Skip to main content

Full text of "USPTO Patents Application 09848616"

See other formats


Document AL2 
Appl.No. 09/848,616 




PCT ORGANISATION MONDIALE DE LA PROPRIETE INTELLECTUELLE 

Bureau international 

DEMANDE INTERNATIONALE PUBLIEE EN VERTU DU TRA1TE DE COOPERATION EN MATIERE DE BREVETS (PCI) 



(51) Classification Internationale des brevets 5 
A61K 39/385, 47/48, C07K 17/08 



Al 



(11) Numero de publication Internationale: WO 94/06472 

(43) Date de publication Internationale : 31 mars 1994 (31.03.94) 



(21) Numero de la demande Internationale: PCT/FR93/O0876 

(22) Date de depot international : 1 3 septembre 1 993 (1 3.09.93) 



(30) Donnees relatives & la priorite: 

92/10879 1 1 septembre 1992 (1 1.09.92) FR 



(71) Deposant (pour tous les Etats designes sau/US): INSTITUT 
PASTEUR [FR/FRJ; 28, rue du Docteur-Roux, F-75724 
Paris Cedex 15 (FR). 

(72) Inven tears ; et 

(75) Inventeurs/Deposants (US seulement) ; GENGOUX, Chris- 
tine [FR/FR]; 13, rue Docteur-Rouques, Cite Joliot-Cu- 
ne, F-95100 Argenteuil (FR). LECLERC, Claude [FR/ 
FR]; 127, rue de Javel, F-75015 Paris (FR). 



(74)Mandataire: PHELIP, Bruno; Cabinet Harie & Phelip 21 
rue de la Rochefoucauld, F- 75009 Paris (FR). ' ' 

(81) Etats designes: AU, CA, JP, US, brevet europeen (AT BE 
CH DE, DK, ES, FR, GB, GR, IE, IT, LU, Mc/nL,' 
"T, SE). 



Publiee 

Avec rapport de recherche internationale. 



<54)Tit.e: ^G^CARR^NGMICROPARTICLES AND THEIR USE IN THE INDUCTION OF HUMORAL OR 
(57) Abstract 

The invention concerns the use, in the induction of an immune response, of a synthetic microparticle polymer 
carrying on the surface one or more covalently bonded proteins capable of carrying one or more epitopes, the densities of 
the protein(s) on the surface of the microparticles, and their molecular weights, being adjusted so as to direct the immune 
response to the induction of a humoral and cellular response or to the induction of a largely cellular response. Said 
microparticles have an average diameter of approximately 0.25 to 1.5 pm. 

• 

(57) Abrege 

Utilisation pour ('induction d'une reponse immunitaire de microparticules en mateYiau synthelique polymere 
portant en surface une ou plusieurs prolines liees de maniere covalente pouvant porter un ou plusieurs epitopes, les 
densites de la ou des proteines a la surface des microparticules, ainsi que leurs poids moleculaires, etant ajustees Win 
d onenter la reponse immunitaire vers I'induction d'une reponse humorale et eel I ul aire ou vers I'induction d'une reponse 
majoritairement cellulaire. Les microparticules ont un diametre moyen compris entre environ 0,25 et environ 1,5 pm. 



VNIQVEMENTA TTTRE D'JNFORMATION 



Codes utilises pour identifier tes Etats parties au PCT, sur les pages de couverture des brochures 
publiant des demandes Internationales en vertu du PCT. 



AT 


Aulrichc 


PR 


France 


MR 


Mauritania 


All 


Ausualle 


CA 


Gabon 


MW 


Malawi 


BB 


Barbade 


CB 


Royaume-Unl 


NE 


Niger 


BE 


Belgique 


GN 


Gulnee 


NL 


Pays-Bas 


BF 


Burkina Faso 


CR 


Grece 


NO 


Norvegc 


BC 


Bulgarlc 


HI) 


Hongrie 


NZ 


Nouvellu-Z£landc 


BJ 


Benin 


IB 


Irlande 


PL 


Pologne 


BR 


Bresil 


IT 


Italic 


PT 


Portugal 


BY 


Belarus 


JP 


Japon 


RO 


Rou manic 


CA 


Canada 


KP 


Ripublique populaire dlmocralique • 


RU 


Federation de Russic 


CF 


Ripublique Ccntrafricainc 




de Coree 


SO 


Soudan 


CC 


Congo 


KR 


Republiquc de Coree 


SB 


Suede 


CH 


Suisse 


KZ 


Kazakhstan 


SI 


Slov6nte 


a 


Cdte d'i voire . 


. . . U 


Liechtenstein 


SK 


RepubJique slovaque 


CM 


Cameroun 


LK 


Sri Lanka 


SN 


Senegal 


CN 


Chine 


LU 


Luxembour 


TD 


Tchad 


CS 


Tchecoslovaquie 


LV 


Lettonie 


TC 


Togo 


CZ 


Republiquc (cheque 


MC 


Monaco 


UA 


Ukraine 


DE 


Allemagne 


MG 


Madagascar 


US 


Etat*-Unis d'Amerique 


DK 


Danemark 


ML 


Ma» 


UZ 


Ouzbtkislan 


ES 


Espagne 


MN 


Mongolie 


VN 


Viet Nam 


PI 


Finlande 











WO 94/06472 



PCT/FR93/00876 



"Microparticules portant des antigenes et leur 
utilisation pour I 1 induction de reponses humoral es ou 
cellulaires" 

La presente invention a pour objet des 
5 microparticules portant en surface des antigenes et 
leur utilisation pour I 1 induction de reponses 
humorales ou cellulaires. 

Plus specif iquement, 1* invention concerne 
egalement des microparticules comportant, en surface, 

10 une densite importante d* antigenes. 

Les cellules B qui expriment des recepteurs 
inununoglobulines specifiques pour un antigene 
particulier sont hautement efficaces pour la 
presentation de cet antigene. (Rock et al. C, J. Exp. 

