magha in Sam. 1884 = 9 February 1828. 
Cambridge University Add. 2430. Ff. 1-8. Copied by 
Motirama Sarasvata, a Brahmana of the Sanda- 
JhMi, on Sunday 8 krsnapaksa of Caitra in Sarn. 
1887 = 6 April 1830. See SATE 20. 

RORI (Alwar) 2629 = *Alwar 1888. 13ff. 


^PURUSOTTAMA (1658/1754) 

The son of Pitambara, the son of Yadupati, and 
the pupil of Krsnacandra, Puru§ottama wrote 
extensively on suddhadvaita. Additional manuscripts 
of his Samvatsarotsavakdlanirnaya (see CESS A 4, 
209b-210a): 

BHU B.3425. 83ff. Copied in Sarn. 1786 = A.D. 
1729. 

RORI Cat. IV 20603. 58ff. (ff. 5, 14, 18-20, 26, and 
46-49 missing). Copied by Kr§iia at Campaka- 
pura in Sarn. 1831 = A.D. 1774. Incomplete. 

RORI (Udaipur) 5553. 19ff. Copied in Sarn. 1857 = 
A.D. 1800. 

RORI Cat. VI 24701. 48ff. Copied in Sain. 1862 = 
A.D. 1805. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


219 


RORI (Alwar) 3645. 8Iff. Copied in Sam. 1912 = 
A.D. 1855. 

Baroda 1115. 51ff. (Utsavanirnaya). 

Mysore ORI A.652. Ff. 1-42. 

Mysore ORI C.1051. Incomplete. 

RORI Cat. IV 20569. 99ff. 

RORI Cat. IX 29524. 66ff. 


*PULASTYA 

Additional manuscripts of his Pallisaratavi- 
dhana (see CESS A 4, 212a) addressed to Saunaka 
(q. V.): 

Leipzig 1168. 4ff. Copied by Sivarama in A.D. 1790. 
Leipzig 1169. 5ff. 

RORI Cat. VII 25250. 3ff. (Palllpatanavicdra). 

RORI (Udaipur) 301. 3ff. (PaHlsaraiasantivi- 
dhdna). 

*RORI (Udaipur) 546. 6ff. 


PULASTYABRAHMAN 

Author of an As takavargavydkhyd. Manuscript: 

Mysore ORI P.7473/1. Ff. 1-11. Kannada. Incom¬ 
plete (adhyayas 1-2). 


PUSKALACARYA 

Authority for a Vaidhrtij ananas anti. Manuscripts: 

Mysore ORI P.2239/60. Ff. 70-71. Telugu. 

Mysore ORI P.4592/22. Ff. 44-45. Nandinagari. 
Mysore ORI P.5672/47. Ff. 78-79. Kannada. 

Mysore ORI P.10041/8. Ff. 15-16. Telugu. 

Mysore ORI P.10041/56. F. 74. Telugu. 

He also wrote a Vyatlpdtajananasdnti. Manu¬ 
script: 

Mysore ORI P.3023/45. F. 30. Telugu. 

He also is the authority for a Sahkrdntijana- 
nasdnti. Manuscripts: 

Mysore ORI P.2239/61. Ff. 71-73. Telugu. 

Mysore ORI P.2239/66. Ff. 80-81. Telugu. 

Mysore ORI P.2579/4. Ff. 9-11. Nandinagari. 

Mysore ORI P.3023/47. F. 31. Telugu. 


Mysore ORI P.4992/23. Ff. 45-46. Nandinagari. 
Mysore ORI P.5572/48. Ff. 79-81. Kannada. 
Mysore ORI P.10041/46. Ff. 66-67. Telugu. 


PU^PADANTA 

Author of a Bdlabodha. Manuscript: 

RORI Cat. VIII 26725 (2). Ff. 48-58. With a Hindi 
tika. 


PURNABRAHMA 

Author of a Cihna cintdmani in Hindi. Manu¬ 
script: 

NPS 172 of 1932-34. Copied in Sam. 1739 = a.d. 
1682. Property of Pandita Radhesyama Dvivedi 
of Svamighata, Mathura. 

PURNABHADRA SURI (fl. ca. 1175) 

The pupil of Sricandra SQri (fl. ca. 1150), Purna- 
bhadra wrote a Lagnavicdrasdra in Sarnskrta and 
Prakrta. Manuscript: 

RORI Cat. IV 19301. 3ff. 


PURNANANDA 

Author of a Gha(ikdpancdhga. Manuscript: 
Mysore ORI P.3771/22. Ff. 85-87. Grantha. 


*PRTHUYASAS (fi. ca. 575) 

Additional manuscripts of his ^atpahcdsikd (see 
CESS A 4, 212b-221b): 

Pattan II 10436. 5ff. Copied in Sarn. 1541 = A.D. 
1484. With a tippani. 

Panjab JB I 2664 (Patti 193). 17ff. Copied in Sarn. 

1550 = A.D. 1493. With a Bdldvabodha. 

RORI Cat. IV 19556 (2). Ff. 7-10. Copied by Teja- 
sundara in Sarn. 1602 = A.D. 1545. With a 
Rajasthani BMdvabodha. 

Pattan II 8861. 4ff. Copied in Sam. 1622 = a.d. 
1565. 


220 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Pattan II 8862. 9ff. Copied in Sam. 1629 = a.d. 
1572. With the tika of Bhattotpala.. 

Oxford (Vyasa) 103 I. Ff. l-5v. Copied for Murari, 
the son of Vidyadhara Thakura, on Saturday 13 
kr§napak§a of Caitra in Sam. 1637, Saka 1503 = 
1 April 1581. 

RORI Cat. XVI 34054. 6ff. Copied by Jhanasagara 
Gani at Pahcakadurgarajanipura in Sam. 1640 = 
A.D. 1583. With the fika of Bhatfotpala. 

RORI Cat. IX 28560. 2ff. Copied by Dhanaji at 
Sivapuri in Sarp. 1647 = A.D. 1590. 

Pattan II 12803. lOff. Copied in Sarn. 1658 = a.d. 
1601. With a fippani. 

Oxford (Vyasa) 128. Ff. 2 and 4-<5>. Copied by 
Vasudeva Dave of the Udicyajhati at Vaiika + 
+ + on Monday 7 suklapak^a of Margasir§a in 
Sam. 1694, Saka 1559 = 13 November 1637. 
Incomplete. 

RORI (Jaipur) 5552 (11). Ff. 128-159. Copied by 
Mahesa Vyasa and Sukadeva at Khudadagudha in 
Sarn. 1705 = A.D. 1648. With a Rajasthani tika. 

Oxford CSS I 490 (d. 785 (3)). Ff. 1-17. Copied on 
Wednesday 4 kr§iiapak§a of Pau§a in Sarn. 1706, 
Saka 1571 = 1 January 1651 (?). With the fika 
of Bhattotpala. 

Jodhpur 830 (B). 5ff. (f. 1 missing). Copied by 
Sridhara Purohita in Sarn. 1730 = A.D. 1673. 
Incomplete. 

Jodhpur 830 (A). Ff. 3-5. Copied by Kanaji Puro¬ 
hita in Sarn. 1741 = A.D. 1684. 

BHU C.2721. 16ff. Copied in Sarn. 1746 = A.D. 
1689. With a tika. Incomplete. 

RORI Cat. VII 25620 (29). Ff. 210-224. Copied at 
Valhi in Sarn. 1747 = A.D. 1690. With a 

Rajasthani Balavabodha. 

RORI (Jaipur) 9456 (1). 12ff. (ff. 1-3 missing). Cop¬ 
ied in Sarn. 1749 = a.d. 1692. Incomplete. 

Pattan II 14162. 9ff. Copied in Sarn. 1752 = a.d. 
1695. Ascribed to Bhattotpala. With a Gujarati 
stabaka. 

RORI (Jaipur) 4458. 7ff. Copied by Vijayacandra 
Muni in Sarn. 1752 = A.D. 1695. With a 

Rajasthani stabaka. 

RORI (Bikaner) 15884. 3ff. Copied by Balakr§ria in 
Sarn. 1754 = a.d. 1697. 

Panjab JB I 2661 (Zira 271). 18ff. Copied in Sarn. 
1757 = A.D. 1700. With a Gujarati tika. 

RORI (Chittorgarh) 5247. llff. Copied by Caritravi- 
jaya in Sarn. 1763 = a.d. 1706. With a vrtti. 

RORI (Jaipur) 7735. 5ff. (ff. 1-2 missing). Copied 
by Balakr§ria Dvivedin in Sarn. 1763 = a.d. 
1706. Incomplete. 

RORI Cat. IV 20326. 4ff. Copied by Amara at Jala- 
puri in Sarn. 1764 = a.d. 1707. With the tika of 


Bhattotpala. 

RORI (Chittorgarh) 4725. 14ff. Copied in Sarn. 1766 
= A.D. 1709. With the tika of Bhattotpala. 

RORI Cat. IX 29193. 7ff. Copied by Dayasirnha at 
Pali in Sarn. 1768 = a.d. 1711. With the tika of 
Bhattotpala. 

RORI (Bikaner) 14655. Ff. 1-9. Copied on 9 sukla- 
pak§a of Magha in Sarn. 1780 = ca. 23 January 
1724. With the tika of Bhattotpala and a 
Rajasthani Balavabodha. 

Pattan II 12948. 9ff. Copied in Sarn. 1781 = a.d. 
1724. Ascribed to Bhattotpala. With a Gujarati 
Balavabodha. 

VSM (Upadhye) 12756. Ff. 1-2 and 11-29. Copied 
by Ramacanda in Saka 1651 = a.d. 1729. With 
the tika of Bhattotpala. Incomplete. 

Panjab JB I 2663 (Patti 290). 14ff. Copied in Sarn. 
1789 = a.d. 1732. With the tika of Bhattotpala. 

Nagaur 1070. 7ff. Copied on 2 krsriapaksa of Phal- 
guna in Sarn. 1790 = ca. 10 March 1734. 
Ascribed to Varahamihira. 

RORI Cat. VI 23865. 20ff. Copied in Sarn. 1792 = 
A.D. 1735. 

RORI Cat. VII 25261. 6ff. Copied by Devakrsiia 
Josi at Medata in Sarn. 1795 = a.d. 1738. 

Delhi Jaina (Dharmapura) 430 (Gutaka 30). 63ff. 
Copied in Sarn. 1796 = a.d. 1739. With a tika. 

RORI (Udaipur) 572. 2ff. Copied by Jayaraja Muni 
in Sarn. 1797 = A.D. 1740. 

PrSB 3623 (Berlin or. oct. 882). 18ff. Copied' on 8 
suklapaksa of Phalguna in Sarn. 1799 = ca. 20 
February 1743. With the tika of Bhattotpala. 

RORI (Jaipur) 2782. 8ff. Copied by Narajanaraya in 
Sarn. 1800 = a.d. 1743. 

RORI (Udaipur) 3856 (38). Ff. 124-128. Copied in 
Sarn. 1800 = a.d. 1743. 

RORI Cat. VII 26173. 3ff. Copied by Kisana at Ba- 
halava in Sarn. 1801 = a.d. 1744. 

RORI Cat. VI 24120 (2). Ff. 6-8. Copied by Siva- 
varddhana in Sarn. 1808 = a.d. 1751. 

RORI (Bikaner) 14648. 23ff. Copied in Sarn. 1808 
= A.D. 1751. With the tika of Bhattotpala. 

RORI (Chittorgarh) 1657. 9ff. Copied in Sarn. 1810 
= A.D. 1753. With the tika of Bhattotpala. 

Vrndavana 3618. 33ff. Copied on Wednesday 4 
kr§iiapak§a of A^adha in Sarn. 1820 = 18 July 

1764. With the tika of Bhattotpala. 

Jodhpur 832. 24ff. Copied in Sarn. 1822 = A.D. 

1765. With a Rajasthani tika. 

RORI (Chittorgarh) 2955. 18ff. Copied in Sarn. 1824 
= A.D. 1767. 

Oxford (Vyasa) 126. Ff. 1-6. Copied by Devesvara, 
the son of Jetha Acarya, on Friday 13 sukla- 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


221 


pak§a of Sravana in Sam. 1828, Saka 1693 = 23 
August 1771. With a fika in bha§a. Formerly 
property of Prabhurama Acarya. 

RORI (Chittorgarh) 2587. 5ff. Copied by Harisaii- 
kara Vyasa in Sarn. 1828 = a.d. 1771. 

RORI Cat. XVI 34291. 3ff. Copied in Sam. 1830 = 
A.D. 1773. 

RORI (Chittorgarh) 2110. 14ff. Copied in Sam. 1833 
= A.D. 1776. With a Rajasthani stabaka. 

RORI Cat. IV 19848. 22ff. Copied in Sam. 1835 = 
A.D. 1778. With a Rajasthani Balavabodha. 

WHMRL N.119. Ff. 1-6. Copied by Kesaricandra, 
the pupil of Jasakarnaji, through the favor of 
Haracandraji, at Curunagara in the kr§napak§a 
of Sravana in Sarn. 1839, Saka 1704 = ca. 23 
August-6 September 1782. 

Varendra 283. Ff. 1-11. Bengali. Copied by Nanda- 
kumaradeva Sarman on 3 Pau§a Saka 1707 = ca. 
3 January 1786. With a tika. 

RORI (Chittorgarh) 2958. 5ff. Copied in Sarn. 1843 
= A.D. 1786. 

RORI (Jaipur) 2934. 8ff. Copied by Dinanatha 
Vyasa at Jayapura in Sarn. 1843 = a.d. 1786. 

RORI (Jaipur) 5406. 2ff. Copied in Sarn. 1846 = 
A.D. 1789. 

Oxford (Vyasa) 127. Ff. 1-13. Copied by Sivasaii- 
kara Prabhuji Vyasa on Monday 1 kr^napaksa of 
Karttika in Sarn. 1847, Saka 1712 = 22 Novem¬ 
ber 1790. 

RORI (Jaipur) 11091. 8ff. (f. 1 missing). Copied by 
Lak§micanda in Sarn. 1847 = a.d. 1790. Incom¬ 
plete. 

PrSB 3622 (Berlin or. fol. 1652). 14ff. Copied by 
Sevagarama on Saturday 3 kr§napaksa of 
Sravana in Sarn. 1849 = 4 August 1792. With the 
tika of Bhattotpala. 

Panjab JB I 2662 (Zira 272). 17ff. Copied in Sarn. 
1850 = A.D. 1793. With a Gujarati tika. 

RORI (Jaipur) 10117. 43ff. (f. 1 missing). Copied by 
Sivalala Brahmana in Sarn. 1850 = a.d. 1793. 
With a Matrkasakundvali and a Samanyajyotisa. 

RORI (Chittorgarh) 2575. 5ff. Copied by Gahga- 
visnu at Vi§adharapura in Sarn. 1852 = a.d. 
1795. 

RORI (Jaipur) 5509. 24ff. Copied in Sam. 1854 = 
A.D. 1797. With the tika of Bhattotpala. 

Vrndavana 2761. 4ff. Copied in Sarn. 1854 = a.d. 
1797. 

RORI (Bikaner) 17224. 7ff. Copied by Nagaraja at 
Udayapura in Sam. 1859 = a.d. 1802. With a 
Rajasthani stabaka. 

RORI Cat. IV 20250. 12ff. Copied by Kirttimala in 
Sarn. 1861 = a.d. 1804. With the Rajasthani sta¬ 
baka of Kirttimala. 


Oxford CSS I 491 (*c. 315 (3)). Ff. 1-11. Copied by 
Gaiigadhara Visvarupa at Amaradurga on Wed¬ 
nesday 2 kr§napak§a of Caitra in Sam. 1863 = 
22 April 1807. With the tika of Bhattotpala. 

RORI Cat. XVI 35513. 25ff. Copied in Sam. 1864 = 
A.D. 1807. 

Oxford CSS I 492 (*c. 316 (2)). Ff. 1-17. Copied by 
Sivanatha Bhatta at Gokula on Wednesday 13 
kr§napak§a of Vaisakha in Sarn. 1866, Saka 1731 
= 10 May 1809. With the tika of Bhattotpala. 

RORI (Jaipur) 2864. 7ff. Copied in Sarn. 1869 = 
A.D. 1812. 

RORI (Jaipur) 9665. 9ff. Copied in Sam. 1869 = 
A.D. 1812. 

BHU C.3279. 20ff. Copied in Sarn. 1870 = A.D. 

1813. Ascribed to Varahamihira. 

RORI (Chittorgarh) 2315. 6ff. Copied by 
Jivanacanda at Vikramapura in Sarn. 1870 = 
A.D. 1813. 

Pattan II 4257. Off. Copied in Sam. 1871 = a.d. 

1814. With a Gujarati stabaka. 

RORI Cat. IX 29861. llff. Copied by Rddhiharnsa at 
Udayapura in Sarn. 1872 = a.d. 1815. With a 
Rajasthani Balavabodha. 

RORI (Chittorgarh) 4755. 7ff. Copied by Manarupa- 
vijaya at Sthanapura in Sam. 1872 = a.d. 1815. 
With a Rajasthani stabaka. 

RORI (Jaipur) 2881. 8ff. Copied by Ananda Bhatta 
in Sarn. 1873 = a.d. 1816. 

RORI Cat. IV 22022. 2ff. Copied in Sam. 1875 = 
A.D. 1818. Ascribed to Bhattotpala. 

RORI (Chittorgarh) 2346. 6ff. Copied by Kusala- 
sundara in Sarn. 1875 = A.D. 1818. 

RORI (Jaipur) 8257. 6ff. Copied in Sam. 1876 = 
A.D. 1819. 

Nagaur 1073. 27ff. Copied on Wednesday 15 sukla- 
pak§a of Caitra in Sam. 1877 = 29 March 1820. 
Ascribed to Varahamihira. With the ilka of 
Bhattotpala. 

RORI (Jaipur) 5079. I3ff. Copied in Sam. 1878 = 
A.D. 1821. 

BHU C.1361. 4ff. Copied in Sam. 1880 = a.d. 1823. 
Incomplete. Ascribed to Varahamihira. 

RORI Cat. IV 19694. 4ff. Copied by ROpasundara at 
Pipada in Sarn. 1881 = a.d. 1824. 

Nagaur 1067. 13ff. Copied on Thursday 5 krsna- 
pak§a of Sravana in Sam. 1885 = 28 August 
1828. 

RORI (Jaipur) 9910 (2). Ff. 3-4. Copied in Sam. 
1886 = A.D. 1829. No author mentioned. 

GJRI 8703/928. Ff. 1-4. Maithili. Copied by Soma- 
datta on 4 kr§napak§a of Phalguna in Saka 1752 
= ca. 1 March 1831. 


222 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


BHU C.3557. 4ff. Copied in Sam. 1890 = a.d. 1833. 
(Kalajhanaprasna). With the tika of Bhattot- 
pala. 

RORI Cat. IX 28517. 2ff. Copied at Bikanera in 
Sam. 1890 = a.d. 1833. 

RORI (Chittorgarh) 748. 19ff. Copied by Biharilala 
Srimali at Khareti (Nagora) in Sam. 1890 = 
A.D. 1833. With the fika of Bhaffotpala. 

RORI (Chittorgarh) 2597. 8ff. Copied by 
JIvanacanda at Pitambari in Sam. 1893 = a.d. 
1836. 

BHU B.690. 15ff. Copied in Sam. 1895 = a.d. 1838. 
With a tika. 

BHU C.4789. 27ff. Copied in Sam. 1906 = a.d. 
1849. With the lika of Bhaffotpala. 

RORI (Chittorgarh) 2647. 14ff. Copied by Sukla- 
canda at Pitambari in Sam. 1906 = a.d. 1849. 
With a Rajasthani stabaka. 

Udaipur RVSS 846. 8ff. Copied by VakaramOlaJi in 
Sarn. 1906 = a.d. 1849. With a Gujarati fika. 

GJRI 11714/1252. Ff. 1-6. Copied in Saka (read 
Sam.) 1908 = a.d. 1851. 

RORI (Alwar) 6198. 16ff. Copied by Devadatta Sar- 
man in Sarn. 1908 = A.D. 1851. With the tika of 
Bhatfotpala. 

VSM (Upadhye) 12750. 4ff. Copied in Saka 1773 = 
A.D. 1851. 