15 Med* (1984) 160; 1102; Hutchings et al. Eur. J. 
Immunol. (1987) 17:393). Par exemple, des cellules B 
specifiques peuvent presenter la toxoide tetanique a 
des cellules T a des concentrations en antigene 10 4 
fois inferieures a celles requises pour la 

20 presentation par des cellules B non specifiques ou des 
monocytes du sang peripherique. (Lanzavecchia, Nature, 
(1985) 314:537). 

De plus, des etudes in vivo avec des souris 
deficientes en cellules B indiquent que ces cellules 

25 sont requises pour 1' activation des cellules T des 
ganglions lymphatiques (Jane way et al. J. Immunol. 
(1987) 138:1051; Ron, et al. J., J. Immunol. (1987) 
138:2848; Kurt-Jones et al. A.K. J. Immunol. (1987) 
140:3773). 

30 Les souris deficientes en cellules B presentent 

aussi des reponses reduites en ce qui concerne les 
cellules T CD4 + et CD8 + specifiques de tumeurs, apres 
immunisation par le virus de la leucemie murine de 
Freund (Schultz et al., Science, (1990) 291). 

35 La capacite des cellules B a modifier et a 



WO 94/06472 



PCTYFR93/00876 



presenter l'antigene en vue de la reconnaissance par 
des cellules T Helper CD4 + restreintes au complexe 
majeur d'histocompatibilite de classe II (MHC) forme 
la base d'un modele d' activation des cellules B par 
5 les cellules T. (Noelle et al. The Faseb Journal* 
(1991) 5:2770). 

La reconnaissance par des cellules T Helper 
CD4 + du complexe peptide-MHC de classe II a la surface 
des cellules B permet la formation de conjugues 

10 stables physiquement entre les cellules T et les 
cellules B (Kupfer et al. S. J.. Proc. National Acad. 
Sci. USA. (1986) 83:6080). 

Cette reconnaissance directe a pour resultat la 
proliferation et la dif f erenciation de cellules B en 

15 reponse a des lymphokines telles 1 • Interleukine-2 , 
1 ■ Interleukine-4 ou l'Interleukine-5. 

L v induction de la reponse anticorps contre un 
an ti gene necessite done la presentation de l'antigene 
par des cellules B. 

20 La plupart des etudes sur la presentation de 

l'antigene ont ete effectuees en utilisant des 
proteines solubles telles que la toxoide du tetanos, 
le lysozyme, 1'hemocyanine (LH) . Ce pendant, la plupart 
des antigenes auxquels le systeme immunitaire est 

25 expose, sont inclus dans des structures particulaires 
complexes telles que des bacteries ou des parasites. 

II est bien etabli que les cellules qui sont 
capables de phagocytose telles que les macrophages 
peuvent presenter des antigenes bacteriens a des 

30 cellules T. 

Par contre, on ne sait pas si des cellules qui 
ne phagocytent pas, telles que les cellules B, peuvent 
presenter des antigenes complexes et de tallies 
importantes . 

35 II a ete montre recemment que, in vivo, des 



WO 94/06472 



PCT/FR93/00876 



3 



antigenes bacteriens devaient etre mis sous une forme 
soluble, p ur induire une reponse anticorps dependante 
des cellules T (Leclerc et al. J. Immunol. (1990) 
144:3174; Leclerc et al. J. Immunol. (1991) 147:3545). 
5 II convenait cependant d'etablir encore qu'in 

vivo, les antigenes proteiques bacteriens sont 
exclusivement presentes aux cellules T par des 
cellules phagocytaires et que les cellules B ne 
peuvent modifier des antigenes sous forme de 

10 particules. 

A cet effet, on a compare, selon la presente 
invention, la capacite de macrophages et de cellules B 
a presenter le meme antigene, sous une forme soluble 
et particulaire . 

15 On a notamment utilise des antigenes 

proteiques, tels que le lysozyme et le TNP-KLH, 
couples a des microparticules de poly(acroleine) ou de 
polystyrene ayant une taille comparable a celle d'une 
bacterie. 

20 Selon 1 'invention, on a montre de maniere 

surprenante que les cellules B qui pre sen tent le TNP- 
KLH ou le lysozyme de maniere tres efficace, sont 
incapables de presenter ces antigenes couples a des 
billes. Par contre, les macrophages presentent les 

25 deux formes d' antigenes aux cellules T. 

L' etude de la presentation des antigenes et de 
l v induction de la reponse T cellulaire et/ou humorale 
a une importance scientifique et medical e 
particuli&re. 

30 En effet, 1 'orientation vers une reponse 

purement cellulaire ou une reponse purement humorale 
peut permettre de vacciner contre certains pathogenes, 
de modifier certains dysf onctionnements biologiques et 
de guerir certaines pathologies. 

35 Par exemple, une telle orientation permettrait 



WO 94/06472 



PCT/FR93/00876 



d'eliminer des inf ctions persistantes ou d'operer une 
regulation des reponses allergiques. 

De plus, il existe deux sous-populations de 
cellules T, CD4 + , les Thl et les Th2 qui ont des 
5 capacites differentes a produire diverses lymphokines 
(Mosmann, Cherwinski, Bond, Giedlin et Coffman, J. 
Immunol., 136, 2348-2357 (1986)). L' induction de Thl 
ou de Th2 joue un role majeur dans la resistance aux 
infections bacteriennes, parasitaires ou virales. 
10 Ainsi, dans le cas de la leishmaniose cutanee murine, 
les Thl protegent de l f infection alors que les Th2 
aggravent la maladie. In vitro, les lymphocytes B 
stimulent de fagon optimale la proliferation des 
clones Th2 alors qu'une forte proliferation des clones 
15 Thl est observee avec les cellules adherentes 
(Gajewski, Pinnas, Wong et Fitch . J. Immunol., 146, 
1750-1758 (1991)). 

L ■ orientation de l'antigene vers la 
presentation par des cellules B ou des macrophages 
20 peut permettre d'induire des reponses Thl ou Th2. 

Differentes techniques ont ete developpees 
jusqu'a present pour induire une meilleure reponse 
immunitaire. 

La plus ancienne des methodes cons is te a 
25 activer le systeme immunitaire a l'aide d' adjuvants. 
Ainsi, l'adjuvant de Freund permet d'augmenter 
l'intensite des reponses humorale et cellulaire. 
Cependant, de tels adjuvants presentent des 
inconvenients majeurs dus a leur manque de 
30 specif icite, a leur toxicite et aux reactions 
immunologiques parasites qu'ils risquent d f induire, en 
raison de leur manque de purete. 

Les iscomes (abreviation de l f expression 
immuno-stimulating complexes) sont composes d'un 
35 complexe antigenique et d'un adjuvant, le QuilA qui 



WO 94/06472 



PCT/FR93/00876 



est extrait d'un arbre. Ces particules nt un diametre 
d' environ 35 nm et sont compose s de sous-unites 
d* environ 12 run. Elles permettent d'induire uhe reponse 
immunologique ma is le plus souvent les antigenes sont 
5 encapsules et sont done ensuite re 1 argues dans le 
milieu exterieur. En outre, la technique ne permet pas 
un controle precis du type de cellules presentant ces 
particules, et de ce fait ces particules induisent une 
double reponse humorale et cellulaire. 

10 Enfin, du point de vue pratique, on notera des 

difficultes de preparation, un manque de stabilite et 
une toxicite importante de ces particules. 

Les liposomes dont 1 'utilisation a aussi ete 
testee pour 1" induction d'une reponse immunitaire 

15 presentent les memes inconvenients que les is comes. 

Des microparticules biodegradables comme par 
exemple des polymer es d'acide lactique et glutamique 
ont aussi ete developpees (Aguado et Lambert, Immuno. 
Biol., 184, 113-125, (1992)). Ces microparticules 

20 liber en t au cours de leur degradation, I'antigene sous 
forme soluble. Cette liberation permet une 
presentation de I'antigene par di verses cellules et 
1" induction d'une reponse humorale sans possibility 
d' orientation vers une reponse specif iquement 

25 cellulaire. 

Des particules constitutes exclusivement de 
proteines recombinantes ont aussi ete synthetisees. 
Ainsi, la demande de brevet frangais FR 2.635.532 
decrit des particules composees d'une proteine hybride 

30 entre I'antigene HBs et une sequence immunogene 
supposee induire des anticorps neutralisants dirlges 
contre des virus HIV. 

Des particules contenant la toxine de la 
poliomyelite ont aussi ete fabriquees. 

35 Ces particules present nt des inconvenients 



WO 94/06472 



PCT/FR93/00876 



notables. Ainsi, il est tres difficile d'inserer des 
sequences longues dans ces particules. De plus, elles 
induisent tant une reponse humoral e que cellulaire et 
il n'est done pas possible d'obtenir specif iquement 
5 l'une des deux. 

Des particules de polyacroleine ou de 
polystyrene auxquelles sont couples des anticorps ont 
deja ete utilisees pour la mise au point de techniques 
de separation (Rembaum et al., Immunol. (1982) 52:341- 
10 351). 

Aucune utilisation pour la preparation de 
vaccins et 1 'immunisation in vivo n'est neanmoins 
mentionnee. Les billes utilisees ont des diametres de 
20 a 35 run (polyacroleine) ou de 40 a 120 pm 

15 ( po ly s ty r ene ) . 

Des particules de polyacroleine d'un diametre 
de 2 pm ont aussi ete utilisees pour etudier in vitro 
la stimulation des reponses T (Ziegler et al. Eur. J. 
Immunol. (1987), 17: 1287-1296). L'activite de ces 

20 billes n'est pas testee in vivo. 

Dans 1' ensemble de ces travaux, le critere de 
la taille des particules n'a jamais ete considere 
co mine critique. Cependant, des particules de petites 
tailles (nanoparticules) corome les particules HBs 

25 pourraient etre presentees par les lymphocytes B. Au 
contraire, des particules de taille trop importantes 
( super ieures a 5-10 microns) ne peuvent pas etre 
presentees par des cellules phagocy taires . 

Les diverses solutions proposees dans l'etat de 

30 la technique d'une part pour permettre une induction 
d'une reponse immunologique importante et d* autre part 
pour diriger cette reponse specif Iquement dans une des 
deux voies de reponse, humoral e ou cellulaire, ne sont 
done pas satisf aisantes . 

35 L* invention pr pose de mettre au p int des 



WO 94/06472 



7 



PCT/FR93/00876 



produits perm ttant d'obtenir une bonne r'ponse 
immunologique tout en ayant une orientation cellulaire 
ou humor ale. 

Selon 1* invention, on a trouve de maniere 
5 surprenante qu'une telle reponse pouvait etre induite 
a I 1 aide de microparticules, de faibles tallies et 
pre sent ant des densites antigeniques variees. 

La presente invention a parti culierement pour 
objet des microparticules en materiau synthetique 
10 polymere portant en surface une ou plusieurs proteines 
liees de maniere covalente au materiau constituant les 
microparticules, la ou lesdites proteines portant 
chacune un ou plusieurs epitopes et etant presentes a 
une densite comprise entre 10 4 et 5.10 5 molecules///m 2 
15 pour chacune des proteines. 

L 1 invention concerne aussi les caracteristiques 
ci-apres, considerees isolement ou selon toutes leurs 
combinaisons techniquement possibles: 

Le couplage des proteines antigeniques ou 
20 microparticules dolt etre covalent pour eviter la 
liberation sous forme soluble de l v ant i gene. 