RORI (Alwar) 2851. 20ff. Copied by Nirbhayarama 
in Sam. 1910 = A.D. 1853. With the fika of 
Bhattotpala. 

RORI (Jaipur) 10643. 5ff. Copied in Sam. 1914 = 
A.D. 1857. 

GJRI 8702/927. Ff. 1-6. Maithili. Copied in Saka 
1781 = A.D. 1859. 

RORI (Jaipur) 2393. 5ff. Copied in Sam. 1916 = 
A.D. 1859. 

*WHMRL G.5.C. Ff. 1-24. Ff. 23-24 copied by 
Vrndavana on Sunday 3 suklapak§a of A^adha in 
Sam. 1916 = 3 July 1859. With the tika of 
Bhattotpala. 

RORI (Alwar) 6202. 6ff. Copied in Sarn. 1921 = 
A.D. 1864. With the tika of Bhattotpala. Incom¬ 
plete. 

RORI Cat. IX 29118. 17ff. Copied by Ramakarnvara 
at Chavani in Sarn. 1926 = A.D. 1869. With the 
tika of Bhattotpala. 

RORI (Alwar) 5581. 12ff. Copied by Premadasa 
Mahanta in Sarn. 1928 = a.d. 1871. With the 
tika of Bhattotpala. 

GJRI 9706/1016. Ff. 1-21 and 2ff. Copied in Sam. 
1938 = A.D. 1881. With the tika of Badrilala. 

RORI (Alwar) 5468 (5). Ff. 11-27. Copied in Sarp. 
1942 = A.D. 1885. With the tika of Bhattotpala. 

AS Bengal 7191. (G.7001) II. 5ff. Incomplete. 


BHU B.692. 7ff. With a tika. Incomplete. 

BHU B.693. 2ff. Incomplete. 

BHU B.4244. 17ff. With a tika. 

BHU C.463. 20ff. Sarada. With a tika. 

BHU C.1601. 8ff. 

BHU C.2892. 2ff. With a tika. Incomplete. 

BHU C.4321. 14ff. Sarada. With a tika. Incomplete. 

Delhi Jaina (Dharmapura) 431 (No. 19). 5ff. With a 
tippana. 

GJRI 11168/1222. Ff. 1-3. Maithili. 

GJRI 11169/1223. Ff. 5-9. Incomplete. 

GJRI 11170/1224. Ff. 1-5. 

GJRI 11171/1225. Ff. 1-8. Maithili. With the tika 
of Bhattotpala. Incomplete. 

Harvard Indie 2389. F. 1. Incomplete (ends in 7c). 

IM Calcutta 8967 B. See NCC, vol. 12, p. 190. 

*Jaipur (Khasmohor) 5131; 5134; 5419; 5585; and 
5602 (1). 

Jodhpur 829. 5ff. With a Rajasthani tippani. 
Incomplete. 

Kathmandu (1965) 166 (4070). 20ff. With the 
Bhuvanadlpaka of Padmaprabha Suri. 

Mysore (1905) 590. 13pp. Telugu. 

Mysore ORI C.2840/1. Ff. 1-19. 

Mysore ORI C.4694/13. Ff. 1-6. 

Mysore ORI C.4714/30. If. Kannada. Incomplete. 

Mysore ORI P.212/10. Ff. 123-124. Nandinagari. 

Mysore ORI *P.852/4. Ff. 18-43. Grantha. 

Mysore ORI P.3771/5. Ff. 67-73. Grantha. 

Mysore ORI P.4542/15. Ff. 33-45. Telugu. Incom¬ 
plete. 

Mysore ORI P.5217/1. Ff. 1-24. Telugu. 

Mysore ORI P.5637/A. Ff. 1-24. Grantha. Incom¬ 
plete. 

Mysore ORI P.6172/5. Ff. 13-16. Grantha. 

Mysore ORI P.6341/2. Ff. 1-4. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.7415/8. Ff. 36-40. Telugu. Incom¬ 
plete. 

Mysore ORI P.7415/9. Ff. 41-42. Telugu. Incom¬ 
plete. 

Mysore ORI P.7449/1. Ff. 1-22. Telugu. 

Mysore ORI P.7913/25. Ff. 1-5. Nandinagari. 

Mysore ORI P.8078/7a. Ff. 92-106. Nandinagari. 

Mysore ORI P.8078/8a. F. 107. Nandinagari. Incom¬ 
plete. 

Mysore ORI P.8407/1. Ff. 1-11. Kannada. Incom¬ 
plete. 

Mysore ORI P.8431/2. Ff. 132-141. Grantha. 

Mysore ORI P.9274/19. 4ff. Telugu. 

Mysore ORI P.9347/1. Ff. 25-33. Grantha. 

Mysore ORI P.9881/12. Ff. 1-5. Nandinagari. 
Incomplete. 

Mysore ORI P.9942/9c. Ff. 143-146. Telugu. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


223 


Mysore ORI P.I027I/I2. Ff. 61-68. Nandinagari. 

Nagaur 1065. 2ff. Ascribed to Bhattotpala. 

Nagaur 1066. 2ff. Ascribed to Bhattotpala. 

Nagaur 1068. 7ff. Ascribed to Bhattotpala. 

Nagaur 1069. 6ff. Ascribed to Bhattotpala. 

Nagaur 1071. 4ff. Ascribed to Varahamihira. 

Nagaur 1072. 12ff. With a tika- 

Oxford CSS I 493 (*d. 750 (4)). Ff. 1-4. 

Oxford (Vyasa) 129. F. 2. Incomplete (verses 
11-24). 

Panjab JB I 2657 (Patti 26). 4ff. 

Panjab JB I 2658 (Ambala 739). 6ff. With a tabba. 

Panjab JB I 2659 (Nakodar 99). 3ff. 

Panjab JB I 2660 (Zira 363). 12ff. With a tika. 

Pattan II 2764. 3ff. 

Pattan II 2765. 4ff. With an avacuri. 

Pattan II 2766. 3ff. With a vrtti. 

Pattan II 8858. 2ff. 

Pattan II 8859. 2ff. 

Pattan II 8860. 3ff. 

Pattan II 8863. 7ff. With a Gujarati Balavabodha. 

Pattan II 10103. 3ff. 

Pattan II 10222. 14ff. With the tika of Bhattotpala. 

Pattan II 12433. 3ff. 

Pattan II 12531. 6ff. With a GujarMi stabaka. 

Pattan II 14314. 9ff. With a Gujarati Balavabodha. 
Incomplete. 

PrSB 2954 (Berlin or. 6323). Ff. 104-107v. Grantha. 

RORI Cat. IV 18264. 9ff. (f. 8 missing). 

RORI Cat. IV 19745. 6ff. With a tika. 

RORI Cat. V 22638. lOff. With the tika of Bhattot¬ 
pala. 

RORI Cat. VI 24127. 20ff. Copied by Dipacanda at 
Rajapura. With a Balavabodha in Old Hindi. 

RORI Cat. VII 25620 (6). Ff. 88-93. With a 

Rajasthani Balavabodha composed in Sarn. 1744 
= A.D. 1687. 

RORI Cat. IX 29027. 5ff. With a Rajasthani 

Balavabodha. 

RORI Cat. IX 29257. 32ff. With the tika of Bhat¬ 
totpala. 

RORI Cat. IX 29728 (2). Ff. 9-13. With a 

Rajasthani tika. Incomplete. 

RORI Cat. IX 29891. 7ff. 

RORI Cat. XVI 35333. Ff. 2-6. With the tika of 
Bhattotpala. Incomplete. 

RORI Cat. XVI 37457 (2). Ff. 1-6. With a 

Rajasthani vivarana. 

RORI (Alwar) 2850. 20ff. With the tika of Bhattot¬ 
pala. 

RORI (Bikaner) 14631. 18ff. No author mentioned. 
With the Bhuvanadipaka of Padmaprabha Suri. 

RORI (Bikaner) 14647. 6ff. With the tika of Bhat¬ 
totpala. 


RORI (Bikaner) 14649. 6ff. With the tika of Bhat¬ 
totpala. 

RORI (Bikaner) 14670. 5ff. With a Rajasthani sta¬ 
baka. 

RORI (Bikaner) 14673. 4ff. 

RORI (Bikaner) 15885. 13ff. Copied by Bhuvanavi- 
sala. With the tika of Bhattotpala; and with a 
Prasnasloka on ff. 12-13. 

RORI (Bikaner) 17332. lOff. With the tika of Bhat¬ 
totpala. 

RORI (Bikaner) 17381. 4ff. Copied by Saradharma 
Gani. With the tika of Bhattotpala. 

RORI (Bikaner) 17383. 21ff. With the tika of Bhat¬ 
totpala. 

RORI (Chittorgarh) 1400. lOff. With a stabaka. 

RORI (Chittorgarh) 1540. 9ff. 

RORI (Chittorgarh) 1647. 12ff. 

RORI (Chittorgarh) 1781. 3ff. Copied by Saka- 
lakirti. With a Rajasthani stabaka. 

RORI (Chittorgarh) 2343. llff. (f. 1 missing). With 
a vrtti. 

RORI (Chittorgarh) 2574. 2ff. 

RORI (Chittorgarh) 2624. 5ff. 

RORI (Chittorgarh) 2656. 4ff. 

RORI (Chittorgarh) 2780. 5ff. Copied by Phatecan- 
dra. 

RORI (Chittorgarh) 2969. 3ff. 

RORI (Chittorgarh) 5248. 4ff. With the stabaka of 
Narendrasagara. 

RORI (Jaipur) 3385. 6ff. 

RORI (Jaipur) 3981. 5ff. 

RORI (Jaipur) 4466. 8ff. With a Rajasthani stabaka. 
Incomplete. 

RORI (Jaipur) 5270. 3ff. Copied by Nityasaubhagya. 
With a tika. 

RORI (Jaipur) 5275. 45ff. Incomplete. With a 
Jdtakapaddhati and a Laksmisuktddi. 

RORI (Jaipur) 5445. 2ff. 

RORI (Jaipur) 5525. 7ff. Copied by Tejarama 
Sadananda. With a tippana. 

RORI (Jaipur) 7795. 8ff. (ff. 5-6 missing). With a 
Rajasthani fika. Incomplete. 

RORI (Jaipur) 8022. 4ff. (f. 1 missing). With the 
tika of Bhattotpala. Incomplete. 

RORI (Jaipur) 8716. 3ff. 

RORI (Jaipur) 8717. 3ff. 

RORI (Jaipur) 9355. 7ff. 

RORI (Jaipur) 9479 (1). 19ff. (ff. 1-9 missing). Cop¬ 
ied by Lak§midasa. With a Rajasthani tika. 
Incomplete. 

RORI (Jaipur) 9884 (2). Ff. 2-5. Incomplete. 

RORI (Jaipur) 10441. 5ff. With a stabaka. 

RORI (Jaipur) 10841. 8ff. 


224 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


*RORI (Udaipur) 571. 15ff. With a Rajasthani tika. 
Incomplete. 

*RORI (Udaipur) 1711. 4ff. Copied at Udayapura. 
RORI (Udaipur) 4868. Ff. 1-13. With the tika of 
Bhattotpala. Incomplete. 

RORI (Udaipur) 4913. Ff. 1-12. With a tika. 
Incomplete. 

RORI (Udaipur) 6093. 5ff. With a stabaka. 

RORI (Udaipur) 6111. 2Iff. (ff. 2-5 and 17 miss¬ 
ing). Incomplete. 

RORI (Udaipur) 6204. 5ff. With a bha$atika. 
Incomplete. 

RORI (Udaipur) 6225. 25ff. With a tika. Incom¬ 
plete. 

Udaipur RVSS 2177. 3ff. Incomplete. No author 
mentioned. 

Vrndavana 6062. 8ff. Incomplete. 

Vrndavana 6631. 20ff. With the tika of Bhattot- 
pala. 

Vrndavana 9453. 14ff. With a tika. 

Vrndavana 9813. 4ff. (f. 2 missing). Incomplete. 
WHMRL 7 13. F.lObv. With an interlinear gloss in 
bha§a. Incomplete (ends in 1, 4c). 

WHMRL 7 241. Ff. 1-21. With the tika of Bhaf- 
totpala. Incomplete (ends in 7, 3). 

Additional information concerning the 
manuscript of the Samaravijayodaya = Safigramavi- 
jayodaya attributed to him (see CESS A 4, 221b): 

Mysore ORI *P. 1726/1. Ff. 1-50. Telugu. Incom¬ 
plete. 


*CATURVEDA PRTHUDAKASVAMIN (fl. 864) 

1. Additional manuscript of his Vasandbhd^ya (see 
CESS A 4, 221b-222a; see also D. Pingree [A5. 
1976] and [A5. 1983]): 

RORI Cat. XVI 35182. Ff. 2-14, 19-48, 48b-124, 
and 2ff. Incomplete (I 4-II 68; XV 1-9; and III 
1-X 64). Perhaps a copy of *BORI 339 of 
1879/80. 

2. Additional manuscript of his Khandakhddyakavi- 
varana (see CESS A 4, 222a): 

BHU C.326. 129ff. Sarada. 


PRTHVIRAJA DVIVEDIN {fl. 1913) 

An astrologer residing in Balotara, Jila Bada- 
mera, Rajasthana, and the author of pahcahgas fol¬ 
lowing the Brahmapak§a, Prthviraja wrote a K^a- 
yddhimdsanirnaya that was corrected and published 
by Bhavanisaiikara Prthviraja Dvivedin (b. 21 Janu¬ 
ary 1913) at Balotara in 1977. 

^PEDDANARYA 

Additional information concerning the 
manuscript of his Pancangaghantdpatha (see CESS 
A 4, 222b): 

Mysore ORI *P.4771/7. Ff. 75-77. Nandinagari. 

^PAULISA (fl. third or fourth century) 

Concerning his Paulisasiddhdnta (see CESS A 4, 
223a) see also T. S. Kuppana Sastry [A5. 1979]. 

*PRAJAPATIDASA 

1. Additional manuscripts of his Pancasvardnirnaya 
(see CESS A 4, 223b-225a): 

GJRI 11704/1242. Ff. 1-8. Maithili. Copied in Sal. 

San 1197 = a.d. 1789. No author mentioned. 
Vrndavana 102. lOff. Bengali. Copied by Nrsimha- 
deva Sarman at Radharamanapura in Sam. 1876 
= A.D. 1819. 

Oxford CSS I 193 (*d. 783 (8)). Ff. 1-9. Copied on 
Friday 3 kr§napaksa of Asvina in Sarn. 1892 = 6 
November 1835. 

BHU C.2848. If. Copied in Sam. 1896 = a.d. 1839. 
Incomplete. 

BHU C.5421. If. Copied in Sam. 1896 = a.d. 1839. 
Incomplete. 

RORI (Alwar) 2979. 9ff. Copied in Sarn. 1908 = 
A.D. 1851. With the tika of Paramasukha. 

RORI Cat. IV 21957. 9ff. Copied by Balananda in 
Sam. 1916 = a.d. 1859. 

Oxford CSS I 194 (*d. 776 (2)). Ff. 1-13. Copied in 
Sam. 1919 = a.d. 1862. 

Bhubaneswar IV 152 (Jy/128). 5ff. Oriya. Copied by 
Trilocana Misra in Sal. San 1288 = a.d. 1880. 
Incomplete. From Midnapur, West Bengal. 

GJRI 8500/725. Ff. 1-3. Maithili. Copied in Saka 
1806, Sal. San 1291 = a.d. 1883/1884. 



CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


225 


Bhubaneswar IV 30 (Jy/130). 68ff. Oriya. Copied by 
Sudarsana for his adhyapaka, Gad^hara Deva- 
sarman, on 6 kr§napak§a of Mina in Sal. San 
1304 = ca. 22 March 1897. 

Oxford CSS I 195 (*c. 393 (2) B). a Ff. 1-25. Ben¬ 
gali. Copied on 8/2/12 = ca. 3 June 1906. With a 
vyakhya. Incomplete. 

RORI Cat. XVI 36591 (1). 9ff. Copied in Sam. 1967 
= A.D. 1910. 

RORI Cat. XVI 36591 (2). 28ff. Copied in Sam. 
1967 = A.D. 1910. With his own tika. 

AS Bengal III.E.134. Bengali. 

BHU B.4247. 21ff. 

BHU B.4248. 7ff. 

BHU C.857. 9ff. 

BHU C.1698. llff. 

BHU C.3213. 3ff. Incomplete. 

BHU C.3555. 16ff. Incomplete. 

Bhubaneswar 2.Dh/292 B. (Granthasahgraha). 

Bhubaneswar IV 93 (Jy/116). 75ff. Oriya. Incom¬ 
plete. From Dharmasala, Cuttack District. 

Bhubaneswar IV 94 (Jy/26c). lOff. Oriya. Incom¬ 
plete. From Jagatsirnhapur, Cuttack District. 

Bhubaneswar IV 168 (Jy/122). 48ff. Oriya. Incom¬ 
plete. From Midnapur, West Bengal. 

GJRI 8291/516. Ff. 116v-126. Maithili. (Grantha¬ 
sahgraha). 

GJRI 8293/518. Ff. 1-21. Maithili. (Granthasahgra¬ 
ha). 

GJRI 8294/519. Ff. 1-12. Maithili. (Granthasahgra¬ 
ha). Incomplete. 

GJRI 8295/520. 2ff. Maithili. (Granthasahgraha). 
Incomplete. 

GJRI 8499/724. Ff. 1-3. Maithili. Incomplete. 

GJRI 8501/726. Ff. 1-12. Maithili. 

GJRI 8502/727. Ff. 3-6v. Maithili. Incomplete. 

GJRI 8504/729. Ff. 1-15. Maithili. 

GJRI 8505/730. Ff. 1-7. Maithili. 

GJRI 11700/1238. Ff. 1-2. (Jyotisagranthanirnaya). 
Incomplete. 

Kathmandu (1965) 119 (7390). 15ff. 

Kathmandu (1965) 120 (7385). 3ff. Incomplete. 

New Delhi, H. B. Fall 75. llff. Incomplete. 

Oxford CSS I 196 (*d. 776 (1)). Ff. 1-21. With the 
tika of Appayya Dik§ita. 

Oxford CSS I 197 (*d. 782 (7)). Ff. 1-16. 

Oxford CSS I 198 (d. 924 (1)). Ff. 1-6. Bengali. 
With a tika. Incomplete (verse 86 to end of adh- 
yaya 6). 

Oxford CSS I 199 (*d. 924 (2)). Ff. 1-22. Bengali. 

RORI Cat. XVI 37383. 32ff. 

RORI (Alwar) 2978. 28ff. With the tika of Appayya 
Dik§ita. 

RORI (Alwar) 2980 = *Alwar 1831. llff. (ff. 1-2 


missing). With the tika of Gauda Bhattacarya. 
Incomplete. 

Vrndavana 8445. 19ff. With a tika. Incomplete. 
Vrndavana 8446. 13ff. 

The Pahcasvaranirr^aya with the tika, Subo- 
dhint, of Kr§nadatta Jha was published at KaU in 
Sarn. 1961, Saka 1826 = a.d. 1904; and with a 
Hindi tika, Kantimatl, by Nagendra Pandeya, 
Varanasi 1984. 

2. Additional mansucripts of his Pahcasvaranirna- 
yaGika (see CESS A 4, 225a-225b): 

Kathmandu (1965) 122 (7402). 20ff. Copied on 
Tuesday 11 suklapak§a of Caitra in Sam. 1856, 
Saka 1721 = 16 April 1799. Incomplete. 

RORI Cat. XVI 36591 (2). 28ff. Copied in Sam. 

1967 = A.D. 1910. 

AS Bengal 7031 (G.4587). Extra f. 

Kathmandu (1965) 121 (7383). 22ff. 

Kathmandu (1965) 123 (7433). 9ff. Incomplete. 


*PRATAPARUDRA GANAPATl (fl. 1497/1540) 

The real author of the Pratapamartanda (see 
CESS A 4, 226a) is apparently Ramakrsna (fl. ca. 
1500). 


PRABHAKARA 

Collaborator in a Vamphlnala on ganita. Manu¬ 
script: 

Bhubaneswar IV ganita 57 (G/40) = Bhubaneswar 
2.G/40. 50ff. Oriya. Incomplete. From Bhubanes¬ 
war, Puri District. 