Les microparticules ont avantageusement un 
diametre moyen compris environ entre 0,25 jnn et 1,5 
j/m, et pref erentiellement d 9 environ 1 pm afin de 
25 pouvoir etre presentees aux lymphocytes T, CD4 + par 
des cellules phagocytaires ma is pas par des 
lymphocytes B. 

Lesdites microparticules sont plus 

particulierement caracterisees en ce que la liaison 
30 covalente est realisee par reaction des fonctions NH 2 
et/ou CO des proteines et du materiau constituant la 
microparticule . 

Avantageusement line telle liaison se fera par 
1 1 intermediaire d'un agent pontant, tel que par 
35 exemple le glutaraldehyde ou le carbodiimide. 



WO 94/06472 



PCT/FR93/00876 



8 



Neanmoins, tout autre agent bif onctionnel permettant 
une telle liaison peut etr utilise. De tels agents 
sont connus, voir par exemple Synthetic polypeptides 
as antigens, M. H. Von Regenmortel, J. P. Br land, S. 
5 Muller and S. Plane 1988 (Elsevier). Cette liaison 
peut egalement etre faite sans agent pontant. 

Le materiau constituant la microparticule peut 
etre avantageusement un polymere biocompatible, tel 
qu'un polymere acrylique, par exemple la polyacroleine 

10 ou le polystyrene ou des poly (alpha-acides 
hydroxyques ) , des copolymeres d'acides lactiques et 
glycoliques, ou des polymeres d'acides lactiques. 

On entend par polymere tout homo polymere ou 
hetero- ou copolymere. 

15 II doit permettre un couplage covalent des 

proteines au materiau et ne doit pas entrainer de 
reaction de re jet ou de toxicite de la part de 
l'organisme auquel il pourrait etre injecte. 
Avantageusement, il s'aglt, pour 1 1 application en 

20 therapeutique humaine, d'un polymere biodegradable, 
par exemple un polymere pouvant etre degrade par les 
cellules possedant des enzymes lysozomiaux, telles que 
les macrophages . 

De tels materiaux biodegradables peuvent etre 

25 des polymeres d'acide lactiqud et glutamique de 
I'amidon ou des polymeres utilises pour des usages 
biomedicaux, et en particulier ceux utilises dans les 
sutures . 

Une telle microparticule peut porter a sa 
30 surface outre des proteines antigeniques, des 
molecules susceptibles d'activer le systeme 
immunitaire, telles que des interleukines , en 
particulier 1 1 interf er on- gamma ou I'interleukine 4. 

Ces microparticules peuvent porter une ou 
35 plusieurs proteines qui peuvent elles-memes comprendre 



WO 94/06472 



PCT/FR93/00876 



chacune un ou plusieurs epitopes. D telles protein s 
peuvent etre des glycoproteins, des peptides 
synthetiques contenant un epitope ou plusieurs 
epitopes, ou toute autre molecule non proteique ou 
5 contenant une partie proteique pouvant induire une 
reponse immunitaire. 

Les microparticules objets de la presente 
invention peuvent en outre etre encapsulees afin de 
proteger les antigenes fixes a leurs surfaces d'une 
10 degradation et afin de les amener jusqu'a leur lieu 
d'action. 

Elles peuvent ainsi comprendre un noyau 
constitute d'une matrice polysaccharidique, a laquelle 
sont lies les antigenes, d'une premiere couche 

15 lipidique liee de maniere covalente au noyau et d'une 
seconde couche de molecules amphiphiles. 

L' invention a pour autre objet des medicaments 
ou vaccins comprenant les microparticules decrites ci- 
dessus, ainsi que des compositions pharmaceutiques 

20 caracterisees en ce qu' elles les comprennent, en 
association avec des diluants ou des adjuvants 
pharmaceutiquement compatibles . 

La presente invention est de maniere generale 
relative a 1 1 utilisation de microparticules en 

25 materiau synthetique polymere portant en surface une 
ou plusieurs proteines liees de maniere covalente, la 
ou lesdites proteines portant chacune un ou plusieurs 
epitopes T ou B, pour la fabrication d'un medicament 
ou d f un vaccin pour 1 'induction d'une reponse 

30 immunitaire, selon laquelle les dens it es de la ou des 
proteines a la surface des microparticules sont 
ajustees afin d'orienter ladite reponse immunitaire 
vers une reponse majoritairement humorale ou 
majoritairement cellulaire. 

35 Sous un autre aspect, 1' invention a aussi pour 



WO 94/06472 



PCT/FR93/00876 



10 



ob jet un procede pour la fabrication d'un medicament 
ou d'un vaccin dont la reponse immunitaire est s it 
majoritairement humorale soit ma joritairement 
cellulaire, de type Thl ou Th2, ledit procede etant 
5 caracterise en ce qu'on fixe de maniere covalente sur 
des microparticules ou billes en materiau synthetique 
polymere au mo ins une proteine portant un ou plusieurs 
epitopes en faisant varier la densite de la proteine 
fixee a la surface selon le type de reponse desiree. 

10 Afin d'induire une reponse cellulaire et 

humorale, on utilisera pref erentiellement des 
microparticules pre sent ant une densite pour chacune 
des proteines portant un epitope d'au minimum 10 5 et 
pref erentiellement d 'environ 5.10 s molecules/pm 2 . De 

15 telles densites correspondent environ pour une bille 
d'un diametre de lpm a des quantites de proteines a la 
surface de la microparticule respectivement de 10 5 et 
4.10 s molecules. 

En vue de 1' induction d'une reponse 

20 majoritairement cellulaire, CD4 + , classe II 
restreinte, on utilisera, pref erentiellement, des 
microparticules presentant une densite pour chacune 
des proteines portant un epitope comprise entre 
environ 1.0* et 5.10* molecules de proteines ///m^ . 