^PRABHANANDA SURI (fl. 1333) 

Additional manuscripts of his Jambudvlpa- 
sahgrahanivrtti (see CESS A 4, 227a-227b): 

Pattan II 4516. 5ff. Copied in Sarn. 1837 = a.d. 
1780. 

Pattan II 965. 14ff. 

Pattan II 1499. 15ff. 

Pattan II 4515. 15ff. 


226 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


PRABHUDEVA 

Author of a Kalajhana in Kannada. Manuscript: 
Mysore ORI A.47/35. Ff. 149-151. Telugu. 


PRABHVRAMA 

The son of Kasirama, Prabhurama wrote a 
Bhugolasara at Cittapurnanagara. Manuscript: 

RORI (Udaipur) 3046. 6ff. Incomplete. 


PRAVACANATHAKA 

Author of a Suryamandala in Hindi and 
Rajasthani. Manuscript: 

Prayaga 3863. 9pp. Copied by Jitamala in Sarn. 1846 
= A.D. 1789. Acquired from Candrakurnvari of 
Jodhapura, Rajasthana. 

*PRASASTADHARA (fl. 958) 

Additional manuscript of his Laghumdnasaitkd 
(see CESS A 4, 227b-228a): 

Mysore (1905) 793. 91pp. Grantha. 


*PRANADHARA MISRA 

Additional manuscripts of his Jdtakacandrikd 
(see CESS A 4, 228b-229a): 

GJRI 8335/560. Ff. 1-6. Maithili. Copied in Saka 
1802 = A.D. 1880. 

GJRI 8334/559. Ff. 1-14. 

GJRI 8336/561. Ff. 1-2 and 4-31. Incomplete. 

GJRI 8337/562. Ff. 1-9. Maithili. 

GJRI 8338/563. Ff. 1-14. Maithili. 

GJRI 8339/564. Ff. 1-21. Maithili. 


*PREMA (fl. 1656) 

Additional manuscript of his Grahaldghavasdrinl 
(see CESS A 4, 229a-229b): 

BHU B.2853. 98ff. 


PREMANIDHI 

The son of Indrapati Thakkura, a Maithila whose 
ancestors came from Mahi§mati in the territory of 
the Nijamasaha, Premanidhi wrote a Dharmddhar- 
maprabodhini = Dharmabodhinl. Manuscripts: 

Mitra, Not. 1999. 157ff. Maithili. Copied on Friday 
6 suklapak^a of Margasir^a in Sarn. 1410 (the 
date is both irregular and historically impossible). 
Property of Pandita Varnsamani Jha of Navani, 
Madhopura, Darbhahga. 

Mithila I 239. 90ff. Maithili. Copied by Harivasara 
on 11 suklapaksa of Margasirsa in Sarn. 18/2 
(read 1802), Saka 1788 (read 1677) = ca. 14 
December 1756 (?). Ascribed to the son of 
Ramapati. Property of Pandita Gonu Misra of 
Lalaganj, Jhanjharpur, Darbhanga. 

CP, Hiralal 2375. Ascribed to Mahesa. Property of 
Haldhar Sastri of Raipur. 

CP, Hiralal 2376. Property of Visvambharnath of 
Ratanpur, Bilaspur District. 

CP, Hiralal 2377. Property of Janaknandan of Pul- 
cur, Bhandara District. 

CP, Hiralal 2378. Property of Narottam Ojha of 
Kawardha. 

CP, Hiralal 2379. Property of MannQlal of Drug. 

CP, Hiralal 2380. Property of Kasidatt Jha of Khai- 
ragarh. 

At the end are the verses: 

manvadismrtim alokya yajnavalkyam tathaiva ca / 
srimatpremanidhir dhiman akarod dharma- 
bodhinim // 

srimadrajanijamasahavi§aye mahi^mati ya puri / 
sa me purvaJavasabhQs ca satatarn devo ’pi yarn 
vanchati // 

srimanmaithilathakkurendrapatijo yatnena drstva 
smrtim / 

karyakaryavicaranartham akarod devopakanthe 
vasan // 

The colophon begins: iti mahamahopadhyayasaftha- 
kkurasrimadindrapatisunusripremanidhiviracite. 


^'PREMANIDHI PANTHA (/?. 1741) 

The son of Uddyotamati and Umapati of the 
Panthakula, Premanidhi, who was born in Kurma- 
cala, completed his Jagatpremodaya at Kasi on Sun¬ 
day 1 suklapaksa of Pau§a in Saka 1633 = 27 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


227 


December 1741. He is probably identical with the 
Premanidhi Panta who is the author of a Sama- 
yarama (see CESS A 4, 229b). Manuscripts: 

Benares (1956) 13547. Ff. 1-54; 1-82; 1-87; 1-173; 

and 1-104. Copied in Sarn. 1834 = a.d. 1777. 

AS Bengal 2093 (G.5468). 39ff; and 69ff. Incomplete 
(prayascitta). 

At the end are the verses: 

yasyoddyotamati satigunavati mata pitomapatir 
nama premanidhiti panthakulabhuh kurmacale 
janmabhuh / 

supasyarn krtaviryajacyutapadarn kasyarn sthitih + 

+ + 

yasminn rtvig ihak§isahkhya udayah premodayo 
’smin gatah // 

sake ’gnyahgak§mape sitaravigapau^apratipadi 
prabhoh premapraptya dvijatanubhuva prema- 
nidhina / 

jagadrajapremodayasamabhivrddhyai vilikhito 
jagadrajapremodaya udaya eso ’k§imitikah // 

PHAKIRA OJHA 

Collaborator in composing a Ganita. Manuscript: 

Bhubaneswar IV ganita 18 (G/20). lOOff. Oriya. 
From Ranapur, Puri District. 


^PHATEHASIMHA {fl. 1750/1757) 

Besides the Matacandrika (see CESS A 4, 230b), 
Phatehasirnha wrote a Gunaprakasa in Hindi in 
Sarn. 1807 = A.D. 1750. Manuscripts: 

NPS 48 B of 1920-22. Copied in Sam. 1898 = A.D. 
1841. Property of Pandita Mataprasada Dube of 
Phaiapura, Ilahabada. 

NPS 31 B of 1906-08. Property of Lala Devidina of 
Ajayagadha. 

^BACANAPRASADA TRIPATHIN {fl. ca. 
1960/1980) 

Author also (see CESS A 4, 231a) of a Hindi 
Ramala divakara kl kuhji published at Varanasi [N. 
D.] and of a Hindi Ramala sastra, of which the 5th 
ed. was published at Varanasi in 1966. 


^BADRILALA 

Additional manuscript of his ^aipahcdsikdlika 
(see CESS A 4, 231b): 

GJRI 9706/1016. Ff. 1-21 and 2ff. Copied in Sam. 
1938 = A.D. 1881. 


BANARASlDASA 

Author of two works in bhasa. 

1. Tithisodash Manuscript: 

Jaipur (Khasmohor) 1396 (25). 

2. Purusalaksana. Manuscript: 

Jaipur (Khasmohor) 1396 (53). 

BABBA SURI (fl. ca. 1100/1150) 

Author of a PancdhgasMhana that was the origi¬ 
nal upon which Ramakrsna (fl. 1264) based his 
Karapahcahga. He is also cited by Bhaskara (b. 
1114) in 6, 2 and 10, 1 of his Karanakutuhala 
(1183). 

^BALADEVAPRASADA MISRA (fl. 1897/1929) 

His Hindi tika on the Yantracintamani of 
Damodara (see CESS A 4, 232b) was reprinted at 
Kalyana-Bambai in 1983. His Hindi anuvada of the 
Brhatsamhitd of Varahamihira (fl. ca. 550) was 
reprinted at Bambai in 1987. 


BALABHADRA 

Author of a Kdladlpika. Manuscript: 
BHU S.76. 29ff. Incomplete. 


^BALABHADRA 

Additional manuscripts of his Yogasataka (see 
CESS A 4, 233a-233b): 


228 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Benares (1963) 34714. Ff. 1-24. No author men¬ 
tioned. 

BHU C.2977. 19ff. Incomplete. No author men¬ 
tioned. 

GJRI 8615/840. Ff. 1-5. Maithili. Incomplete. 

BALABHADRA DASA 

Orissan author on ganita. Manuscripts: 

Bhubaneswar 2.Cy/313. (Ganita in Oriya). 
Bhubaneswar 2.G/106. (Sodhi). 


BALABHADRA NAY AKA 

The son of Yugala of the K^itivarnsa, Balabhadra 
wrote or collaborated in writing various works on 
ganita in Orissa. 

1. Upadesaglta. Manuscript: 

Bhubaneswar IV ganita I (G/2a) = Bhubaneswar 

2.G/2a. 35ff. Oriya. From Puri. 

2. Collaborated in a KhadiUldvati. Manuscript: 

Bhubaneswar IV ganita 8 (G/53). 207ff. Oriya. Cop¬ 
ied by Haribali Arasirnha for Vrndavana Nayaka 
of the K$itivamsa on Friday 10 Sirnha in Sal. San 
1284, the 22nd ahka of Divyasirnha = 25 August 
1876 (?). From Nijigada Tapanga, Khurdha, Puri 
District. 

3. Collaborated in a Ganita. Manuscripts: 

Bhubaneswar IV ganita 19 (G/24). 69ff. Oriya. 

Incomplete. From Jagatsirnhapur, Cuttack 
District. 

Bhubaneswar IV ganita 27 (G/45) = Bhubaneswar 
2.G/45. 43ff. Oriya. Incomplete. From Puri. 
Bhubaneswar IV ganita 55 (G/28). 54ff. Oriya. 

Incomplete. From Jagatsirnhapur, Cuttack Dis¬ 
trict. 

Bhubaneswar 2.G/61; and G/79. 

4. Collaborated in a Nalasdgara. Manuscript: 

Bhubaneswar IV ganita 38 (G/32). 135ff. Oriya. 
From Puri. 


Bhubaneswar 2.G/128. 

6. Collaborated in a Vdmphlnala. Manuscript: 

Bhubaneswar IV ganita 57 (G/40). 50ff. Oriya. 
Incomplete. From Bhubaneswar, Puri District. 

7. Si^ya upadesa cautisd. Manuscripts: 

Bhubaneswar IV ganita 60 (G/27b). llff. Oriya. 
Incomplete. From Jagatsirnhapur, Cuttack Dis¬ 
trict. 

Bhubaneswar IV ganita 61 (G/26b) = Bhubaneswar 
2.G/26b. 44ff. Oriya. Incomplete. From Khalli- 
kota, Ganjam District. 

8. Collaborated in a Sindhusirnhdra cautisd. Manu¬ 
script: 

Bhubaneswar IV ganita 62 (G/2b). 20ff. Oriya. From 
Puri. 


^BALABHADRA (/?. eighth century) 

For this author (see CESS A 4, 233b) see also D. 
Pingree [A5. 1976] and [A5. 1983). 


^BALABHADRA (b. 1495) 

Additional manuscripts of his Bdlabodhinl (see 
CESS A 4, 233b-234a): 

^Bombay U 373 B (373 A contains the Bhdsvati 
with the anonymous Bhdsvatidyota\ A and B 
were copied by the same scribe in the same year). 
Ff. 1-11. Copied in Sarn. 1720 = A.D. 1663. 
Incomplete (adhikaras 6-8). From Bharatapura in 
Rajasthana. 

Kathmandu (1965) 158 (2814). 66ff. Copied by 
Vijayananda Jaina on 5 kr$napak§a of Pau§a in 
Sarn. 1899 = ca. 20 January 1843. 

RORI (Alwar) 2658 = *Alwar 1885. 34ff. Copied in 
Sam. 1909 = A.D. 1852. 

AS Bengal III.F.208. 

Kathmandu (1965) 160 (7065). 25ff. Incomplete 
(ends with grahasphuta). 

Oxford CSS I 30 (*c. 393 (5)). Ff. 11-14, 23-24, 27, 
43-50, and 56-57. Bengali. Incomplete (2, 4-3, 
2; 3, 18-4, 4; 4, 8-15; 5, 10-7, intr.; and 7, 
4-end). 


5. Collaborated in a Bijamdlikd. Manuscript: 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


229 


BALABHADKA SUKLA (Ji. 1623/1642) 

The son of Ratnakara Gauc^a of the Vatsakula, 
Balabhadra wrote on kun^as at Stambhatirtha dur¬ 
ing the reign of Jayadeva, the son of Nrsirnhadeva. 

I. The Kundatattvapradlpa = Kundapradipa in 60 
verses, composed in Saka 1545 = a.d. 1623, Manu¬ 
scripts: 

Anup 1740. 16ff. Copied by Prabhakara, the son of 
Narayana, at Varanasi in Sam. 1693 = a.d. 1636. 
Baroda 9721. 30ff. Copied in Sam. 1713 = a.d. 

1656. With his own fika. Incomplete. 

RORI Cat. II 8811. 61ff. (ff. 32 and 34-35 missing). 
Copied by Visvesvara Sukla in Sarn, 1715 = a.d. 
1658. With his own tika. See BORI 204 of 
1884/87. 

RORI Cat. IX 28607. 62ff. Copied in Sarn. 1794 = 
a.d. 1737. With his own tika. 

BORI 39 of A 1882/83. 20ff. Copied in Sam. 1802 
= A.D. 1745. 

Baroda 10528. Off. Copied in Sarn. 1803 = a.d. 
1746. 

BORI 204 of 1884/87 = BORI (Dharma) 300. 41ff. 
Copied by Amrtarama Sukla on Thursday 11 
kr§napak§a of Vaisakha in Sarn. 1817 = 10 
April 1760 from a manuscript (RORI 8811) cop¬ 
ied by Visvesvara Sukla of the Gaudanvaya on 
Thursday 8 Asvina of Sarn. 1715 = 24 Septem¬ 
ber 1658. With his own fika. 

Wai 2999. 38ff. Copied in Saka 1714 = a.d. 1792. 

With his own tika. Incomplete. 

BORI 164 of 1886/92 = BORI (Dharma) 301. 37ff. 
Copied by Haridasa Vai§nava for Arnmakesvaraji 
on Wednesday 7 Vaisakha in Sam. 1888 = 11 
May 1831. With his own tika. 

Baroda 4620. 13ff. Copied in Sarn. 1910 = a.d. 
1853. 

RORI (Alwar) 3757. 27ff. Copied in Sam. 1913 = 
A.D. 1856. With his own tika. 

WRI 4664. 43ff. Copied in Sam. 1924 = a.d. 1867. 

With his own Oka. Incomplete. 

Alwar 1296 and 1297. 

Anandasrama 4376. (Kundabheddh). See NCC, vol. 
4, p. 180. 

Anup 1739. 19ff. Formerly property of Manirama 
Dik§ita. 

Bombay U Desai 202. 17ff. 

CP, Kielhorn XIX 56. 40ff. Property of Javahara 
Sastri of Canda. 

IM Calcutta 2976. With a fika. Incompl'ete. See 
NCC, vol. 4, p. 178. 

IM Calcutta 5799. (Kundadyotana). See NCC, vol. 4, 


p. 179. 

PUL I Dharma 158. Ff. 1-7, 9, 11-12, 14-22, 24-42, 
56-57, and 59-61. With his own tika. Incom¬ 
plete. 

RORI Cat. II 4960. 15ff. 

RORI (Alwar) 3754. 19ff. 

RORI (Alwar) 3755. 21ff. With his own tika. 

SOI. See NCC, vol. 4, p. 178. 

Tanjore D. 11870 = Tanjore JL 1112. 24ff. With (his 
own) tika. Incomplete (to verse 84). 

WRI 1141. 26ff. With his own tika. 

The Kundatattvapradlpa was published on pp. 
104-118 of Viuhaladlk^itaviracitd mandapakunda- 
siddhi, Kalyana-Mumbai Sarn. 1982, Saka 1847 = 
A.D. 1925. Verse 1 is: 

natvacyutabrahmamahesamurtir 
i§te§u purtesu yad ahgam adyam // 
saiigarn samarn kundam anekabhedarn 
brute ’khilarp tad balabhadrasurih //I// 

Verses 155-159 (= 56-60) are: 

srimadbhupatisalivahanasakat pahcabdhitithyanvite 
srisurye disi saumyagamini vasantartau ca mine 
ravau // 

caitre suddhagapaurnamasi himagau savitradhi§nye 
dhrtau 

kanyasthe himagav athavanisute me§e budhe minage 

//155// 

sirnhe devagurau site makarage karke sanau 
sarnsthite 

kanyayam tamasi praketu§u ru§arn sarnsthe^u punye 
’hani // 

sadvi§tyam karane ca sanmithunake lagne ’bhijitke 
muhur- 

te satkundavicaranartham udito dipah prakasarn 
pray at //156// 

sr i matstambhasut i rthapattanamahendrambhodhiyoge 
vasan 

nanasastravicarane patumatih srigaudaratnakarM// 
jato vatsakulabdhisitakiranah satkundatattvam 
sphutam 

suklah sthavarasunur atra balabhadrakhyah pravakti 
sphutam //157// 

yah purvam suhiranyagarbham atularn rCipam 
dadhan vanviran- 

madhye bhattasamakhyayabhavad asau vedanvita- 
tvarn svarat // 

bhuyah srijayadevadik§itamanih samrat suvistari- 
tum 

sahgam karmapatharn caran vijayate srimannrsim- 
hatmabhQh //158// 


230 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


yena sribhagavan makhair bahuvidhaih santarpitah 
sastrato 

yena dvadasasautyakagnicayanaih sadvajapeyadi- 
bhih // 

is tarn tena susastravedavidu^am tattvopadesaya ca- 
jnaptenayam agadha sagarajalat purnenduvat kasitah 

//159// 

2. The Kundapradlpaflka in 164 verses, composed 
in Sam. 1699 = a.d. 1642. Manuscripts: 

Baroda 9721. 30ff. Copied in Sarn. 1713 = a.d. 
1656. Incomplete. 

RORI Cat. II 8811. 61ff. (ff. 32 and 34-35 missing). 
Copied by Visvesvara Sukla in Sarn. 1715 = a.d. 
1658. See BORI 204 of 1884/87. 

RORI Cat. IX 28607. 62ff. Copied in Sam. 1794 = 
A.D. 1737. 

BORI 204 of 1884/87 = BORI (Dharma) 300. 41ff. 
Copied by Amrtarama Sukla on Thursday 11 
kr§napaksa of Vaisakha in Sarn. 1817 = 10 
April 1760 from a manuscript (RORI 8811) cop¬ 
ied by Visvesvara Sukla of the Gaudanvaya on 
Thursday 8 Asvina of Sarn. 1715 = 24 Septem¬ 
ber 1658. 

Wai 2999. 38ff. Copied in Saka .1714 = a.d. 1792. 
Incomplete. 

BORI 164 of 1886/92 = BORI (Dharma) 301. 37ff. 
Copied by Haridasa Vai§nava for Arnmakesvaraji 
on Wednesday 7 Vaisakha in Sarn. 1888 = 11 
May 1831. 

RORI (Alwar) 3757. 27ff. Copied in Sam. 1913 = 
A.D. 1856. 

PUL I Dharma 158. Ff. 1-7, 9, 11-12, 14-22, 24-42, 
56-57, and 59-61. Incomplete. 

RORI (Alwar) 3755. 21ff. 

Tanjore D.11870 = Tanjore JL 1112. 24ff. Incom¬ 
plete (to verse 84). 

Verse 164 is: 

nandahkartusasahkavatsaramite srivikramarkad 
vibhor 

yate dak^inagolage dinamanau hemantakale subhe // 
karttikyarn bhrguvasare vyaracayat fikarn sphufam 
srigururn 

natvesam balabhadrasamjnaka imarn vidvadvicara- 
k§amam //164// 


*BALABHADRA (fl. 1629/1653) 

1. Additional manuscripts of his Hdyanaratna (see 

CESS A 4, 234b-236a): 

BHU C.827. 90ff. Sarada. Copied in Saka 1668 = 
A.D. 1746. 

RORI Cat. IV 19509. 165ff. Copied by Deva Upadh- 
yaya at Kasi in Sarn. 1828 = a.d. 1771. 

BHU C.3761. 170ff. Copied in Sam. 1861 = a.d. 
1804. 

PrSB 3612 (Berlin or. fol. 2137). 11 Iff. Copied by 
Bhavanisaiikara on Saturday 13 kr§napaksa of 
A§adha in Sarn. 1870, Saka 1735 = 26 June 
1813. Formerly property of Phatterama. 

Oxford CSS I 371 (*d. 809). Ff. 1-149. Copied in 
Sam. 1895 = a.d. 1838. Incomplete (adhyayas 
1-5). 

RORI Cat. XVI 36661. 15ff. Copied by Dayakrsna 
in Sam. 1897 = a.d. 1840. 

RORI Cat. IV 19475. 149ff. Copied by Vosero 
Kachavaho at Jodhapura in Sarn. 1911 = a.d. 
1854. With an anukramanika. 

RORI (Alwar) 2800. 185ff. Copied in Sam. 1913 = 
A.D. 1856. 

RORI (Alwar) 6199. 123ff. Copied by Bhagavana in 
Saka 1786 = a.d. 1864. Incomplete. 

Vrndavana 8747. 68ff. Copied by Kisanalala Brah- 
mana at Bhukatarai in Sarn. 1935 = a.d. 1878. 
Incomplete (dvadasabhavavicara). 

RORI (Alwar) 6229. 19ff. Copied by Govindasirnha 
at Alavara in Sarn. 1962 = a.d. 1905. Incom¬ 
plete. 

AS Bengal I.D.19. 

BHU B.689. 91ff. 

BHU C.3908. 17ff. Incomplete (sahamadhyaya). No 
author mentioned. 

Oxford CSS I 372 (*d. 777 (2)). Ff. 5-40, 43-72, 
116-117, 119-131, 133-143, and 145. Incomplete. 

Oxford CSS I 373 (*d. 801 (1)). Ff. 1-51 and 
5lb-96. Incomplete. 

RORI (Alwar) 2799. 192ff. Incomplete. 

RORI (Udaipur) 3782. 201ff. 

Vrndavana 8848. 132ff. Incomplete. 

Vrndavana 8864. Ff. 298-308. Incomplete. No 
author mentioned. 

2. Additional manuscripts of his Hordratna (see 

CESS A 4, 236a-237a): 

AS Bengal 7359 (G.6554 A). Ff. 1-77. Incomplete. 

BORI 894 of 1884/87. 69ff. From Gujarat. 

New Delhi, N.M. 63/916. 70ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


231 


PrSB 3613 (Berlin or. fol. 2826). Ff. 1-29, 36-206, 
and 216-268. Incomplete. 

RORI (Alwar) 2776 = *Alwar 2034. 176ff. 

WHMRL I 110. Ff. 1-3. Incomplete (abbreviated 
version of adhyaya 7). 

The Horaratna was published with his own Hindi 
vyakhya, Indumati, by Muralidhara Caturvedin, 2 
vols., Dilli-Varanasi-Patana 1979-1981. Adhyaya 9, 
which corresponds in its entirety to adhyayas 40-51 
of Minaraja’s Vrddhayavanajdtaka, was translated 
into English by R. Santhanam as the Gargahora, 
New Delhi 1983. 


BALARAMA 

Author of a Paddhaticandrikd. Manuscript: 

RORI (Udaipur) 43. 6ff. 

BALARAMA DAS A 

Collaborator in composing a Ganita. Manuscript: 

Bhubaneswar IV ganita 19 (G/24) = Bhubaneswar 
2.G/24. 69ff. Oriya. Incomplete. From Jagat- 
sirnhapur, Cuttack District. 


BALIPAVIJAYA 

Author of a Jdtakadlpaka. Manuscript: 

RORI (Chittorgarh) 2569. 6ff. 

BALLALA RANADE 

Author of Ekavidhasyenacayanakdrikds in accor¬ 
dance with Hiranyakesin. Manuscript: 

Wai 2685. 2ff. 


^BALLALASENA (fl. ca. 1159/1178) 

Additional manuscripts of his Adbhutasdgara 
(see CESS A 4, 237a-239a): 


Jodhpur 826. 374ff. Copied in Sarn. 1767 = a.d. 

1710. Incomplete (vividhasahgraha). 

Jodhpur 1164. 5ff. Copied in Sam. 1767 = a.d. 

1710. Incomplete (ulukasanti). 

*RORI (Udaipur) 1712. 353ff. Copied by Durgadasa 
Dasora Tivari and Sitarama Misra in Sarn. 1811 
= A.D. 1754. 

RORI Cat. IV 21596. 298ff. (ff. 56-57, 211-214, and 
264-266 missing). Copied in Sarn. 1836 = a.d. 
1779. Incomplete. 

RORI (Jaipur) 4535. 6ff. Copied in Sarn. 1907 = 
A.D. 1850. Incomplete (bhavaphaladhyaya). 

RORI (Alwar) 3798. 294ff. Copied in Sam. 1910 = 
A.D. 1853. 

Jaipur (Dharma) 622. Ff. 85-116. Copied in Sam. 

1945 = A.D. 1888. Incomplete. 

Bhubaneswar 2.Dh/988. 

Jaipur (Dharma) 653. 26ff. Incomplete. 

Kathmandu (1964) 5 (1590). 142ff. Incomplete. 
Kathmandu (1964) 6 (346). 98ff. Incomplete. 

Oxford CSS I 122 (*d. 1104). Ff. 1-12; f. 6; and 
llff. Incomplete. 

RORI Cat. XVI 36264. 358ff. (ff. 128-129, 284, and 
342 missing). Incomplete. 

RORI (Chittorgarh) 4826. I36ff. (ff. 108-113 miss¬ 
ing). Incomplete. 

*RORI (Udaipur) 603. 489ff. (ff. 93, 275-278, 343, 
345-346, 380, 389-395, and 460-481 missing). 
Incomplete. 

CANNA BAS AY ANN A 

Author of a Kdlajhdna in Kannada. Manuscript: 
Mysore ORI A.47/25. Ff. 139-142. Telugu. 


^NIRDURI (NITTURI) BASAVOPADHYAYA SURI 
(BASAVABHATTA) 

Basavopadhyaya (see CESS A 4, 239b) also wrote 
a Sudarsanakdlanirnaya. Manuscripts: 

Mysore ORI P.5040/2. Ff. 1-8. Telugu. 

Mysore ORI P.9658/4a. Ff. 1-58. Telugu. Incomplete 
(prakarana 1). 

The colophon begins: iti sridevarajabhaftopa- 
dhyayasomayajiputranit furibasavabhattaviracite. 


Vrndavana 415. 392ff. Copied by Paramananda 
Kayastha at Mathura in Sarn. 1655 = a.d. 1598. 


232 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


BASTIRAMAJl (fl. 1987) 

Author of a Hindi tika on the Lagnacandrika of 
Kasinatha, published at Bambai in 1987. 

BAHAVACARYA 

Author of a Bhuvanadlpikd = Bhuvanesva- 
rldlpikd. Manuscript: 

Mysore ORI P.9881/6. Ff. 31-32. Nandinagari. 
Incomplete (vastuprakarana). 


WAI LAKHU 

Additional manuscripts of her Sakunasdstra (see 
CESS A 4, 239b): 

Benares (1963) 37610. Ff. 1-4. 

GJRI 8676/901. Ff. 4v-5v. Maithili. (Ldkhobdi). 
RORI Cat. VII 25620 (2). If. 


^BADARAYANA 

Additional manuscripts of his Prasnavidyd (see 
CESS A 4, 239b-240a): 

RORI Cat. IX 28718. 18ff. Copied in Sam. 1801 = 
A.D. 1744. With the fika of Bhattotpala. 

RORI Cat. VIII 27285. 13ff. With the fika of Bhaf- 
totpala. 

*BAPIRAJA 

Additional manuscripts of his Kdldmnavivrti 
(see CESS A 4, 240b-241a): 

Mysore ORI *P.4409/2. Ff. 69-203. Telugu. 

Mysore ORI P.5123/2b. Ff. 1-130. Telugu. Incom¬ 
plete (verses 1-305). 

Mysore ORI P.5784/2. Ff. 1-86. Telugu. Incomplete 
(verses 1-264). 

Mysore ORI P.7088. Ff. 1-97. Nandinagari. Incom¬ 
plete (verses 1-299). 


-^BAPUDEVA SASTRIN (b. 1 November 1821) 

Author also (see CESS A 4, 241a-242a) of a 
Kaslsthamanamandiravedhalayavarnana, which de¬ 
scribes the astronomical instruments established by 
Savai Jayasirnha (1686/1743) on the roof of the 
Manamandira constructed by Manasirnha 
(1550-1614). Bapudeva wrote this at the College in 
Varanasi in Saka 1788 = A.D. 1866, as is indicated 
by the concluding verse: 

sake gaja^tadrihimarnsutulye 
sribapudevabhidhasastrinedam // 
vinirmitarn kasikarajakiya- 
pafhalaye tantrikavaryatu^tyai // 

The Kdslsthamdnamandiravedhdlayavarnana was 
printed in a rare edition, probably at Kasi in 1866 
or shortly thereafter; it has been published again 
with an English translation and commentary by 
Shaktidhara Sharma, Kurali 1982. A Hindi version 
is said to have been published by Ganapatideva 
Sastri in Panditdsrama 1, Sarn. 1969 = a.d. 1912/13, 
1-9. 

Bapudeva also wrote a Saralatrikonamiti, edited 
by Govinda Pathaka as SG 10, Varanasi 1977, and a 
Vyaktaganita in Hindi, published in two parts, 
Benares 1875. Concerning his life see also 
Ramacandra Jha, Vidvadbhuti, HSS 256, Varanasi 
1971, pp. 19-23. 

^BAPUBHATTA KELAKARA (Ji. 1810/1819) 

In a manuscript (WHMRL y 251) of his 
Srdddhamahjarl Bapubhatta gives the date of its 
composition as Margasirsa of Saka 1732, a Pramo- 
davatsara; this is correctly a.d. 1810, so that the date 
of his Krtyamanjan (see CESS A 4, 242a-242b) 
must be Pau§a and Magha of Saka 1740 {not 1640) 
= 27 December 1818-24 February 1819. While 
BapubhaUa wrote the Krtyamanjan at Saptar^i ( = 
Satara) on the south bank of the Kr§na, his village, 
Phanasi, was near Vada on the outskirts of Rajapura 
on the bank of the Budhi (Rajapura is several miles 
southeast of Ratnagiri). The Kelakaras belonged to 
the Sandilagotra. The relevant verses from the upa- 
sarnhara of the Srdddhamahjarl are: 

k§etre bhargavanirmite budhitate rajapuraprantake 
vadagramasamipavarttiphanas isamjho laghu- 

gramakah // 

tatsthah kelakaropanamakamahadevatmajah sandilo 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


233 


bapubhaUa imam prayogam akarot tenacyutah 
priyatam //!// 

srisalivahane sake karagnimunibhumite // 
pramodavatsare marge manjariyarn samapita //5// 

Additional manuscripts of his Krtyamanjarl: 

Nagpur 465 (1682), 11 Iff. Copied in Saka 1777 = 
A.D. 1855. From Nasik. 

Mysore ORI C.4200. 90ff. 

Mysore ORI C.4265. Ff. 1-43. Incomplete (to sara- 
svatipuja). 


*BABA ifl. ca. 1600) 

Additional information concerning a manuscript 
of his Pahcahgasiddhi (see CESS A 4, 242b): 

RORI (Alwar) 2655 = *Alwar 1834. lOff. Copied in 
Sam. 1912 = A.D. 1855. 


BABiJ SASTRIN 

A resident of Kasi, Babu wrote a Hindi fika on 
Nilakantha’s Tajikanllakanfhl, of which the 3rd 
ed. was published at Mumbayi in Sarn. 1981, Saka 
1846 = A.D. 1924. 


WALAKR^NA 

Additional manuscripts of his PahcaHokl and its 
tika (see CESS A 4, 242b-243a): 

RORI (Alwar) 5409. 5ff. Copied by Baladatta Sar- 
man in Sarn. 1940 = A.D. 1883. With his own 
tika. 

BHU B.3724. 3ff. With his own tika. 

IM Calcutta 5091. See NCC, vol. 11, p. 57. 

RORI (Alwar) 2811 = *Alwar 1830. 12ff. With his 
own tika. 

BALAKR^NA 

Author of a tika on the Slghrabodha of 
Kasinatha. Manuscript: 

AS Bengal 7083 (G.7911). 8ff. Incomplete. 

Verse 1 is: 


natva ganesarn sivam ambikam ca 
ravirn guror ahghryaravindayugmam // 
sribalakr$no drutabodhakarn tarn 
grantharns ca dr§tva visadikaroti //!// 

*BALAKR$NA BHATTA (fl. ca. 1625/1650) 

Additional manuscripts of his Tdjikakaustubha 
(see CESS A 4, 243a-244a): 

RORI (Chittorgarh) 369. 6ff. Copied by Kalyanacan- 
dra Suri at Satyapura in Sarn. 1766 = A.D. 1709. 
Incomplete (svaraphala). No author mentioned. 
RORI Cat. IX 28217 (4). Ff. 18-21. Copied by Thi- 
rapala Vacaka in Sarn 1785 = a.d. 1728. Incom¬ 
plete (bhavadhyaya). No author mentioned. 

RORI (Alwar) 2793 = *Alwar 1798. 78ff. Copied in 
Sarn. 1861 = a.d. 1804. 

RORI (Alwar) 6097. 44ff. Copied by Manasarama in 
Sarn. 1899 = A.D. 1842. 

RORI (Alwar) 2794. 70ff. Copied in Sarn. 1912 = 
A.D. 1855. 

Anandasrama 1885. 

CVS 2826 (5253). 42ff. No author mentioned. 

Jaipur (Khasmohor) 5428. Incomplete (masaphala- 
bhavadhyaya). 

RORI (Alwar) 2798. 7ff. Incomplete (masaphala). 
RORI (Chittorgarh) 2570. 6ff. Incomplete (bhavadh¬ 
yaya). 

^BALAKR^NA VEDAVRK^A (1796/1830) 

His father, Jyotihsvarupa, was the son of Vasanta- 
raya, the son of Mahadeva, the son of Kesava. 

1. Additional manuscript of his Lilaramana (see 
CESS A 4, 244b-245a): 

AS Bengal 6939 (G.5298) III. F.l. Bengali. 

In this manuscript, the verse cited as 2 in CESS 
A 4 is numbered 4, and verses 2-3 are: 

srimatpaii(litavedavrk§akulajo bhudevamukhyo 
mahan 

sridevadvijayacakarcanaratah srikesavakhyo ’bha- 
vat // 

sadvipresasiromaiiih svadhanayuk tasyatmajo ’bhun 
maha- 

devakhyo jayati pragalbhamanujair manyas tu 
tasyatmajah // 

daivajno hi yasantarayaganako namna dharadevarat 


234 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


tajjo vedamukhak§ikadinipuno jyotihsvarupah 
smrtah // 

catvarah sisavas tadatmajanijas te§u priyatipriyah 
kincic chastravicarasaranipunah sribalakr^no ’smy 
aham // 

3. Additional manuscripts of his Siddhantaraja (see 
CESS A 4, 245a-246a): 

NFS (Sanskrit) 6738. Ff. 2-102. Incomplete. 

RORI Cat. IX 28641. 17ff. Incomplete (ends in 3, 
118). 

5. Additional information concerning the manuscript 
of his Tithinirnaya (see CESS A 4, 246a): 

RORI (Alwar) 3597 = *Alwar 1325. 16ff. Copied in 
Sam. 1911 = A.D. 1854. 

The last 2 verses are: 

iti srilaghukalasya nirnayena viniscitah // 
samanyatithinirnayasadhananarn ca nirnayah // 
krtas tu balakr$nena bharadvajena dhimata // 
viseso hemadryalocanenavagantavya iti // 

6 and 7. Balakrsna also wrote a Tattvdnhacintdmani 
in 9 verses on pancapak^i together with a tika on it 
entitled Maniprakdsa. Manuscript: 

Poleman 4394 (U Penn 652). 7ff. 

The colophon begins: iti srimatparvataveda- 
vrk§abalakrsnaviracitah. 

8. He also wrote an Uccavddavicdra. Manuscript: 

Kathmandu (1964) 26 (3016). 2ff. With the Lagna- 
vMa of Giridharin Misra. 

The colophon begins: iti vedavrk§abalakrsna- 
misraviracitoccavadavicarah. 

*BALAMUKUNDA TRIPATHIN (b. 19 July 1911) 

Author also (see CESS A 4, 246b-247a) of a 
LUavatl kd jdydjlvana, published at Jabalapura in 
1970. 


BALASURI 

The son of Se^abhaffa, Balasuri wrote a Kunda- 
racandnti. Manuscript: 

Tanjore D.11884 = Tanjore JL 1119. 9ff. 

Verse 1 is: 

se§abhattam ca pitararn natva gauripatim tatha // 
kundanatn racanaritis tanvate balasurina // 

BALADATTA 

Author of a tika on a Jdtakamanohara. Manu¬ 
script: 

RORI (Alwar) 5434. 28ff. Incomplete. 

BISIDASA 

Author of a Ganita. Manuscript: 

Bhubaneswar 2.G/3. 


^AL-BlRtjNI, ABU RAYHAN MUHAMMAD IBN 
AHMAD (b. 4 September 973) 

Concerning this author (see CESS A 4, 248a) see 
also N. S. Sastri [A5. 1965]; D. Pingree [A5. 1976]; 
M. S. Khan [A5. 1977]; S. S. H. Rizvi [A5. 1979]; D. 
Pingree [A5. 1983]; F. I. Haddad, D. Pingree, and E. 
S. Kennedy [A5. 1984]; and M. S. Khan [A5. 1987]. 

^BUCCANNA VAJAPEYIN 

Additional information concerning the 
manuscript of his Daivajnadarpana (see CESS A 4, 
248a): 

Mysore ORI *B.807/1. Ff. 1-38. Kannac^a. Copied in 
Saka 1824 = A.D. 1902. 

Verse 3 is: 


srimadvellalabuccannavajapeyimani§ina // 
daivajfiadarpanabhikhyagrahatantrarn vidhiyate // 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


235 


WUDHA VAS AT I RAM A (fl. 1892/1898) 

This author (see CESS A 4, 248b), who some¬ 
times is called simply Vasatirama, was a resident of 
Vadaripura. He completed a Hindi artha to the 
Ramalanavaratna of Paramasukha on Saturday 8 
suklapak^a of A§adha in Sam. 1949 = 2 July 1892; 
it was corrected by Ramabhadra on Wednesday 9 
suklapak§a of Jye§tha in Sarn. 1950 = 24 May 
1893, and published at Mumbai in Sarn. 1950 = 
A.D. 1893. He completed a Hindi tika on the Jata- 
kalafikara of Ganesa on Friday the Nagatithi in the 
suklapak^a of Vaisakha in Sarn. 1950 = 28 April 
1893; it was published at Kalyana-Barnbai in 1986. 
He completed a Hindi tika on the Ramala- 
cintamani of Cintamani on Sunday 11 kr§napak§a of 
Sravana in Sam. 1954 = 22 August 1897; it was 
published at Murnbai in Sam. 1983, Saka 1848 = 
A.D. 1926. And he completed a Hindi tika, Sarala, 
on the Naradasamhita of Narada on Friday the pur- 
nima of Tai§a in Sarn. 1954 = 7 January 1898; it 
was published at Bambai in Sarn. 1994, Saka 1859 
= A.D. 1937, repr. at Bambai in 1957. He also wrote 
a Rajasthani tika, Mularthabodhinl, on the Para- 
sari of Parasara. Manuscript: 

RORI (Chittorgarh) 2107. 5ff. Copied in Sam. 1953 

= A.D. 1896. 


^BUDHASIMHA SARMAN (fl. 1764/1766) 

Additional manuscripts of his Grahanddarsa and 
Prabodhini (see CESS A 4, 248b-249a): 

BHU C.839. 24ff. Copied in Sam. 1877 = A.D. 1820. 

With his own Prabodhini. 

RORI Cat. XVI 37270. 49ff. Copied by Visvanatha 
Sarman at Jayapura in Sarn. 1923 = A.D. 1866. 
With his own Prabodhini. 