25 Afin de favoriser 1 'induction de cette reponse 

cellulaire , on utilisera pref erentiellement des 
microparticules portant en surface des proteines ayaht 
des poids moleculaires superieurs a 50 kD. 

Les autres caracteristiques de ces 

30 microparticules sont celles mentionnees plus haut 
concernant les microparticules a haute densite. 

Les proteines et antigenes lies de maniere 
covalente aux microparticules dependent de 
1 'application prevue desdites microparticules. 

35 El les dependent egalement du type de reponse 



WO 94/06472 



11 



PCT/FR93/00876 



immunitaire que l'on souhaite induire, mais aussi de 
la maladie ou de 1' affection que l'on souhaite traiter 
ou dont on souhaite premunir le sujet. 

A titre d'exentple, on pourra utiliser les 
5 epitopes de la region Pre S2 de l'antigene HBS du 
virus de 1* hepatite virale dont les sequences sont les 
suivantes : 

- epitope T: Pre S:T (120-132) 

io MQWNSTTFHQTLQ 

- epitope B: Pre S:B (132-145) 

is QDPRVRGLYFPAGG 

On peut aussi citer a titre d'exemples les 
epitopes de la proteine VP1 du virus de la 
poliomyelite dont les sequences sont les suivantes: 

20 - epitope T: C3:T (103-115) 

KLFAVWKITYKDT 

25 - epitope B: C3:B (93-103) 

DNPASTTNKDK 

Un autre exeraple de sequence est 1' epitope de 
30 la boucle V3 de la proteine GP120 du virus HIV1 dont 
la sequence est la suivante: 

- epitope T + B: boucle V3 

I^TRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAH 



35 



On utilisera pref erentiellement les epitopes B 
40 pour induire une reponse humoral e a l'aide de 
microparticules a forte densite et les epitopes T pour 
induire une reponse majoritairement cellulaire a 
l'aide de microparticules a faible densite en 



WO 94/06472 



PCT/FR93/00876 



12 



proteines de surface. 

De telles microparticules seront injectees aux 
patients que l'on veut traiter de maniere 
therapeutique ou prophylactique par les moyens connus 
5 de l'homme du metier, par exemple par injection sous- 
cut anee, intraperitoneale, intraveineuse, ou par tout 
autre moyen permettant d'induire une reponse 
immunitaire . 

On se reportera a ce sujet a Current protocols 
10 in immunology, (Edited by J.F. Coligen, A.M. 
Kruisbeek, D.H. Margulies, E.M. Shevach, W. Strober 
Wiley-Intersciences Editors) dans lequel sont 
repertoriees les techniques d 1 immunisation. 

Un des avantages particuliers de la presente 
15 invention reside dans le fait qu'elle permet d'induire 
des reponses immunitaires humorale ou cellulaire sans 
adjonction d* adjuvants aux billes ou microparticules. 
Neanmoins, 1' adjonction d* adjuvants non toxiques et 
n'entrainant pas de reaction immunitaire parasite est 
20 aussi envisageable dans le cadre d'une utilisation 
selon la presente invention. 

La presente invention est illustree sans pour 
autant etre limitee par les exemple s qui suivent dans 
lesquels: 

25 Les diagrammes de la Figure 1 sont des 

resultats d f analyses par fluorometrie (FACS) de 
microparticules portant des antigenes KLH ou TNP-KLH. 
Les ordonnees indiquent l'anticorps utilise (PBS- 
temoin, anti-KLH, anti-TNP) . Les abscisses indiquent 

30 les types de microparticules testees: B (KLH), B (TNP- 
KLH) , B (OVA) et B (OVA-TNP) qui correspondent k des 
microparticules sur lesquelles sont lies respecti- 
vement le KLH, le TNP-KLH, 1 "ovalbiimine et 
1 • ovalbumine-TNP . 

35 Les figures 2A a 2D representent la capacite de 



WO 94/06472 



PCT/FR93/00876 



13 

cellules d rate, de macrophages et de cellules 
specifiques B du TNP et activ'es par le LPS a 
presenter respectivement le KLH, le TNP-KLH, des 
microparticules portant du KLH et des microparticules 
5 portant le TNP-KLH. 

La Figure 3 est une courbe indi quant les 
reponses prolif eratives de cellules ganglionnaires de 
sour is immunisees par le lysozyme soluble et stimulees 
in vitro par le lysozyme soluble (figure 3A) ou par 

10 des microparticules portant le lysozyme de diametres 
0/25, 0,75 et 1,5 }im (figure 3B) . La proliferation 
cellulaire est mesuree par 1' incorporation de 
thymidine (CPM) en ordonnees, tandis que la dilution 
des microparticules est indiquee en abscisses. 

15 La Figure 4 represente la -production d # IL2/IL4 

par un hybridome specifique du lysozyme apres 
stimulation par du lysozyme soluble (figure 4A) ou par 
des microparticules portant du lysozyme (figure 4B) . 
Les concentrations des microparticules sont indiquees 

20 en abscisses, tandis que la proliferation est indiquee 
en ordonnees. 

Les Figures 5A et 5B representent 1» activation 
de 1 'hybridome T specifique du lysozyme mesuree par la 
production d f IL2/IL4 apres stimulation par le lysozyme 

25 soluble (figure 5A) ou couple aux microparticules 
(figure 5B) en presence de splenocytes ou de cellules 
B(A20) comme cellules presentant l'antigene. 

Les Figures 6 A et 6B representent la 
proliferation in vitro apres stimulation par le 

30 lysozyme soluble de cellules de ganglions inguinaux de 
souris Immunisees respectivement par du lysozyme 
soluble en adjuvant complet de Freund (Figure 6A) et 
par du lysozyme couple a des microparticules (Figure 
6B) . 