WRHASPATI 

Additional manuscripts of his Nimittakdnda = 
Brhaspatikdnda (see CESS A 4, 249a-249b): 

NPS (Sanskrit) 6246. Ff. 2-46 and 48-51. Copied on 
Monday 3 kr§napak§a of Caitra in Sarn. 1882 = 
4 April 1825. With a Hindi tika. Incomplete. 
Mysore ORI *P.3505. Ff. 1-24. Grantha. (Bdrhas- 
patyanimitta). 

PrSB 3692 (Berlin or. oct. 838). llff. With a Hindi 
tika. 


WRHASPATI 

Additional manuscripts of his Brhaspatisarnhitd 

= Bdrhaspatya (see CESS A4, 249b-250a): 

GOME Madras R.3258. 178ff. Grantha. Copied in 
1920/21 from a manuscript in the Sanskrit Col¬ 
lege Library, Tiruppanattura, Cochin State, 
(muhurtavidhana in 30 adhyayas). 

GOML Madras R.3294. 176ff. Copied in 1920/21 
from a manuscript belonging to Tippan Nambu- 
dirippad of PonnQrkottamana, Perumbavore 
Post, Travancore State. 

GOML Madras D.3592. Ff. 5-5v. Telugu. (kurma- 
darsanasanti). 

Jodhpur 1176 (A). 141ff. (grahasanti). 

Mysore ORI C.4246. Ff. 1-48. 

Mysore ORI P.604/23. Ff. 27-28. Grantha. (bala- 
hinabrhaspatisanti). 

Mysore ORI P.604/85. Ff. 115-130. Grantha. (pra- 
thamartavasanti). 

Mysore ORI P.4180/21. Ff. 26-29. Nandinagari. 

(balahinabrhaspatisanti). 

Mysore ORI P.4480/20. Ff. 65-69. Nandinagari. 

(adhyaya 20 of the muhurtavidhana). 

Mysore ORI P.4863/29. Ff. 44-45. Telugu. (brhas- 
patipujavidhi). 

Mysore ORI P.5635/27. Ff. 24-25. Grantha. 

(aslesanak§atrajananasanti). 

Mysore ORI P.5930/69. Ff. 86-87. Nandinagari. 

(brhaspatisanti). 

Mysore ORI P.6177. Ff. 172-236. Telugu. (muhurta¬ 
vidhana; incomplete). 

Mysore ORI P.6297/3. Ff. 44-46. Grantha. 

(asle§anak§atrajananasanti). 

Mysore ORI P.6297/27. Ff. 32-33. Grantha. 

(gaulipatanasanti). 

Mysore ORI P.7913/19. Ff. 21-28. Nandinagari. 

(brhaspatikerali). 

Mysore ORI P.7970/49. Ff. 28-30. Nandinagari. 

(bhuvanesvari santi). 

Mysore ORI P.9167/22. Ff. 25-26. Grantha. (brhas- 
patipujavidhi). 

Mysore ORI P.9254/72. Ff. 57-58. Nandinagari. 

(balahinabrhaspatisanti); P.9254/74. Ff. 60-61. 
Nandinagari. (brhaspatipujavidhi); and P.9254/ 
180. Ff. 149-150. Nandinagari. (bhuvanesva- 

risanti). 

Mysore ORI P.9951/32. Ff. 29-31. Nandinagari. 

(brhaspatisanti); and P.9951/34. F. 34. Nandi¬ 
nagari. (brhaspatipujavidhi). 

Mysore ORI P. 10070/48. Ff. 46-48. Nandinagari. 

(brhaspatisanti); and P.10070/50. F. 50. Nandi¬ 
nagari. (brhaspatipujavidhi). 


236 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Oppert I 6060. (Barhaspatyamuhurtavidhana). Prop¬ 
erty of the Maharaja of Travancore. 


*BRHASPATI 

Additional manuscripts of his Svapnddhydya (see 

CESS A 4, 250b-25Ib): 

BHU C.5148. 9ff. Copied in Sam. 1780 = a.d. 1723. 

Oxford CSS I 160 (d. 308 (3)). Ff. 1-9. Copied by 
Ramagulama on Monday 10 kr§napak§a of 
Phalguna in Sarn. 1840 = 15 March 1784. (78 
verses; from a Purdnasamuccaya). 

BHU C.2878. 5ff. Copied in Sam. 1858 = a.d. 1801. 

BHU B.4254. 3ff. Copied in Sam. 1917 = A.D. 1860. 

Berlin 902 (Chambers 608). 3ff. Incomplete (ends in 
verse 76). No author mentioned. 

BHU B.694. llff. 

BHU C.860. lOff. Incomplete. 

BHU C.996. llff. 

BHU C.1923. 2ff. 

BHU C.1938. 3ff. 

BHU C.4373. llff. Sarada. 

BHU C.4681. 2ff. Sarada. 

BHU C.5014. 4ff. 

Dharwar 587 (643). 4ff. 

GOME Madras R.5072. 2ff. Telugu. Purchased in 
1925/26 from Pendyala Venkata Subrahmanya 
Sastri of Pithapuram. 

^Jaipur (Khasmohor) 2252 (4); 4959; 5279; and 
5561 (1). 

NPS (Sanskrit) 8755. 2ff. Incomplete. 

Oxford CSS I 161 (*d. 765 (1)). Ff. 1-4. (45 verses). 

Oxford CSS I 162 (d. 772 (5) A). Ff. 1-4. Incom¬ 
plete (ends in verse 65). 

Oxford CSS I 163 (e. 168 (3) A). Ff. 3-9. Incom¬ 
plete (verses 12-82). 

Panjab JB I 3116 (Patti 326). 7ff. (Svapnavicdra). 

RORI Cat. IV 20462. If. 

Vrndavana 35. 5ff. 

Vrndavana 1338. 4ff. 

Vrndavana 2766. 8ff. 


BODHANANDA 

Author of a vrtti on the vaimanikaprakarana of 
the Yantrasarvasva. Manuscript: 

Baroda 6115. 24ff. Copied in a.d. 1918. 


*BAUDHAYANA 

Additional manuscripts of his Nak^atrasattra (see 
CESS A 4, 252b-253a): 

WRI 6691. 32ff. Copied in Saka 1697 = a.d. 1775. 
Mysore ORI P.2260/26. Ff. 105-120. Grantha. 
Mysore ORI P.4863/48. 5ff. Telugu. 

RORI (Alwar) 580 = Alwar 100 = Alwar (1884) 
Taittiriya 62. 23ff. 


^BAUDHAYANA 

Additional manuscript of his Navagrahayajha (see 
CESS A 4, 253a): 

GOME Madras D.3350. Ff. 179-182v. 


^'BAUDHAYANA 

Additional manuscripts of his works on santi (see 
CESS A 4, 253a-254a): 

1.1. Andvrs fisanti. Manuscript: 

GOME Madras D.3233. Ff. 25-25v. Telugu. 

2. Asanihatasdnti. Additional manuscripts: 

Mysore ORI P.2117/3. Ff. 85-86. Grantha. (asani- 
ghatasanti). 

Mysore ORI P.3924/9. Ff. 88-89. NandinagarE (asa- 
nisithilisanti). 

Mysore ORI P.7970/59. F. 46. NandinagarE (asa- 
nisithilisanti). 

2.1. Asvasdnti. Manuscript: 

Mysore ORI P.7970/113a. F. 123. NandinagarE 

2.2. Ayu^yahomavidhi. Manuscript: 

Mysore ORI P.9428/42. Ff. 32-33. NandinagarE 

2.3. Ardmddbhutasdnti. Manuscript: 

Mysore ORI P.3804/90. Ff. 141-142. NandinagarE 
With Vasi§tha. 

3.1. Ugrarathasdnti. Manuscripts: 

GOME Madras D.3571. Ff. 135v-136. NandinagarE 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


237 


GOML Madras D.3572. Ff. 138-139v. Nandinagari. 
Incomplete. 

Mysore ORI C.2778/4. F. 5. 

Mysore ORI P.5587/38. Ff. 108-109. Nandinagari. 
Mysore ORI P.6159. Ff. 1-2. Telugu. 

4. Utpatasanti. Additional manuscripts: 

Mysore ORI P.604/51. 13ff. Grantha. 

Mysore ORI P.7970/60. Ff. 46-47. Nandinagari. 

5. Udakasanti. Additional manuscripts: 

GOML Madras D.3573. Ff. 112v-113v. Nandina¬ 
gari. 

GOML Madras D.3574. Ff. 113v-115. Telugu. (dif¬ 
ferent version). 

Mysore ORI P.4396/37. Ff. 144-145. Grantha. 

Mysore ORI P.7401/106. 2ff. Telugu. 

Mysore ORI P.8178/7. Ff. 5-6. Telugu. 

Mysore ORI P.10301/1. Ff. 1-28. Nandinagari. 

5.1. Uparagasanti. Manuscripts: 

Mysore ORI P.60/17. Ff. 17-18. Nandinagari. 

Mysore ORI P.5653/67. Ff. 61-62. Grantha. 

5.2. Ulukasdnu. Manuscript: 

GOML Madras D.3257. Ff. 202v-204. 

5.3. fjrdhvadantaj ananas anti. Manuscripts: 

Mysore ORI P.2239/58. Ff. 68-69. Telugu. 

Mysore ORI P.2579/12. Ff. 48-50. Nandinagari. 
Mysore ORI P.3023/52. Ff. 34-35. Telugu. 

Mysore ORI P.4992/18. Ff. 39-40. Nandinagari. 
Mysore ORI P.5587/76. Ff. 152-153. Nandinagari. 
Mysore ORI P.5672/54. Ff. 88-90. Kannada. 

Mysore ORI P.7401/3. If. Telugu. Incomplete. 

Mysore ORI P.10041/53. Ff. 71-72. Telugu. 

6. Rtusdnti. Additional manuscripts: 

GOML Madras D.3581. Ff. 3-5. Grantha. 

Mysore ORI P.3128/29. Ff. 110-111. Nandinagari. 
Mysore ORI P.4396/33. F. 134. Grantha. 

RORI Cat. XVI 37258. 52ff. 

6.1. Kdkamalodbhavasdnti. Manuscript: 

Mysore ORI P.4218/98. Ff. 1-9. Telugu. 

8.1. Ketusdnti. Manuscript: 


Mysore ORI P.604/7. Ff. 13-14. Grantha. 

9.1. Gajasdnti. Manuscript: 

Mysore ORI P.2732/14 A. Ff. 1-2. Nandinagari. 

9.2. Gaul ipatanasanti. Manuscript: 

Mysore ORI P.3085/55. Ff. 67-68. Grantha. 

11. Grdmasdnti. Additional manuscripts: 

Mysore ORI P.2117/1. Ff. 84-85. Grantha. 

Mysore ORI P.2282/9. Ff. 50-52. Nandinagari. 
(gramotpatasanti). 

Mysore ORI P.5635/2. Ff. 1-4. Grantha. 

Mysore ORI P.7970/58. Ff. 44-46. Nandinagari. 

11.1. Jvarasdnti. Manuscripts: 

RORI Cat. V 22252. 5ff. Copied in Sam. 1939 = 
A.D. 1882. 

Mysore ORI P.4925/107. F. 123. Grantha. 

11.2. Duhsvapnasdnti. Manuscript: 

GOML Madras D. 16606. F. 57v. Grantha. 

14. Ndlaves (anasdnti. Additional manuscript: 

GOML Madras D.3663. Ff. 18-19v. Grantha. 

15. Parjanyasdnti. Additional manuscripts: 

GOML Madras D.3673. Ff. 133-135. Telugu. 

Mysore ORI P.4540/9. Ff. 99-100; and P. 4540/11. 

Ff. 101-102. Telugu. 

Mysore ORI P.7561/10. If. Telugu. 

Mysore ORI P.8178/37. F. 44; and P.8178/39. Ff. 
48-52. Telugu. 

17.1. Prathamaphaladarsanasdnti. Manuscript: 

Mysore ORI P.5587/70. If. Nandinagari. 

17.2. Maghdnaksatrasdnti. Manuscript: 

GOML Madras D.3393. Ff. 35-37. Grantha. 

18. Madhumak pika's anti. Additional manuscripts: 

Mysore ORI *C.696/14. If. Kannada. 

Mysore ORI P.60/61. F. 81. Nandinagari. 

Mysore ORI P.7777/40. Ff. 121-122. Nandinagari. 


238 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Mysore ORI P.7970/118. Ff. 124-125. Nandinagari. 

20. Miilanaksatraj ananas anti. Additional manuscript: 

Mysore ORI Ff. 18-19. Nandinagari. 

20.1. Yamalaj ananas anti. Manuscript: 

Mysore ORI P.3128/19. F. 102. Nandinagari. 

21. Raj odar Sana's anti. Additional manuscript: 

Benares (1953) 8480. If. 

21.1. Vanapratiuhasanti. Manuscript: 

Mysore ORI P.4247/5. Ff. 19-24. Telugu. 

24.1. Vaisvmaragnimandyasanti. Manuscript: 

Mysore ORI P.7970/75. Ff. 57-58. Nandinagari. 

24.2. Sanibhaumavarajananasanti. Manuscript: 

Mysore ORI P.3085/44. Ff. 52-54. Grantha. 

25. Santikalpa = Smtikhanda. Additional manu¬ 
scripts: 

GOME Madras D.3808. Ff. 31-33. 

GOME Madras D.3809. Ff. 69-71. Nandinagari. 
GOME Madras D.3810. Ff. 56-59v. Telugu. 

GOME Madras D.3811. Ff. 18-26v. Telugu. Incom¬ 
plete. 

25.1. SithUisanti. Manuscripts: 

GOME Madras D.3445. Ff. 42v-44. Telugu. 

GOME Madras D.3812. Ff. 44-48. Telugu. 

Mysore ORI P.2914/21. Ff. 30-32; and P.2914/22. 
Ff. 32-37. Telugu. 

Mysore ORI P.3023/90. F. 54; and P.3023/91. Ff. 
54-56. Telugu. 

Mysore ORI P.4863/98. Ff. 108-112. Telugu. 

Mysore ORI P.5293/57 A. F. 72. Nandinagari. 
Mysore ORI P.5672/96. Ff. 145-146; and P.5672/97. 

Ff. 146-151. Kannada. 

Mysore ORI P.6298/22. F. 93. Grantha. 

Mysore ORI P.7401/39. 2ff. Telugu. 

Mysore ORI P.7401/40. 4ff. Grantha and Telugu. 
Mysore ORI P.7970/129. Ff. 143-147. Nandinagari. 
Mysore ORI P.9251/152. Ff. 126-130. Nandinagari. 
Mysore ORI P.9951/81. Ff. 95-99. Nandinagari. 


29. Sahkr anti's anti = Sahkrama'santi. Additional 
manuscript: 

Mysore ORI P.5635/68. F. 62. Grantha. 

30.1. Sarvakarmavaigunya'santi. Manuscript: 

Mysore ORI P.5635/106. F. 114. Grantha. 

30.2. Sarva'sdntikhanda. Manuscripts: 

GOME Madras D.3848. Ff. 41-43v. Nandinagari. 
Mysore ORI P.2581/9. Ff. 10-14. Nandinagari. 

30.3. Sarvddbhuta'santi. Manuscript: 

Mysore ORI P.10083/23. 2ff. Nandinagari. 

30.4. Sarvdris (asanti. Manuscript: 

Mysore ORI P.5587/1. Ff. 1-2. Nandinagari. 

30.5. SahasracandradarSana'smti. Manuscripts: 

Mysore ORI C.496/8. 2ff. Kannada. 

Mysore ORI P.5313/54. Ff. 95-96. Nandinagari. 
Mysore ORI P.8532/38. Ff. 147-148. Nandinagari. 


^BAUDHAYANA 

Manuscripts of his Sulbasutra (see CESS A 4, 
252b; see also C. G. Kashikar [A5. 1980]): 

Benares (1953) 4341. Ff. 1-9. Copied in Saka 1597 
= A.D. 1675. 

VSM 4585. 9ff. Copied by Vasudeva Devadhara in 
Sam. 1734 = a.d. 1677. 

Wai 1721. 29ff. Copied in Saka 1611 = A.D. 1689. 

With the tika of Dvarakanatha. 

Wai 1711. lOff. Copied in Saka 1692 = a.d. 1770. 
Wai 1710. 13ff. Copied in ^aka 1705 = a.d. 1783. 
Osmania University B.83/14. 6ff. Copied in A.D. 
1804. Incomplete. 

Osmania University B.77/1. 23ff. Copied in a.d. 
1824. 

VSM 3366. 50ff. Copied by Govinda Manohara in 
Saka 1768 = a.d. 1846. With the tika of Dvara¬ 
kanatha. 

VSM 3367. 9ff. Copied by Govinda Manohara in 
Saka 1768 = a.d. 1846. 

lO 4636 (Burnell 445). 54ff. Copied from one of the 
Tanjore manuscripts in 1871. With the tika of 
Dvarakanatha. From A. C. Burnell. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


239 


Bombay U Desai 124. 63ff. Copied on 6 kr§napak§a 
of Vaisakha in Sam. 1971 = ca. 15 May 1914. 
With the tika of Dvarakanatha. 

AS Bengal 582 (G.499) = AS Bengal I 2.778 = 
Mitra, Not. 1318. 12ff. Property of AS Bengal. 

AS Bengal II.B.41 = AS Bengal I 2.767 (II.B.44 (!)). 
Ff. 1-13. 

AS Bengal I 2.821 = IM Calcutta 2042. Ff. 1-3. 
Incomplete. 

Baroda 460. 8ff. 

Baroda 470. 290ff. (Srautasutra\ sulbasutra is prasna 
30). 

Baroda 553. 6Iff. With the tika of Dvarakanatha. 

Baroda 12439. 3Iff. With the tika of DvarakanMha. 
Incomplete. 

Benares (1953) 1572. Ff. 1-8. 

Benares (1953) 4115. Ff. 1-12. 

Benares (1953) 4403 = Mitra, Not. 655. 8ff. Incom¬ 
plete (ends in patala 4). Property of Queen’s 
College, Benares. 

Benares (1953) 4418. Ff. 1-2. Incomplete (patala 1). 

Bombay U 755 I. Ff. 1-5. Copied by Vinayaka Dhu- 
pakara. Incomplete (adhyaya 1). 

Hultzsch 3.1850. 4ff. (Karikas). Property of Jambu- 
natha Bhatta of Tanjore. 

lO 4608 (Mackenzie II 92). Ff. 2 and 21-183. Nandi- 
nagari. (Srautasutra\ sulba on ff. 42-50). From 
Colin Mackenzie. 

Munich 104 (Sanskrit 107) = Haug 163. 345ff. 
(sulba is part 10. 1 Iff.). 

N-W P X (1886) I 5. 15ff. Property of BalabhaO 
Sapre of Benares. 

Osmania University B.77/2. 126ff. With the tika of 
Dvarakanatha. 

PL, Buhler I D 257. 16ff.; and 258. lOff. Both prop¬ 
erty of Ramabhatta Agnihotrin of Ahamadabada. 

Tanjore BL 3742. 87ff. With the tika of Dvarakana¬ 
tha. 

Tanjore BL 3743. 90ff. With the tika of Dvarakana¬ 
tha. 

Tanjore D.2024 = JL 208. Ff. 1 and 2-12. Incom¬ 
plete. 

Tanjore D.2025 = JL 209. 25ff. 

Visvabharati (Adyar) 53(b). llff. Grantha. 

Visvabharati (Adyar) 58(b). 12ff. Grantha. 

Visvabharati (Adyar) 68(b). 3ff. Grantha. Incom¬ 
plete (ends in khanda 5). 

Visvabharati (Adyar) 355(c). 3ff. Grantha. 
(Sulbopadhanakarikah-, incomplete). 

VSM 1009. 19ff. 

VSM 4584. 17ff. 

VSM 4586. 12ff. 

WBISIS 1453 (B). 22ff. Incomplete (adhyayas 1-3). 


Wai 1709. 24ff. 

Wai 1719. 70ff. With the tika of Dvarakanatha. 

Wai 1720. 12ff. With the tika of Dvarakanatha. 
Incomplete. 

Wai 1722. 12ff. With the tika of Dvarakanatha. 
Incomplete. 

The Baudhayanasulbasutra was edited with a 
Marathi translation by R. P. Kulakarni [A5.1978] 
pp. 1-82; by Satya Prakash and Usha Jyotishmati 
[A5.1979] pp. 1-39; with the Bodhdyanasulba- 
mlmdmsd of Vehkatesvara Dik§ita and the Sulba- 
dtpikd of Dvarakanatha Yajvan by VibhutibhQ^ana 
Bhattacarya as SBG 107, Varanasi 1979; and with 
an English translation and commentary by S. N. Sen 
and A. K. Bag, The Sulbasutras, New Delhi 1983, pp. 
17-38, 77-100, and 147-233. The 1968 edition by 
Satyaprakash and Ram Swarup Sharma was 
reprinted at New Delhi in 1980. 


-^'BRAHMAGUPTA (b. 598) 

Concerning this author (see CESS A 4, 
254b-257a) see also D. Pingree [A5. 1976]; R. N. 
Rai [A5. 1976/80]; S. Jha [A5. 1978]; T. Kusuba [A5. 
1981]; P. K. Majumdar [A5. 1981a] and [A5. 1981c]; 
D. Pingree [A5. 1983]; T. Kusuba [A5. 1987a] and 
[A5. 1987b]; and S. R. Sarma [A5. 1986/87a]. 

1. Additional manuscripts of his Brdhmasphu(a- 
siddhdnta (see CESS A 4, 254b-255b): 

Poona, Mandlik. Jyotisha 14. 59ff. Copied in a.d. 

1880 from BORI 59 of 1869/70. 

AS Bengal I.B.6. Bengali. 

RORI Cat. VI 23782. 17ff. Incomplete. 

RORI Cat. XVI 35182. Ff. 2-14, 19-48, 48b-124, 
and 2ff. With the vivarana of Prthudakasvamin. 
Incomplete (I 4-II 68; XV 1-9; and III 1-X 64). 
Perhaps a copy of *BORI 339 of 1879/80. 

Note that *RORI 411 does not contain adhyaya 
5; see after the Khandakhddyaka. 

2. Additional manuscripts of his Khandakhddyaka 
(see CESS A 4, 256a-257a): 

Pattan II 9737. 13ff. Copied in Sarn. 1611 = a.d. 
1554. 

Kathmandu (1964) 58 (6882). 16ff. Copied in the 
suklapak§a of month 5 in Saka 1724 = a.d. 
1802. Incomplete (ends with patanayana). 


240 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Jaipur) 5486. 16ff. Copied by Nanurama in 
Sarn. 1886 = a.D. 1829. 

RORI Cat. IV 19403. 21ff. (ff. 12-20 missing). Cop¬ 
ied by Devaratna, the pupil of Devasundara, at 
Nagapura in Sarn. 1924 = A.D. 1867. Incomplete. 
ABSP 1658. 6ff. Incomplete. Ascribed to Aryabhafa. 
ABSP 1660. lOff. Incomplete (uttarabhaga). 

ABSP 1662. lOff. Incomplete. 

BHU C.326. 129ff. Sarada. With the tika of Prthu- 
daka. 

BHU C.694. lOff. Sarada. Incomplete. 

BHU C.1670. 39ff. Incomplete. No author men¬ 
tioned. 

BHU C.3986. 4ff. Sarada. With a tika. Incomplete. 
Ascribed to Aryabhata. 

BHU C.4847. 21ff. Ascribed to Krsnaguptacarya. 
Kathmandu (1964) 57 (2635). 18ff. Incomplete (ends 
with taraviksepa). 

PrSB 1851 (Gottingen Mu I 89). 36ff. Sarada. 
Incomplete (ends with naksatrasamagamoda- 
yasta). 

3. Ascribed to Brahmagupta in one manuscript is a 
Grahanarkajhana in 81 verses on computing solar 
eclipses. In verse 21 is quoted Yavana, in verse 47 
Yamunacarya; and it begins: atha ^amdikhadyaka- 
mate (sa = kha). It is a late work based in part on 
the Khandakhddyaka and its commentary by Bhat- 
totpala. Manuscript: 

*RORI Cat. I 411. Ff. 1-8. Copied by Garngabi§na 
(?) (= Gaiigavisnu?) on 7 krsoapaksa of Kart- 
tika in Sarn. 1840 = ca. 16 November 1783. 


BRAHMACAITANYA MUNI 

Author of a Sdmudrikastrlpumsalaksandni. 
Manuscript: 

Jammu 2912. 12ff. 


*BRAHMADEVA (fl. 1092) 

Additional manuscripts of his Karanaprakdsa (see 
CESS A 4, 257b-258b): 

*BORI 849 of 1891/95. Ff. 1-17. Copied by a son of 
Kesava on a Friday in Saka 1548 = A.D. 1626. 
^Jaipur (Khasmohor) 4953. 

RORI (Alwar) 2649 = *Alwar 1723. 9ff. Copied on 
11 kr§napak§a of Bhadrapada in Sarn. 1909 = 
ca. 10 October 1852 from a manuscript copied on 


6 suklapaksa of Tapasya in Saka 1755 = ca. 26 
April 1833. 

*BORI 503 of 1895/1902. Ff. 1-7. Not copied in 
Sarn. 1811, but containing an udaharana on 1, 
1-2, 10 with an example for Sunday 11 kr§na- 
pak§a of Karttika in Sam. 1811, Saka 1676 = 10 
November 1754. 

Mysore (1905) 720. 11pp. Telugu. 

Mysore ORI C.4687/60. Ff. 1-2. 

Mysore ORI C.4698/27. Ff. 1-5. Nandinagari. 

Incomplete (adhyaya 1; incomplete). 

Mysore ORI C.4700/64. Ff. 1-2. Nandinagari. 

Incomplete (adhikara 2). 

Mysore ORI *P.1771/2. Ff. 1-12. Nandinagari. 

Mysore ORI P.4187/2a. Ff. 62-87. Nandinagari. 

Mysore ORI P.4480/15. Ff. 38-44. Nandinagari. 

Mysore ORI P.4672/2a. Ff. 209-229. Grantha. 

Mysore ORI P.6123/1. Ff. 42-71. Grantha. 

Mysore ORI P.10056/45. Ff. 115-116. Nandinagari. 

Poleman 4391 (Harvard 1113). Ff. 2-5 and 8-9 
(placed between ff. 1 and 2 of Viddana’s Vdr^i- 
katantra). Incomplete (I 6a-IV 11b and VI 4b-IX 
5c). 

PrSB 3594 (Berlin or. 6327). F. 60. Grantha. Incom¬ 
plete (verses 1-9). 

VSM (Upadhye) 12758. 2ff. Incomplete. 

*VVRI 1824. 14ff. Not copied in Saka 1802, but ff. 
1-5 contain adhikaras 1-2, and ff. 5-14 an udaha¬ 
rana with an example for Saturday 10 krsna- 
paksa of Vaisakha in Saka 1739 = 10 May 1817. 


^'BRAHMAN 

Additional manuscript of the Grahayajhamrta 
(see CESS A 4, 258b-259a), which is in the form of 
a dialogue between Brahman and Narada: 

BORI 226 of 1879/80 = BORI (Dharma) 405. 49ff. 
Copied by Kalyanajika Pandya, the son of Valla- 
bhaji Pandya of the Udicyajhati, a resident of 
Jarjaragrama, on Thursday 4 suklapaksa of 
Asvina in Sarn. 1866 = 12 October 1809. 


^BRAHMAN 

3. Additional manuscripts of the Brahmasiddhdnta of 
the Sdkalyasamhitd (see CESS A 4, 259a-260a; see 
also D. G. Dhavale [A5. 1981]): 

RORI (Alwar) 2614. 126ff. Copied in Sam. 1902 = 
A.D. 1845. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


241 


Poona, Mandlik. Jyotisha 10. 32ff. Copied in Saka 
1799 = A.D. 1877 from a manuscript belonging 
to Vyavahara Josi of Poona. 

Anandasrama 6681. With the Somasiddhanta. 

AS Bengal I.B.12. Bengali. 

BHU C.4831. 29ff. 

Mysore (1905) 838. 33pp. Incomplete (5 adhyayas). 

Mysore (1905) 855. 43pp. Incomplete (4 adhyayas). 

Mysore ORI *A.657. Ff. 1-143. Kannac^a. Incom¬ 
plete (adhyayas 1-7). 

Mysore ORI *P.1699. Ff. 1-50. Grantha. 

Mysore ORI *P. 1801/4. Ff. 299-309. Telugu. Incom¬ 
plete (3 adhyayas). 

Mysore ORI *P. 1934/2. Ff. 26-68. Nandinagari. 
Incomplete (3 adhyayas). 

Mysore ORI *P.2563. Ff. 1-48. Telugu. Incomplete 
(6 adhyayas). 

Mysore ORI *P.4439. Ff. 1-37. Nandinagari. 

Mysore ORI P.6851. Ff. 1-69. Telugu. 

Mysore ORI P.7068. Ff. 6-60. Telugu. Incomplete 
(adhyayas 1-3). 

Oxford CSS I 20 (M. 782 (3)). Ff. 1-22. 

Paris BN Sansc 1780c. Part of a manuscript of 226ff. 
Grantha. 

PUL II 3726. 36ff. 

RORI (Alwar) 2615. 8ff. (brahmapafi). 

RORI (Alwar) 5714. 39ff. 

RORI (Udaipur) 3421 (1). 44ff. 


^BRAHMAN 

Additional manuscripts of his Brahmasiddhanta 
= Brahmasamhitd (see CESS A 4, 260a-260b): 

GOML Madras D.3118. Ff. 37-44. Grantha. 
(jayantinirnaya). 

GOML Madras D.3364. Ff. 8v-9. Telugu. 

(pitrputraikanak§atrajananasantikalpa). 

GOML Madras D.3429. Ff. 46v-48v. Nandinagari. 

(vi§anagliprathamartavasanti; incomplete). 

GOML Madras D.17762. Ff. 107-107v. Telugu. 
(vi§anadikasanti). 

GOML Madras R.49(d). F. 13Iv. Grantha. (goma- 
hi§yadisanti). Purchased in 1910/11 from 
Minak§iyammaj of Koduvayur Palghat. 

Mysore ORI B. 117/53. Ff. 64-65. Kannada. 

(maghanaksatrajananasanti). 

Mysore ORI P.604/65. Ff. 83-92. Grantha. 

(malasle§ajananasanti). 

Mysore ORI P.734/38. Ff. 70-79. Nandinagari. (raja- 
svalasantikalpa). 

Mysore ORI P.2239/33. Ff. 29-34. Telugu. 


(asle§anak§atrajananasanti). 

Mysore ORI P.2239/39. Ff. 41-51. Telugu. (mOlana- 
k§atrajananasanti). 

Mysore ORI P.2239/79. Ff. 101-103. Telugu. (nava- 
grahayogasanti). 

Mysore ORI P.2579/10. Ff. 27-47. Nandinagari. 

(malanak§atrajananasanti). 

Mysore ORI P.2581/24. Ff. 49-52. Nandinagari. 

(du§tanak§atrarajasvalasanti). 

Mysore ORI P.2587/14. Ff. 22-58. Nandinagari. 

(prathamartavasanti). 

Mysore ORI P.3023/33. Ff. 16-21. Telugu. (mQlana- 
k§atrajananasanti). 

Mysore ORI P.3023/150. Ff. 89-90. Telugu. (nava- 
grahayogasanti). 

Mysore ORI P.3085/48. Ff. 59-60. Grantha. 
(mulaslesajananasanti). 

Mysore ORI P.3804/23. Ff. 36-46. Nandinagari. 
(mOIasle^ajananasanti). 

Mysore ORI P.3804/60. Ff. 104-107. Nandinagari. 
(visanadiprathamartavasanti). 

Mysore ORI P.3804/78. Ff. 131-132. Nandinagari. 
(sulaharasuladana). 

Mysore ORI P.3924/2. Ff. 10-17. Grantha. (pahca- 
grahayogasanti). 

Mysore ORI P.4180/57. Ff. 94-98. Nandinagari. 
(du§tanaksatrarajasvalasanti). 

Mysore ORI P.4180/69. Ff. 126-127. Nandinagari. 
(sahkrantisuladanavidhi). 

Mysore ORI P.4720/48. F. 79. Nandinagari. (ugrara- 
thasanti). 

Mysore ORI P.4863/32. Ff. 47-48. Telugu. (graha- 
yogasanti). 

Mysore ORI P.4863/106. Ff. 122-125. Nandinagari. 
(mulaslesajananasanti). 

Mysore ORI P.5313/38. Ff. 72-74. Nandinagari. 
(visanadiprathamartavasanti). 

Mysore ORI P.5587/25. Ff. 76-77. Nandinagari. 
(rahusanti). 

Mysore ORI P.5587/39. Ff. 109-110. Nandinagari. 
(grahanasanti). 

Mysore ORI P.5587/65. Ff. 141-143. Nandinagari. 
(vrksadivaikrtisanti). 

Mysore ORI P.5672/34. Ff. 39-54. Kannada, 
(mulanaksatrajananasanti). 

Mysore ORI P.5930/75. Ff. 94-96. Nandinagari. 
(grahayogasanti). 

Mysore ORI P.7401/119. 2ff. Telugu. (graha¬ 
yogasanti). 

Mysore ORI P.7684/7. Ff. 6-8. Telugu. (pahcagraha- 
yogasanti). 

Mysore ORI P.7970/85. Ff. 65-68. Nandinagari. 
(mulaslesajananasanti). 


242 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Nandinagari. 


Nandinagari. 


Mysore ORI P.7970/158. Ff. 186-187. Nandinagari. 
(maghanak§atrajananasanti). 

Mysore ORI P.8000/17. Ff. 21-22. Nandinagari. 
(pancamaristasanti). 

Mysore ORI P.8532/5. Ff. 86-92. Nandinagari. 
(mOlasle^ajananasanti). 

Mysore ORI P.9167/36. Ff. 48-50. Grantha. (vi§a- 
nadiprathamartavasanti). 

Mysore ORI P.9254/77. Ff. 63-64. 
(pancagrahayogasanti). 

Mysore ORI P.9254/166. Ff. 145-146. Nandinagari. 
(vi^anadiprathamartavasanti). 

Mysore ORI P.9254/181. Ff. 150-157. Nandinagari. 
(mOlasle^ajananasanti). 

Mysore ORI P.9254/202. F. 171. 
(darsajananasanti). 

Mysore ORI P.9254/213. Ff. 178-179. Nandinagari. 
(sinivalijananasanti). 

Mysore ORI P.9428/20. Ff. 12-13. Nandinagari. 
(visanadiprathamartavasanti). 

Mysore ORI P.9428/33. Ff. 19-20. Nandinagari. (tri- 
vidhagandasanti). 

Mysore ORI P.9764/3. Ff. 
vasantividhi). 

Mysore ORI P.9764/16. Ff. 40-42. Telugu. (vi§a- 
nadiprathamartavasanti). 

Mysore ORI P.9951/94. Ff. 116-117. 
(darsajananasanti). 

Mysore ORI P.9951/109. Ff. 

(mulaslesajananasanti). 

Mysore ORI P.9965/44. Ff. 48-50. Nandinagari. 
(visanadiprathamartavasanti). 

Mysore ORI P.10041/59. Ff. 95-96. Telugu. (pahca- 
grahayogasanti). 

Mysore ORI P.10070/53. Ff. 52-53. Nandinagari. 
(grahayogasanti). 

Mysore ORI P.10265/17. Ff. 9-11. Nandinagari. 
(visanadiprathamartavasanti). 

RORI Cat. XVI 36568. 21ff. 


15-19. Telugu. (sar- 
>lugu. (visa- 
Nandinagari. 
129-135. Nandinagari. 


*BRAHMAMUNI 


Additional manuscripts of his Jambudvipapra- 
jnaptivivrti (see CESS A 4, 260b-261a): 

*BORI 272 of 1883/84 = BORI (Agama) 250. Ff. 
1-176 and 178-235. 

*BORI 1259 of 1891/95 = BORI (Agama) 249. Ff. 
1-84 and 846-101. 

RORI (Jaipur) 8111. 333ff. (ff. 1-117, 122-125, 
127-133, 135-166, 168-183, 185-207, 210-237, 
240, 242-277, 282-300, and 314-324 missing). 
Incomplete. 


^BRAHMA VARDHANA 

Additional manuscript of his Kausalyakusumdva- 
ri on the Rudrakausalya (see CESS A 4, 261a): 

Kathmandu (1964) 54 (4548). 33ff. Incomplete. 


BRAHMASRUTA 

Author of a tika on the Trilokasdra of Nemi- 
candra {fl. ca. 975). Manuscript: 

Nagaur 1705. 46ff. 


^BRAHMADITYA 

Additional manuscripts of his Vivdhapafala (see 
CESS A 4, 2616): 

BORI 346 of 1879/80. 14ff. Copied in Sam. 1557 = 
A.D. 1500. Ascribed to Bhaskara. With the 
Prasnajhdna of Bhattotpala. 

RORI (Chittorgarh) 1425. 19ff. (ff. 1 and 6 missing). 
Copied by Dharanidhara Vyasa in Sam. 1821 = 
A.D. 1764. 

RORI (Chittorgarh) 2738. 28ff. Copied by Harsa- 
vija<ya> at Kaladi in Sarn. 1880 = a.d. 1823. 
RORI (Alwar) 2953. 23ff. Copied in Sarn. 1912 = 
A.D. 1855. 

RORI (Chittorgarh) 2735. 4ff. With the Rajasthani 
tabartha of Yasolabha. 

RORI (Jaipur) 6403. 3ff. With the Rajasthani 
Bdldvabodha of Yasolabha. No author men¬ 
tioned. 


BRAHMANANDA TRIPATHIN {fl. 1980/1988) 

A descendent of Sricandra Tripafhin of the 
Gautamagotra, a follower of the Kuthumasakha of 
the Samaveda, who moved with his son Sukadeva 
from Gurjaradesa to Kurmacala in Saka 1342 = a.d. 
1420 at the invitation of King Udyanacanda, and set¬ 
tled at Almoda, Muralidhara was the father of 
Manoratha, who had three sons: Haridatta, Srikr§na, 
and Taradatta. This last had two daughters and one 
son, Brahmananda, by his wife, Kha§ti, the daugh¬ 
ter of Siromani Pandeya; she died in Sam. 2005 = 
A.D. 1948. Brahmananda studied, at Kasi, ayurveda 
under Lalacandra Khiste, and then sahitya. He lived 
at Silavati in Nayanisarovara District of Kurmadri 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


243 


with his wife, Tara, four sons, and two daughters. 
His Hindi vyakhya, Tara, on Bhanunatha’s Vyava- 
hararatna was published as CSG 49, Varanasi 1980; 
2nd. ed. Varanasi 1983. Some verses of the paricaya 
at the end of that book are: 

tatraikadese yasasarn nidhano 
virajate gurjaradesa e§ah / 
yatrabhavad gautamagotrajanma 
satsamavedi kuthumakhyasakhi //3// 
candrasriya bhu§itasarvakayah 
sricandranama prathitas tripathi / 
yugmabdhiramaikasakabdamadhye 
vikhyatakirtir nrpatir babhuva //5// 
udyanacandah sujanabhiramah 
kurmacaliyo ’bhinavah sasahkah / 
rajye tadiye sukadevanamna 
sricandradevah svasutena sakam II6II 
kurmadrer mukufe nisargarucire kosisuvamlavrte 
srigvallagananathasaimamahite nandakhyadevya 
yute / 

devaih siddhamahar§ibhir budhajanaih sarnsevite 
praktanair 

almodanagare sametya sasukharn vasarn svakiyarn 
vyadhat //?// 

tasmin sudharnsuvimale sukule babhuva 
sriman satam gunadharo muralidharo ’yam / 
yasyavadatacaritany adhunapi martya 
adarsavad vyavaharanti na vismayo ’tra //13// 
tasmad babhuva sudine svakulavatarnsah 
prajhah pratapavimalo dvijakarmani§thah / 
pitror manorathasataih sukrtair anekair 
manyo manoratha iti prathitabhidhanah //14// 
jatas tato balaparakramasilayuktah 
putrah kusagradhi^anas traya eva yogyah / 
tesv agrimah suvidito haridatta nama 
svalpayur eva suralokam agat svapunyaih //15// 
tasyanujah saccaritah surupah 
srikrsnanama mahaniyakirtih / 
bha§anuragat sa gato videsam 
snigdhan samagran pravihaya bandhOn //16// 
bhrata citrakalasu tasya nipunah sahgitavit sattvikah 
sadvaidyah sukrti paropakarano grhyagame para- 
gah / 

nityarn sambhupadaravindayugale sraddha- 
samrddhasayas 

tarMattabudhas tripathikulajah sammanasimancitah 

// 17 // 

patni tadiya gunasilayukta 
kha^fiti namni patibhaktini^tha / 
kanyatha pandeyasiromaneh sa 
prasuta kanye sutam ekam idyam //18// 
divahgata pahcakhasunyayugme 
sarnvatsare sravanamasi kr§ne / 


gauritithau punyavati sanau sa 
kutumbahardarn sahasa vihaya //19// 
tatsunur jananiviyogavasatah svadhyayabuddhya 
grhat 

kasim prapya bhi§agguror adhijage srilala- 
candrabhidhat / 

ayurvedam itah pararn guruvarat khistenva- 
vayodbhavad 

brahmanandabudho ’pafhat sulalitarn sahityavidyam 
api //20// 

tatpatni sakalakalasu kusala tarabhidha srimati 
putran sa susuve kramena caturah kanyadvayarn 
prak tatah / 

putrah sarnskrtavahmayarn punar ime pascatya- 
vidyam api 

srivisvesakrpakataksavasatah sarve pathanty adarat 

// 21 // 

kurmadrau nayanisarovaram iti khyatarn ca yan 
mandalarn 

tasyaivasti samipavarti sumahad bhimabhidhanarn 
sarah / 

prak tasyasti silavatiti vidito gramo ’bhiramo dvijais 
tasmin brahmakuti tadiyavasatih puspoccayaih 
sobhita II22II 

These verses are repeated at the end of his 
Samskrta and Hindi fikas on the Grahalaghava of 
Ganesa, published as CSG 125, Varanasi 1987, and 
at the end of his Hindi tika, Tara, on the 
Ekadaslmahatmya, published as Caukhambd Stotra- 
vratakatha Granthamdld 4, Varanasi 1988. 