35 Les figures 7A et 7B repr'sentent la 



WO 94/06472 



14 



PCT/FR93/00876 



proliferation in vitro apres stimulation par le 
lysozyme de cellules de ganglions inguinaux de souris 
immunisees par diverses concentrations de lysozyme 
soluble (7A) ou couple a des microparticules (7B) . 
5 La figure 8 represente la proliferation de 

cellules ganglionnaires de souris immunisees par le 
lysozyme en adjuvant complet de Freund ou en PBS ou en 
presence de microparticules couplees a de 
l'hemocyanine de patelle, ou KLH (Keyhole Limpet 

10 Hemocyanin) • 

La Figure 9 represente la reponse proliferative 
de cellules ganglionnaires de souris immunisees par de 
1 'hemoglobine soluble en adjuvant (Hb + CFA) ou 
couplee a des billes (B-Hb) . 

15 La Figure 10 represente la reponse 

proliferative de cellules de souris stimulees par de 
l'ovalbumine soluble (OVA + CFA) ou de 1 • ovalburaine 
couplee a des billes (B-OVA) . 

La reponse proliferative, respectivement a 

20 1 'hemoglobine et a l'ovalbumine , a ete mesuree en 
ordonnees par la radioactivite incorporee (CPM), en 
fonction de la quantite d 1 hemoglobine ou d'ovalbumine 
(en abscisses) utilisee pour restimuler les cellules. 

La Figure 11 illustre la proliferation de 

25 cellules de souris immunisees par le peptide C3 sous 
forme soluble (C3:T + CFA) ou sous forme micropar- 
ticulaire (B-C3: T) . Les cellules ont ete restimulees 
en presence de quantite de C3 soluble (en abscisses) 
et la proliferation a ete mesuree (en ordonnees) . 

30 La Figure 12 represente la proliferation des 

cellules de souris immunisees par .le peptide pre-S:TB 
soluble (Pre-S:TB + alum) ou sous forme microparticu- 
laire (B-pre-S:TB) ou le peptide pre-S:B sous forme 
particulaire (B-Pre S:B) et restimulees par le peptide 

35 Pre-S. 



WO 94/06472 



PCT/FR93/00876 



15 

Les Figures 13A et 13B representent . 
respectivement les taux d' anticorps anti -lysozyme 
(Figure 13A) et d'anticorps anti-KLH (Figure 13B) de 
souris immunisees avec du lysozyme et de 1' adjuvant 
5 alun, des microparticules portant du lysozyme ou des 
microparticules portant du LH. 

Les Figures 14 et 15 illustrent la reponse 
anticorps de souris immunisees par 1 'hemoglobine 
(Figure 14) ou l'ovalbumine (Figure 15) sous forme 
10 soluble ou particulaire . Le Log du titre en anticorps 
est represents en ordonnees tandis que le temps est 
represents en abscisses . 

La Figure 16 est relative a la reponse 
anticorps de souris immunisees par le peptide pre-S : 
15 TB soluble ou les peptides pre-S: TB ou pre-S: B sous 
forme particulaire. L'ordonnee et l'abscisse de cette 
courbe ont la meme signification que pour les Figures 
14 et 15. 

La Figure 17A represente la proliferation de 
20 cellules de souris immunisees par injection de 
lysozyme en presence d' adjuvant de Freund, apres 
stimulation in vitro par des microparticules portant 
du lysozyme a differentes densites. 

La Figure 17B represente la proliferation in 
25 vitro de cellules de souris immunisees in vivo par du 
lysozyme ou des billes portant du lysozyme apres 
stimulation par differentes concentrations de 
lysozyme. 

La Figure 18 est un diagramme illustrant la 
30 production d'anticorps anti-lysozyme de cellules de 
souris immunises par injection de lysozyme et 
d' adjuvant de Freund ou de microparticules portant du 
lysozyme. 
EXEMFLE 1 ; 

35 Preparation d billes couplees a KLH ou a 



WO 94/06472 



16 



PCT/FR93/00876 



1 ' ovalbumine . 

1 * Materiel et methodes et presentation par des 
cellules B ou par des macrophages. 

Les souris sont des femelles BALB/c et DBA/2 
5 agees de 6 a 8 semaines. 

Les antigenes sont le KLH et l f ovalbumine (OVA) 
commercialises par Sigma Chemical (St-Louis, USA). 
L'hemocyanine trinitrophenylee (TNP4-KLH) a ete 
preparee telle que decrit precedemment (Shutze et al., 
10 J. Immunol. (1989) 142:2635). 

1.1 Couplaoe covalent des ant i penes ou 

microparticules de polvf acroleine) . 
Des microparticules de poly (aero leine) d'un 
diametre compris entre 0,25 et 1,5 pm, commercialisees 
15 par Polysciences Inc. (Washington PA), sont couplees a 
1 • ovalbumine ou au KLH comme decrit precedemment 
(Rembaum et al. Immunol. (1982) 52:341; Ziegler et al. 
Eur. J. Immunol. (1987) 17:1287). 

1 ml de ces microparticules est lave deux fois 
20 dans du PBS et resuspendu dans 1 ml de KLH ou 

d' ovalbumine (5 mg/ml dans du PBS). Apres trois heures 
d f incubation a temperature ambiante, les 
microparticules sont laves deux fois dans du PBS et 
resuspendus dans 2 ml de PBS con tenant 1% de serum 

25 albumine bovine (BSA) et des antibiotiques . Les 
microparticules ainsi obtenues sont stockees a 4*0 
jusqu'a utilisation. 