*BRAHMARKA 

Additional manuscripts of his Prasnajhdna (see 
CESS A 4, 261b-262b): 

Oxford (Vyasa) 123. Ff. 1-7. Copied by Ranachoda 
on Thursday 3 krsnapaksa of Vaisakha in Sarn. 
1732, Saka 1598 = 29 April 1676. 

RORI (Alwar) 2837 = *Alwar 1864. 13ff. Copied in 
Sam. 1912 = a.d. 1855. 

BHU B.3718. lOff. 

BHAG AVAN A 

Collaborator in a Ganita. Manuscripts: 

Bhubaneswar 2.G/12 = Bhubaneswar IV ganita 14 
(G/12). 183ff. Oriya. Copied in Sal. San 1289 = 
A.D. 1881, the 21st ahka of Divyasimha. From 
Puri. 


244 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Bhubaneswar 2.G/85. 


PANDITA BHAGIRATHA (ft. 1451) 

Author of a Prastavasagara in 14 tarahgas in 
Sam. 1508 = a.D. 1451. Manuscript: 

Delhi Jaina (Dharmapura) 429 (Ir 36 (ka)). 129ff. 
Copied in Sarn. 1890 = A.D. 1833. Incomplete. 


BHATTADATTA 

Author of a Grahapradlpasarinl. Manuscript: 

RORI (Bikaner) 15919. 102ff. Copied at Bikanera in 
Sam. 1804 = a.d. 1747. 


BHAJTAPADA (fl. before 1350) 

An authority cited by Vi^nusarman (/?. ca. 1370) 
on VidyamMhavlya 4, 32 (vol. 1, p. 309) and on 12, 
1 (vol. 3, p. 47). 


*BHATTOJI DlK^ITA 

Additional manuscripts of his Jatakdlahkara (see 
CESS A 4, 264a): 

Mysore ORI *P.3186/3. Ff. 52-67. Grantha. 

Mysore ORI P.9301. 7ff. Nandinagari. 


*BHATTOJI DlK$ITA (fl. ca. 1550/1600) 

1 . Additional manuscripts of his Tithinirnaya (see 

CESS A 4, 264a-266b): 

.Mysore ORI C.229. Ff. 1-23. Copied on Saturday 15 
suklapak^a of Margasir§a in Sarn. 1750 = 2 
December 1693. 

Jaipur (Dharma) 88 (4). 29ff. Copied by Madhava 
on Sunday 11 suklapak^a of Pau§a in Sarp. 1758 
= 28 December 1701. 

RORI Cat. XVI 34261. 52ff. Copied by Badaridasa 
at Jodhapura in Sarp. 1766 = A.D. 1709. 

RORI Cat. IX 29521. 30ff. Copied in Sam. 1773 = 
A.D. 1716. 

Harvard Indie 2475. F. 25. Copied by Gopinatha 
Visvarupa Dik§ita, the son of Viresvarabhatta 
Visvarupa. at Datiyagrama on Sunday 7 kr§na- 


pak§a of Vaisakha in Sarp. 1791 = 12 May 1734. 
Incomplete. 

Jaipur (Dharma) 88 (5). 37ff. Copied by Gulabaraya 
at Mulasthana in Sarp. 1811 = a.d. 1754. 

BHU B.2602. 31ff. Copied in Sam. 1830 = a.d. 
1773. 

*BORI 73 of 1891/95 = BORI (Dharma) 501. 43ff. 
Copied by Sevakarama, the son of Marpeharama 
Bhatta, a resident of Srutibhu^anapura, on 
Thursday 3 suklapak^a of Caitra in Sarp. 1854 = 
30 March 1797. 

*BORI 191 of 1886/92 = BORI (Dharma) 500. 48ff. 
Copied by Gulabasirpha on 7 suklapak§a of A$a- 
dha in Sarp. 1876 = ca. 29 June 1819. 

RORI (Alwar) 3594. 36ff. Copied in Sarp. 1886 = 
A.D. 1829. 

Vrndavana 3368. 82ff. (f. 1 missing). Copied in Sarp. 
1898 = A.D. 1841. Incomplete. 

GJRI 5309/340. Ff. 17-58. Maithili. Copied in Saka 
1815 = A.D. 1893. Incomplete. 

BHU C.49. lOff. Sarada. 

BHU C.4525. 35ff. 

*BORI 548 of 1883/84 = BORI (Dharma) 499. 41ff. 

*BORI 141 of Vishrambag I = BORI (Dharma) 
502. 25ff. 

RORI Cat. VII 26161. 31ff. (f. 1 missing). Incom¬ 
plete. 

Vrndavana 4326. 51ff. (ff. 1-3 missing). Incomplete. 

2. Additional manuscripts of his Kalanirnaya (see 

CESS A 4, 267a-268a): 

*BORI 29 of A 1882/83 = BORI (Dharma) 282. 
27ff. Copied by Visvanatha on Saturday 11 suk- 
lapak§a of Pau§a in Sarp. 1742, Saka 1609 (read 
1607) = 26 December 1685. 

*BORI 345 of 1891/95 = BORI (Dharma) 278. lOff. 
and If. Copied by Raghunandana for Ramanan- 
dana and Raghunandana, the sons of Gaiigadhara, 
the son of Hari of the Gaudajnati, on Friday 10 
suklapaksa of Magha in Sani. 1763 = 31 January 
1707. The extra folium contains the beginning of 
his Asaucasahgrahavydkhyd. 

*BORI 243 of 1887/91 = BORI (Dharma) 280. 25ff. 
Copied by Jivanarama Dvivedin on Wednesday 6 
kr§napak§a of Phalguna in Sarp. 1820 = 21 
March 1764. 

RORI (Alwar) 3627. 32ff. and 2ff. Copied in Sam. 
1886 = A.D. 1829. 

*BORI 344 of 1891/95 = B 9 RI (Dharma) 281. 37ff. 
Copied by Arttarama Sarman on Saturday 9 
kr§napak§a of Pau§a in Sam. 1890, Saka 1755 = 

1 February 1834. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


245 


Jaipur (Dharma) 598. 65ff. Copied by Ramapratapa 
on 7 kr§napak§a of Sravana in Sarn. 1950 = ca. 
3 September 1893. 

BHU C.2320. 20ff. 

*BORI 253 of A 1881/82 = BORI (Dharma) 279. 
22 ff. 

Jaipur (Dharma) 593. 37ff. 

Mysore ORI B.44. Ff. 1-58. Kannada. 

Mysore ORI C.219. Ff. 1-24. 

*Poona, Mandlik. Sundry in Daily Ritual 27. No ff. 
given. 

RORI (Alwar) 3628. 23ff. 

3. Additional manuscripts of his Caturvimsatimata- 
vyakhya (see CESS A 4, 268a-269b): 

BORI 172 of 1895/1902 = BORI (Dharma) 444. 
82ff. Copied on a Tuesday in the suklapak§a of 
Sravana in Sarn. 1715 = 20 or 27 July 1658. 
(sarnskara). 

Mysore ORI C.183. Ff. 1-30. Copied on 11 sukla- 
paksa of Jye^tha in Saka 1587 = ca. 15 May 
1665. (sraddha). 

*BORI 45 of A 1883/84 = BORI (Dharma) 437. Ff. 
68-83. Copied by Vamsidhara Vyasa at Mathura 
on Tuesday 1 suklapak§a of Phalguna in Sam. 
1727 = 31 January 1671. (acara; incomplete). 
*BORI 66 of 1899/1915 = BORI (Dharma) 438. 
37ff. Copied on 11 suklapak§a of Magha in 
<Saka> 1648, a Parabhavasarnvatsara = ca. 21 
January 1727. (acara). 

*BORI 251 of 1887/91 = BORI (Dharma) 442. 28ff. 
Copied by Jivanarama Dvivedin on Tuesday 4 
suklapaksa of Phalguna in Sarn. 1820 = 6 March 
1764. (sraddha). 

Benares (1956) 13440. Ff. 1-16. Copied in Sam. 

1832 = A.D. 1775. (asauca). 

Benares (1956) 13489. Ff. 1-36. Copied in Sarn. 

1837 (?) = A.D. 1780 (?). (sraddha). 

Benares (1956) 12312. Ff. 1-69. Copied in Saka 
1710 = A.D. 1788. No author mentioned. 

Benares (1956) 13900. Ff. 1-17, 19-28, and 31. Cop¬ 
ied in Sarn. 1860 = A.D. 1803. (prayascitta; 
incomplete). No author mentioned. 

Benares (1956) 13488. Ff. 1-166. Copied in Saka 
1159 (read 1759?) = a.d. 1837 (?). (acara). 

RORI (Alwar) 3768. 47ff. Copied in Sam. 1904 = 
A.D. 1847. (prayascitta). 

RORI (Alwar) 3769. 39ff. Copied in Sarn. 1908 = 
A.D. 1851. (prayascitta). 

*BORI 35 of 1866/68 = BORI (Dharma) 435. 118ff. 
Copied by Vyahkatacarya GhalasasI, a resident 
of Karhatakak§etra, on Monday 11 suklapaksa of 
Pausa in Saka 1789, which is 6 Janevari 1868, 


from a manuscript belonging to Ananta Limaye 
which had been copied on Saturday 5 kr§iiapaksa 
of Sravaiia in Sarn. 1756 = 5 August 1699. 
(acara). 

*Poona, Mandlik. Smrti and Dharma 73. 162ff. Cop¬ 
ied in Saka 1802 = a.d. 1880. 

AS Bengal III.E.25. (ahnika). 

Benares (1956) 12245. Ff. 1-42. (prayascitta). 
Benares (1956) 12487. Ff. 1-16. (sarnskara; incom¬ 
plete). 

Benares (1956) 12542. Ff. 2-84. (acara; incomplete). 
Benares (1956) 12575. Ff. 1-59. (sarnskara). 

Benares (1956) 12726. Ff. 42-43. (prayascitta; 

incomplete). No author mentioned. 

Benares (1956) 12775. 80ff. 

Benares (1956) 12960. Ff. 3-12 and 25-37. Incom¬ 
plete. No author mentioned. 

Benares (1956) 13209. Ff. 1-9. (asauca). 

Benares (1956) 13509. Ff. 1-29 and 34-46. (prayas¬ 
citta; incomplete). 

Benares (1956) 13692. Ff. 1-81. Incomplete. No 
author mentioned. 

BHU B.2613. 9ff. Incomplete. 

BHU B.2619. 23ff. 

BORI 69 of A 1879/80 = BORI (Dharma) 153. Ff. 

1-59 and 59b-103. (acara; incomplete). 

BORI 249 of A 1881/82 = BORI (Dharma) 154. Ff. 

1-12 and 14-48. (acara; incomplete). 

*BORI 181 of 1886/92 = BORI (Dharma) 440. 37ff. 
(prayascitta). 

*BORI 315 of 1886/92 = BORI (Dharma) 443. 23ff. 
(sraddha). 

*BORI 355 of 1891/95 = BORI (Dharma) 436. 50ff. 
(acara; incomplete). 

BORI 387 of 1891/95 = BORI (Dharma) 441. Ff. 
1-49 and 51. (prayascitta). 

BORI 93 of 1895/1902 = BORI (Dharma) 156. Ff. 

1-50, 46b-50b, and 51-65. (acara; incomplete). 
*BORI no of 1895/1902 = BORI (Dharma) 439. 

Ff. 57-73. (acara; incomplete). 

BORI 163 of Vishrambag I = BORI (Dharma) 155. 
82ff. (acara). 

Mysore ORI B.37. Ff. 1-118. (acara). 

Mysore ORI B.38. Ff. 119-237. (sarnskara). 

Mysore ORI C.113. Ff. 1-65. (acara). 

Mysore ORI C.128. Ff. 1-40. (prayascitta). 

Mysore ORI C.2889/1. Ff. 1-49. (prayascitta). 

Mysore ORI C.2889/2. Ff. 1-86. (sarnskara). 

Mysore ORI P.7474/1. Ff. 1-54. Kannada, (acara). 
RORI (Alwar) 3694. 45ff. (sraddha). 

VSM (Upadhye) 12358. 82ff. (ahnika). 


246 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


BHATTOTPALA 

Alleged author of a vivarana on the Jyotisaratna- 
mala of Sripati (fl. 1039/1056). Manuscripts: 

Kathmandu (1965) 50 (3234). 174ff. Nevari. 
Kathmandu (1965) 51 (3444). No ff. given. Nevari. 
Incomplete. 

The colophon begins: iti srimadbhattotpalavi- 
racitayarn. 

BHATTOTPALA 

Alleged author of a BhauotpaH, which is a fika 
on a Ramalaprasnavicara; cf. the Ramalarahasya of 
Bhattotpala (see CESS A 4, 269b). Manuscript: 

BHU C.2005. llff. 


^bhattotpala (fl. 966/969) 

Concerning this author see also P. V. Kane [A5. 
1947]. 

1. Additional manuscripts of his Samhitavivrti (see 
CESS A 4, 270b-272a): 

Delhi Jaina (Dharmapura) 435 (Ir 32 (ka)). 624ff. 

Copied in Sarn. 1609 = a.d. 1552. 

GJRI 9608/1005. Ff. 1-197, 199-373, 375-376, 
378-451, 491-518, and 520-569. Copied in Sarn. 
1611 = A.D. 1554. Incomplete. 

Poona, Mandlik. Jyotisha 2. 570ff. Copied in Sarn. 
1667 = A.D. 1610. 

PrSB 2929 (Gottingen, Sanscr. Madh. 23). Ff. 24-27, 
357-359, 361, 371-377, and 407-536. Copied by 
Ghanasyama at Kasipura on Wednesday 7 
kr§napak§a of Bhadrapada II in Sarn. 1806, Saka 
1671 = 20 September 1749. Incomplete (adhya- 
yas 24-35 and 60-100). 

RORI Cat. IV 21603. 495ff. Copied by Svaruparama 
Caube in Sarn. 1831 = a.d. 1774. 

RORI Cat. IV 20053. 832ff. (f. 597 missing). Copied 
in Sarp. 1917 = a.d. 1860. 

RORI Cat. IV 18476. 65ff. Copied in Sarn. 1931 = 
A.D. 1874. Incomplete (vastumahodadhi). 

AS Bengal I.D.22. 

BHU C.4781. 186ff. Incomplete. 

Bhubaneswar 2.Jy/325. 

*Jaipur (Khasmohor) 5529. 

Jodhpur 825 (A). 256ff. 


RORI Cat. IV 21060. 49ff. 

RORI (Alwar) 6091. 13ff. Incomplete (nak§atra- 
kurma). 

RORI (Udaipur) 3675. 7ff. Incomplete (vatacakra). 

2. Additional manuscripts of his Jagaccandrika (see 

CESS A 4, 272a-275a): 

BHU B.824. 27ff. Copied in Sam. 1711 = a.d. 1654. 
Incomplete. 

VSM (Upadhye) 12794. 301ff. Copied by Hari Sende 
in Saka 1635 = A.D. 1713. 

EDI (LDC) 1628. 25Iff. Copied in Sarn. 1860 = 
A.D. 1803. 

Vrndavana 9482. 27ff. Copied in Sarn. 1901 = a.d. 
1844. 

Nagaur 1045. 172ff. Copied in Sarn. 1942 = a.d. 
1885. 

AS Bengal 6939 (G.5298) IV. 25ff. Bengali. Incom¬ 
plete. 

AS Bengal I.B.l. Bengali. 

BHU C.2. 246ff. Sarada. 

BHU C.1077. 25ff. Sarada. Incomplete. 

BHU C.3469. 152ff. 

BHU C.4118. 291ff. Sarada. Incomplete. 

Delhi Jaina (Dharmapura) 419 (No. 9). 24ff. Incom¬ 
plete. 

GJRI 11180/1234. Ff. 56-79 and 178-184. Incom¬ 
plete. 

^Jaipur (Khasmohor) 5515. 

Mysore ORI C.4250. Ff. 1-39. Incomplete. 

Mysore ORI P.5057. Ff. 1-173. Telugu. 

Mysore ORI P.5461/1. Ff. 1-155. Kannada. Incom¬ 
plete (to dre^kariadhyaya). 

Mysore ORI P.6052/4. If. Telugu. Incomplete (a- 
dhyayas 1-2; incomplete). 

Mysore ORI P.7502. Ff. 1-29 and 5ff. Nandinagari. 
Incomplete (adhyayas 1-10). 

Mysore ORI P.7725. Ff. 1-82. Telugu. Incomplete 
(rasyadhyaya). 

Mysore ORI P.7832/2. Ff. 1-87. Nandinagari. 
Incomplete (to dre^katiadhyaya). 

Mysore ORI P.9937/2. Ff. 82-120. Telugu. Incom¬ 
plete (adhyayas 13-21). 

Mysore ORI P.10674/b. Ff. 1-103. Telugu. Incom¬ 
plete (ends with tulavrscikasthitaphala). 

New Delhi, N.M. 57/106/1628. 103ff. 

NPS (Sanskrit) 8321. 50ff. Incomplete. 

Poona, Mandlik. Jyotisha 21. 308ff. Incomplete. 

RORI Cat. XVI 34626. 165ff. 

RORI Cat. XVI 35516. 74ff. Incomplete. 

RORI (Alwar) 2704. 295ff. Incomplete (begins in 
adhyaya 7). 

RORI (Alwar) 2708. 60ff. 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


247 


RORI (Udaipur) 5518. 238ff. (ff. 1, 105, 130, 132, 
142, 146, 170, 175, 180, and 196 missing; ff. 167 
and 178 repeated). Incomplete. 

WHMRL a 130. Ff. 1-54. Sarada. Incomplete 
(introductory verses only). 

WHMRL a 133. Ff. 1-16. Sarada. Shortened ver¬ 
sion. Incomplete (adhyaya 7). 

The Jagaccandrika was also published at Kalyana- 

Mumbai in Sam. 1980, Saka 1845 = a.d. 1923; and 

the edition by Sitarama Jha was reprinted at Vara¬ 
nasi in 1983. 

3. Additional manuscripts of his Sisyahitd (see CESS 

A 4, 275a-277a): 

RORI Cat. VI 24525. 2Iff. Copied by Vasana, the 
pupil of Tejana, in Sarn. 1649 = A.D. 1592. 

RORI Cat. VI 24255. 36ff. Copied in Sam. 1676 = 
A.D. 1619. 

RORI (Bikaner) 14690. 29ff. Copied at Vrnda- 
vatinagara in Sarn. 1688 = a.d. 1631. 

RORI Cat. IV 19858. 7ff. Copied at Javalapura in 
Sarn. 1760 = a.d. 1703. Incomplete (ut- 

patadhyaya). 

Benares (1963) 35665. Ff. 1-5; and 1-30. Copied in 
Sam. 1804, Saka 1669 = a.d. 1747. Incomplete. 

Nagaur 1039. lOff. Copied on 3 suklapak§a of Phal- 
guna in Sarn. 1819 = ca. 15 February 1763. 

RORI Cat. IV 19851. 67ff. (f. 10 missing). Copied at 
Jodhapura in Sam. 1831 = a.d. 1774. 

Nagaur 1037. 21ff. Copied in Sam. 1835 = a.d. 
1778. 

GJRI 9766/1021. Ff. 1-49. Copied in Saka 1709 = 
A.D. 1787. 

GJRI 11132/1186. Ff. 3-9. Maithili. Copied in Saka 
1715 = A.D. 1793. Incomplete. 

RORI (Chittorgarh) 4191. 19ff. Copied by Dharma- 
canda at Pallikapura in Sarn. 1852 = a.d. 1795. 

GJRI 8653/878. Ff. 1-26. Maithili. Copied in Saka 
1731 = A.D. 1809. 

Poleman om. (Columbia, Smith Indie 15). 44ff. Cop¬ 
ied by Nandarama in Sarn. 1883 = a.d. 1826. 

RORI Cat. VI 24098. 19ff. Copied by Pasadatta at 
Medata in Sarn. 1890 = a.d. 1833. 

New Delhi, B. H. Fall 1. 32ff. Copied by Sahava 
Rama in the house of Baladeva Lala Misra at 
Mathura on Tuesday 13 suklapak§a of Mar- 
gasirsa in Sarn. 1893 = 20 December 1836. 

RORI (Alwar) 2710 = *Alwar 1947. 44ff. Copied in 
Sarn. 1912 = A.D. 1855. 

VSM (Upadhye) 12792. 48ff. Copied in Saka 1781 
= A.D. 1859. 

BHU B.178. 14ff. Incomplete. 


BHU C.74. 56ff. Sarada. Incomplete. 

BHU C.2828. 44ff. Incomplete. 

BHU C.4175. 41ff. Sarada. 

BHU C.4527. 26ff. 

BHU C.4650. 33ff. Sarada. Incomplete. 

BHU C.5084. 24ff. Sarada. Incomplete. 

GJRI 8652/877. Ff. 1-21. Maithili. Incomplete. 

GJRI 11136/1190. Ff. 3-32. Incomplete. 

GJRI 11137/1191. Ff. 1-25. Maithili. Incomplete. 
^Jaipur (Khasmohor) 5354; and 5532. 

Mysore ORI C.2885/2. Ff. 1-33. 

Mysore ORI *P.1675/6. Ff. 37-163. Grantha. 

Nagaur 1036. 19ff. 

Nagaur 1038. 5ff. 

Panjab JB I 2249 (Nakodar 96). 30ff. 

Pattan II 8857. 7ff. 

PrSB 3636 (Berlin or. fol. 2884). 18ff. 

RORI Cat. IV 18331. 139ff. 

RORI Cat. IV 20313. 16ff. Incomplete. 

RORI Cat. XVI 34792. 15ff. Incomplete. 

RORI (Bikaner) 14734. 31ff. (f. 1 missing). Incom¬ 
plete. 

RORI (Chittorgarh) 1353. Off. Incomplete. 

RORI (Udaipur) 5211. 35ff. (ff. 4, 10, 14, and 27 
missing). (Jdtakatlkd). Incomplete. 

4. The Brhadydtrd^Xkd (see CESS A 4, 277a) was 
edited by Deviprasada Larnsala at Ka^thamaridapa 
in Sarn. 2026 = A.D. 1969. 

5. Additional manuscripts of his Yogaydtrdtikd (see 
CESS A 4, 277a-277b): 

BHU C.4689. 132ff. Copied in Saka 1600 = a.d. 
1678. Incomplete. 

RORI (Alwar) 2944 = *Alwar 1876. 125ff. Copied 
in Sarn. 1911 = a.d. 1854. 

AS Bengal III.G.4. 

BHU B.116. 47ff. Incomplete. 

7. Additional manuscripts of his ^atpahcdsikd{lkd 
(see CESS A 4, 277b-281b): 

Pattan II 8862. 9ff. Copied in Sarn. 1629 = a.d. 
1572. 

RORI Cat. XVI 34054. 6ff. Copied by Jhanasagara 
Gaiii at Paheakadurgarajanipura in Sarn. 1640 = 
A.D. 1583. 

Oxford CSS I 490 (*d. 785 (3)). Ff. 1-17. Copied on 
Wednesday 4 kr§iiapak§a of Pau§a in Sarn. 1706, 
Saka 1571 = 9 January 1650. 

Pattan II 13932. 9ff. Copied in Sarn. 1730 = a.d. 
1673. 


248 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


Jodhpur 831. 20ff. (f. 1 missing). Copied by Siva- 
rama Purohita in Sam. 1737 = a.d. 1680. Incom¬ 
plete. 

RORI Cat. IV 20326. 4ff. Copied by Amara at Jala- 
puri in Sam. 1764 = A.D. 1707. 

RORI (Chittorgarh) 4725. 14ff. Copied in Sam. 1766 
= A.D. 1709. With a Rajasthani BMavabodha. 

RORI Cat. IX 29193. 7ff. Copied by Dayasimha at 
Pali in Sarn. 1768 = A.D. 1711. 

RORI (Bikaner) 14655. Ff. 1-9. Copied on 9 sukla- 
pak§a of Magha in Sarn. 1780 = ca. 23 January 
1724. With a Rajasthani Bdlavabodha. 

VSM (Upadhye) 12756. Ff. 1-2 and 11-29. Copied 
by Ramacandra in Saka 1651 = a.d. 1729. 

Incomplete. 

Panjab JB I 2663 (Patti 290). 14ff. Copied in Sarn. 
1789 = A.D. 1732. 

PrSB 3623 (Berlin or. oct. 882). 18ff. Copied on 8 
suklapak§a of Phalguna in Sarn. 1799 = ca. 20 
February 1743. 

RORI (Bikaner) 14648. 23ff. Copied in Sarn. 1808 
= A.D. 1751. 

RORI (Chittorgarh) 1657. 9ff. Copied in Sarn. 1810 
= A.D. 1753. 

Vrndavana 3618. 33ff. Copied on Wednesday 4 
kr§napak§a of A§adha in Sarn. 1820 = 18 July 
1764. 

BHU C.2496. 17ff. Copied in Sam. 1833 = a.d. 
1776., 

PrSB 3622 (Berlin or. fol. 1652). 14ff. Copied by 
Sevagarama on Saturday 3 kr§napak§a of Sra- 
vana in Sarn. 1849 = 4 August 1792. 

RORI (Jaipur) 5509. 24ff. Copied in Sarn. 1854 = 
A.D. 1797. 

Oxford CSS I 491 (*c. 315 (3)). Ff. 1-11. Copied by 
Gaiigadhara Visvarupa at Amaradurga on Wed¬ 
nesday 2 kr^napaksa of Caitra in Sarn. 1863 = 
22 April 1807. 

Oxford CSS I 492 (*c. 316 (2)). Ff. 1-17. Copied by 
Sivanatha Bhatta at Gokula on Wednesday 13 
kr§napak§a of Vaisakha in Sarn. 1866, Saka 1731 
= 10 May 1809. 

Nagaur 1073. 27ff. Copied on Wednesday 15 sukla- 
pak§a of Caitra in Sarn. 1877 = 29 March 1820. 

BHU B.691. 31ff. Copied in Sarn. 1879 = A.D. 1822. 

BHU C.3557. 4ff. Copied in Sarn. 1890 = A.D. 1833. 

RORI (Chittorgarh) 748. I9ff. Copied by Biharilala 
Primal! at Khareti (Nagora) in Sam. 1890 = 
A.D. 1833. 

BHU C.4789. 27ff. Copied in Sam. 1906 = a.d. 
1849. 

RORI (Alwar) 6198. 16ff. Copied by Devadatta Sar- 
man in Sarp. 1908 = a.d. 1851. 

RORI (Alwar) 2851. 20ff. Copied by Nirbhayarama 


in Sarn. 1910 = a.d. 1853. 

*WHMRL G.5.C. Ff. 1-24. Ff. 23-24 are copied by 
Vrndavana on Sunday 3 suklapak§a of Asadha in 
Sam. 1916 = 3 July 1859. 

RORI (Alwar) 6202. 6ff. Copied in Sarn. 1921 = 
A.D. 1864. Incomplete. 

GJRI 8704/929. Ff. 1-15. Maithili. Copied in Saka 
1789 = A.D. 1867. 

RORI Cat. IX 29118. 17ff. Copied by Ramakarnvara 
at Chavani in Sarn. 1926 = a.d. 1869. 

RORI (Alwar) 5581. 12ff. Copied by Premadasa 
Mahanta in Sam. 1928 = A.D. 1871. 

RORI (Alwar) 5468 (5). Ff. 11-27. Copied in Sarn. 
1942 = A.D. 1885. 

AS Bengal I.A.62. Bengali. 

BHU C.2394. 28ff. Incomplete. 

BHU C.3671. 22ff. Incomplete. 

Bhubaneswar IV 165 (Jy/23). 76ff. Oriya. Incom¬ 
plete. From Ranapur, Puri District. 

Bhubaneswar IV 166 (Jy/32a). 6ff. Oriya. From Ba- 
ripada, Mayurbhanj District. 

GJRI 8705/930. Ff. 1-14. Maithili. 

GJRI 8706/931. Ff. 1-20. Maithili. 

GJRI 11171/1225. Ff. 1-8. Maithili. Incomplete. 

^Jaipur (Khasmohor) 2115 (32); 5282; 5435; 5585; 
and 5599. 

Mysore (1905) 620. 53pp. Telugu. 

Mysore (1905) 660. Pp. 46-68. Grantha. 

Mysore ORI P.852/5. Ff. 18-43. Grantha. 

Mysore ORI P.4481/3. Ff. 13-17. Nandinagari. 

Mysore ORI P.4542/16. Ff. 33-45. Telugu. Incom¬ 
plete. 

Mysore ORI *P.5217/2. Ff. 1-24. Telugu. 

Pattan II 10222. 14ff. 

RORI Cat. V 22638. lOff. 

RORI Cat. IX 29257. 32ff. 

RORI Cat. XVI 35333. Ff. 2-6. Incomplete. 

RORI (Alwar) 2850. 20ff. 

RORI (Bikaner) 14647. 6ff. 

RORI (Bikaner) 14649. 6ff. 

RORI (Bikaner) 15885. 13ff. Copied by Bhuvanavi- 
sala. With a Prasnasloka on ff. 12-13. 

RORI (Bikaner) 17332. lOff. 

RORI (Bikaner) 17381. 4ff. Copied by Saradharma 
Gani. 

RORI (Bikaner) 17383. 21ff. 

RORI (Chittorgarh) 4776. 16ff. Incomplete. 

RORI (Jaipur) 8022. 4ff. (f. 1 missing). Incomplete. 

RORI (Udaipur) 4868. Ff. 1-13. Incomplete. 

Visvabharati (Adyar) 736(d). llff. Telugu. Incom¬ 
plete. 

Vrndavana 6631. 20ff. 

WHMRL 7 241. Ff. 1-21. Incomplete (ends in 7, 3). 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


249 


8. Additional manuscripts of his Prasnavidyaiika 
(see CESS A 4, 281b-282a): 

RORI Cat. IX 28718. 18ff. Copied in Sam. 1801 = 
A.D. 1744. 

RORI Cat. VIII 27285. 13ff. 

RORI (Chittorgarh) 4176. 3ff. No author mentioned. 

10. Additional manuscripts of his Prasnajhdna (see 
CESS A 4, 282a-283b): 

Kathmandu (1905) vol. 2, p. 106. Ff. 44-49. 
Maithili. Copied by Jayabhadra on Sunday 7 suk- 
lapak§a of Jye^fha in Nep. Sarn. 473 = 12 May 
1353, during the reign of Jayarajadeva. Property 
of Suryacarana Rajopadhyaya. 

RORI Cat. IV 20353. 2ff. Copied at Bhuriyavasani 
in Sarn. 1712 = A.D. 1655. 

RORI Cat. IV 20715. 2ff. Copied by Srinatha in 
Sarn. 1732 = A.D. 1675. 

RORI (Jaipur) 9253. 3ff. Copied in Sarn. 1854 = 
A.D. 1797. 

BHU C.3272. 8ff. Copied in Sarn. 1955 = A.D. 1898. 
(BkaUotpaPi). 

BHU C.4886. 17ff. With a fika. (Bhauotpall).. 
GJRI 8532/757. Ff. 1-7. Maithili. 

GJRI 8533/758. Ff. 1-6. Maithili. Incomplete. 

GJRI 8555/780. Ff. 1-5. Maithili. 

GJRI 11082/1136. Ff. 1-5. Maithili. 

Kathmandu (1964) 20 (7067). 4ff. 

Osmania University B.9/5c. 2ff. Incomplete (31 
verses). No author mentioned. 

RORI Cat. IX 29593. 7ff. With an udaharana. 

RORI Cat. XVI 34300. 4ff. 

RORI (Alwar) 2884 = *Alwar 1863. 5ff. 

RORI (Bikaner) 15893. 2ff. 

RORI (Chittorgarh) 1784. 2ff. Copied by Amaracan- 
dra Brahmaria. 

RORI (Jaipur) 4954. 7ff. 

RORI (Jaipur) 7917. 3ff. With a vivararia. 

RORI (Jaipur) 8788. 2ff. 

A tika on the Suryasiddhdnta by Bhatfotpala is 
quoted by Divakara (b. 1606) in his Praudhamano- 
rama. See p. 29, fn. 2, in K. S. Shukla’s edition of 
the Suryasiddhanta. 


*BHADALI 

Additional manuscripts of his Bhadaltvakya or 
Meghamdla (see CESS A 4, 283b-284b): 

LDI (GujarMi) 3770 (4054) = *LDI (MPC) P/4054. 


lOff. Copied by Muni Dhanasomaji at Vitodara 
in Sarn. 1845 = A.D. 1788. 

LDI (Gujarati) 3765 (2708). 8ff. Copied by Durla- 
bha Suri in Sarn. 1890 = A.D. 1833. 

Udaipur RVSS 883. 9ff. Copied by Devasahkara 
Bhavanisaiikara in Sarn. 1938 = A.D. 1881. 

LDI (Gujarati) 3769 (1630) = *LDI (MPC) P/1630. 
12ff. Copied by Goradhana at Palana in Sarn. 
2011 = A.D. 1954. 

Jodhpur (Hindi/Rajasthani) 395. llff. (Bhadallpu- 
rdna). 

LDI 6801 (3514). llff. (ff. 1-6 missing). (Janmapa- 
tn Bhaddall Mi vicdra). Incomplete. 

LDI (Gujarati) 3762 (619). 18ff. Copied by Rupasa- 
garaji. (Bhadalipurdna). 

LDI (Gujarati) 3763 (7983). 5ff. (Bhadallpurana). 

LDI (Gujarati) 3764 (8023). 16ff. (ff. 1-8 missing). 
Copied by Uttamavijaya of the Tapagaccha at 
Khasada. (Bhadalipurap^i)- 

LDI (Gujarati) 3766 (2804/2) = *LDI (MPC) 
P/2804/2. 4ff. 

LDI (Gujarati) 3767 (7246) = *LDI (MPC) P/7246. 
14ff. 

LDI (Gujarati) 3768 (7567). llff. 

LDI (Gujarati) 3771 (2725). 4ff. (Bhadaltvicdra). 

LDI (Gujarati) 3772 (7280). 8ff. (Meghamdla). 

LDI (Gujarati) 3773 (1542). lOff. Copied by Valla- 
bha. (Meghamdld). 

LDI (Gujarati) 3774 (260). 2ff. (Vddalavicdra). 

Nagaur 1011. 5ff. (Bhadalipurdna). 

Nagaur 1012. 7ff. (Bhadalipurdna). 

NPS (Sanskrit) 9052. If. (Bhddarijotasa = Bhd4aH- 
jotisa). 

Pattan II 8866 (1). 4ff. (Meghamdld brhat Bhadali- 
vdkya in Gujarati). 

Pattan II 8867. 3ff. (Meghamdld Bhadalivdkya in 
Gujarati). Incomplete. 

RORI (Udaipur) 4213 (6). Ff. 29-35. (Bhddalislo- 
kdh). 


^'BHADRABAHU 

Additional manuscripts of his Grahasdntistotra 
(see CESS A 4, 284b-285a): 

RORI (Bikaner) 16530. 2ff. Copied by Udyotavijaya 
at Makasudabada in Sarn. 1858 = a.d. 1801. 
With a Grahastotra and an Artipadya. 

RORI (Bikaner) 17273. Ff. 38-40. Copied in Sarn. 
1896 = A.D. 1839. 

RORI (Jaipur) 7031 (19). Ff. 75-76. Copied in Sarn. 
1899 = A.D. 1842. 


250 


CENSUS OF THE EXACT SCIENCES IN SANSKRIT 


RORI (Bikaner) 17366. If. Copied by Abiracanda at 
Ajimaganja in Sarn. 1927 = A.D. 1870. 

RORI (Jaipur) 5409 (4). F. 2. Copied in Sana. 1927 
= A.D. 1870. 

Pattan II 14159. If. 

RORI Cat. IV 18355 (4). If. 

RORI Cat. VII 25903 (1). If. 

RORI (Bikaner) 13812. Ff. 124-125. 

RORI (Bikaner) 13894. F. 46. 

RORI (Bikaner) 17438. 2ff. 

RORI (Jaipur) 5789 (3). Ff. 2-3. With a DMaguru- 
stuti. 

RORI (Jaipur) 6504 (2). F. 39. Incomplete. 

RORI (Jaipur) 6603. If. Copied by Gulabacanda 
R§i. 

RORI (Jaipur) 6990 (53). Ff. 20-21. With a DMa- 
stuti. 

RORI (Jaipur) 7009 (19). Ff. 69-70. 

RORI (Jaipur) 7019 (225). F. 171. 

RORI (Jaipur) 7083 (38). Ff. 7-8. 

RORI (Jaipur) 7355 (1). If. 

RORI (Jaipur) 9448 (3). If. 

RORI (Jaipur) 11624. F. 2. 

RORI (Udaipur) 3760 (40). Ff. 259-260. 


BHADRABAHU 

Author of a Janmavicarajataka; cf. the Janma- 
pradlpasastra of Bhadrabahu (see CESS A 4, 285a). 
Manuscript; 

RORI Cat. IV 21185. 3ff. 


BHADRABAHU 

Author of a Sdroddhdra = Bhadrabahusdstra. 
Manuscript: 

Mysore ORI P.9278/1. Ff. 1-39. Kannada. Incom¬ 
plete (stripuru§alak§ana). 


*BHADRABAHU {fl. seventh, eighth, or ninth cen¬ 
tury) 

Additional manuscripts of his Bhadrabdhu- 
samhiid (see CESS A 4, 285a-286a; see also S. S. 
Lishk [A5. 1983a] and D. Pingree [A5. 1987c]); 

RORI (Alwar) 2557 = *Alwar 1879. 47ff. Copied 
on Sunday 8 suklapak§a of Vaisakha in Sarn. 
1846, Saka 1711 =3 May 1789. 


Delhi Jaina (Dharmapura) 417 (u 30 (ka)). 20ff. 

Copied in Sarn. 1910 = A.D. 1853. 

Delhi Jaina (Dharmapura) 427 (Ir 31 (ka)). 14ff. 
(Nimitta). 

Pattan II 929. 27ff. Incomplete. 

Pattan II 6814. 27ff. Incomplete. 

PUL II 3729. Ff. 2-42. 


WHAYABHANJANA SARMAN (fl. 1700) 

Additional manuscripts of his Ramalarahasya (see 
CESS A 4, 286a-286b):