Les microparticules portant les antigenes TNP- 
OVA ou TNP-KLH sont preparees par incubation de 

30 microparticules portant l f OVA ou le KLH avec du TNBS 
(Trinitrobenzene sulfonate) • 

2 ml des microparticules qui ont ete couplees 
au KLH ou a I 9 ovalbumine sont laves deux fois dans du 
PBS et resuspendus dans 2 ml de tampon cacodylate 

35 contenant 10 mg/ml de TNBS . Les micr particules sont 



WO 94/06472 



17 



PCT/FR93/00876 



incubees 30 minutes dans I'obscurite a la t mp'rature 
ambiant et lavees trois f is dans du PBS. Elles sont 
resuspendues dans 2 ml de PBS contenant 1% de BSA et 
des antibiotiques et stockees a 4 # C. 
5 1.2 Analyse par cvtof luorometrie de flux . 

50 ul de microparticules sont laves deux fois 
dans du PBS contenant 1% de BSA et incubes durant 40 
minutes a 4*C avec du serum de souris anti-KLH ou 
anti-TNP. Apres deux lavages , les microparticules sont 

10 incubees avec des anticorps de chevre couples au FITC 
(fluoroisothiocyanate) diriges contre des 

immunoglobulines de souris (Biosys, Compiegne, France) 
durant 40 minutes a 4*C. 

Apres quatre lavages, les microparticules sont 

15 resuspendues dans 1 ml de PBS contenant 1% de BSA. 

L'intensite de fluorescence est mesuree en 
utilisant le cytometre de flux FACSCAN (Becton 
Dickinson, Mountain View. CA) . 
1.3 Milieu de culture . 

20 Les lymphocytes sont cultives dans du RPMI 1640 

(Seromed, Munich, FRG) complementes avec de la L- 
glutamine 2mM, 10% de FCS (serum de veau foetal) 
inactive par la chaleur, du 2 -ME 50juM et des 
antibiotiques • 

25 1.4 Etablissement de la licrnee cellulaire Th 
specifigue du KLH . 

Cette lignee cellulaire est etablie et 
maintenue selon le protocole decrit par Taylor et al. 
(ed. IRL Press. New York) et Galelli et al. (J. 
30 Immunol. (1990) 145:2397). 

Des cellules de ganglions inguinaux (4 10 6 /ml) 
de souris DBA/2 ayant subi 8 jours avant le 
prelevement des cellules, une injection de 100 jig de 
KLH en emulsion dans de l v adjuvant complet de Freund a 
35 la base de la queue nt ete cultive s durant 4 jours 



WO 94/06472 



i 

18 



PCT/FR93/00876 



dans du milieu de culture en presence de KLH (lOO 
pg/ml) . 

Les cultures sont incubees dans une atmosphere 
humide a 7,5% de C0 2 a 37 *C. 
5 Une lignee cellulaire a ete etablie a partir de 

cette culture initiale par des passages en serie de 
cellules T purifiees sur Ficoll (2.l0 5 /ml) en presence 
de cellules de rate de souris DBA/2 irradiees (300O 
rad) durant 6 a 8 jours (peri ode de repos) ou avec des 

10 cellules de rate irradiees plus du KLH (100 pg/ml) 
durant 4 jours (peri ode de stimulation) . 

Les cellules T utilisees dans les experiences 
sont recoltees 8 a 10 jours apres leur derniere mise 
en presence du KLH. 

15 1.5 Estimation de la proliferation des cellules Th . 

Des cultures en triplicats contenant 5.10 4 
cellules Th purifiees sur Ficoll, et 5.10 4 cellules B 
memo ire specif iques du TNP purifiees et irradiees (900 
rad), ou 5.10 s cellules de rate totales Irradiees 

20 (3000 rad), ou 10. 5 cellules de rate adherentes 
irradiees (3000 rad), ou 10 5 cellules B de lymphome 
A20 positives pour le HHC de classe II irradiees (3300 
rad) (Kim et al. J. Immunol. (1979) 122:549), ou 10 5 
cellules B vierges specif iques du TNP et activees par 

25 le LPS comme source de cellules presentant les 
antigenes, et differentes concentrations d'antigene 
ont ete incubees dans des plaques de microculture a 
fond plat (Corning, Cambridge, MA) sous un volume 
total de 0,2 ml/puits de milieu complet. La 

30 proliferation cellulaire T a ete estimee par 
incorporation de la thymidine tritiee durant les huit 
dernieres heures d'une culture de 3 jours. 

Les resultats sont exprimes comme la moyenne 
geometrique de trois cultures, une fois elimine le 

35 bruit de fond. L''cart type est inferieur a 15 % de la 



WO 94/06472 



19 



PCT/FR93/00876 



moyenne . 

1.6 Cellules B specifiques du TNP. 

Les cellules B specifiques du TNP de sourls 
normales sont purifiees par liaison et elution sur une 
5 gelatine-TNP8 et selon la technique decrite par Haas 
et Layton J. E., J. Exp, Med. (1975) 141:1004. 

Ce protocole a ete modi fie afin d'obtenir des 
populations enrichies en cellules B memoires 
specifiques du TNP a partir de la rate de souris 

10 precocement immunisees, comme precedemment decrit 
(Galelli et al. J. Immunol. (1990) 145:2397). Les 
cellules B memo ire specifiques du TNP ont ete 
selectionnees sur de la gelatine portant un haptene 
(gelatine-TNP2) , en testant l'af finite des recepteurs 

15 pour le TNP par comparaison aux cellules B vierges, et 
la capacite a secreter de larges quantites 
d'immunoglobulines 6 ant i -TNP en presence de faibles 
concentrations d 1 antigenes . 

10 8 cellules de rate ne contenant ni 

20 erythrocytes ni cellules mortes ont ete suspendues 
dans 3 ml de HEPES (50 roM) tamponnees par du DMEM 
(Seromed, Munich, Allemagne) et incubees dans des 
boites de Petri en plastique recouvertes de gelatine- 
TNP2. Les boites sont agitees de maniere douce durant 

25 15 minutes a 4*C, puis lavees 10 fois par du DMEM a la 
temperature de la glace. Les cellules adherentes sont 
eluees en ajoutant 5 ml de DMEM rechauffe & 37 "C et la 
gelatine-TNP liee est eliminee par digestion par la 
collagenase (Collagenase CLSIII de Worthington 

30 Biochemicals Freehold, New Jersey, 100 U/ml) durant 15 
minutes a 37'C. 

Ce protocole conduit a l^btention finale, 
exprimee comme un pourcentage par rapport au nombre de 
cellules de rate d'origine, de 0,3 a 0,6 % de cellules 

35 liant le TNP a partir de rate de souris immunisees.- 



WO 94/06472 



PCT/FR93/00876 



Les cellules sont cultivees toute la nuit avant 
1' addition d'autres cellules et reactifs afin de 
permettre la reexpression d'immunoglobulines de 
surface modifiees par le traitement par la 
5 collagenase. La presence de recepteurs libres du TNP 
sur ces cellules est evaluee par leur capacite a lier 
des erythrocytes portant a leur surface du TNP. 

55 a 76 % des cellules obtenues a partir de 
souris immunisees forment des rosettes avec des SRBC 
10 modifiees par le TNP. Ces cellules ne proliferent pas 
en reponse a la concanavaline A mais sont enrichies 20 
fois, pour les cellules qui secretent les 
immunoglobulines 6 anti-TNP apres stimulation par TNP- 
LH, par comparaison aux cellules de rate non 
15 f ractionnees . 

1*7 Cellules B vieroes specifigues du TNP et 
activees par le LPS 

Des cellules B vierges specifiques du TNP de 
souris et non immunisees ont ete purifiees par liaison 

20 puis elution sur de la gelatine-TNPB comme decrit 
precedemment. Ces cellules ont ete cultivees a une 
densite de 2.10 6 par ml dans un milieu contenant 50 
ptg/ml de LPS (Salmonella enteriditis, Difco 
Laboratories, Detroit, MI) durant 3 jours. Les 

25 lymphoblastes non adherents ont ete purifies en 
utilisant du Ficoll-Hypaque (Pharmacia, Piscataway, 
NJ), puis laves et utilises comme cellules 
accessoires • 
1.8 Macrophages . 

30 Les macrophages ont ete obtenus a partir de 

cellules de rate non immunisees par adhesion durant 4 
heures a 37 *C suivie d'un lavage des cellules afin 
d'eliminer les cellules non adherentes tel que decrit 
precedemment (Kakiochi et al. J. Immunol. (1983) 

35 131:109). 



WO 94/06472 



PCT/FR93/00876 



21 



2 . Resultats . 

2*1 Verification du couplaoe de l'antioene 
aux microparticules. 

Le KLH a ete couple de maniere covalente a des 
5 microparticules de polyacroleine d'un diametre de 0,25 
a 1,5 Jim. Le couplage du KLH aux microparticules a ete 
controle par analyse en cytof luorometrie de flux en 
utilisant un serum de souris anti-KLH. 

Les resultats obtenus avec des microparticules 
10 de 1,5 pm sont indiques sur la Figure 1. 

Les microparticules de 1,5 Jim ont ete couplees 
a 1 ' ovalbumine (B OVA) ou a la KLH (B-KLH) . Les 
microparticules TNP-OVA ou TNP-KLH ( respect ivement 
designees B(TNF-OVA) et B (TNP-KLH) ) ont ete preparees 
15 par incubation de microparticules portant I'OVA ou le 
KLH avec du TNBS . L' analyse par cytof luorometrie a ete 
ef fectuee sur des microparticules incubees en presence 
de PBS ou en presence de serum de souris anti-KLH ou 
anti-TNP. Apres lavage, les microparticules ont ete 
20 incubees avec des anticorps de chevre lies au FITC 
diriges a l'encontre des immunoglobulines de souris et 
ont ete analysees par cytometric de flux. 

Des resultats similaires ont ete obtenus avec 
des microparticules de 0,25 et 0,75 ym. 
25 Les microparticules temoins couplees avec de 

I'ovalbumine n'ont pas ete reconnues par le serum 
anti-KLH. 

2.2. Comparaison de la caoacite de dlverses 
populations de splenocvtes k presenter des 
30 antioenes solubles ou particulaires . 

La capacite de splenocytes non fractionnes, de 
macrophages et de cellules B vierges specifiques pour 
le TNP a ete comparee quant a leur presentation de KLH 
et de TNP-KLH soluble ou particulaire a des cellules T 
35 specifiques du KLH. 



WO 94/06472 



PCT/FR93/00876 



22 



Dans c s experiences, des populations de 
splenocyt s ont et' preparees a partir de souris non 
immunisees. Apres purification, les cellules B 
specifiques du TNP ont .ete activees durant trois jours 
5 par du LPS; on sait en effet que les lymphoblastes 
induits par le LPS sont des cellules tres efficaces 
quant a la presentation d'un antigene (Kakiochi et al. 
J, immunol. (1983) 131:109). 

Les resultats sont illustres sur la Figure 2 

10 pour laquelle 5.10 5 splenocytes irradies, lo 5 cellules 
adherentes ou 10 5 cellules B vierges. specifiques du 
TNP activees par le LPS ont ete cultivees avec 5.10 4 
cellules Th specifiques du KLH en presence de 
quantites variees de KLH soluble (A) , de TNP-KLH 

15 soluble (B) ou fixes sur des microparticules (B KLH) 
(C) ou de B (TNP-KLH) (D) ) • La proliferation 
cellulaire Th a ete estimee au jour 3. 

Comme le montre la Figure 2 (2A et 2B) , les 
macrophages et les cellules B activees par le LPS 

20 stimulent de man i ere efficace les cellules T quand ils 
sont incubees avec du KLH ou du TNP-LH solubles - 

Contrairement a ces resultats, seuls les 
macrophages, et non les cellules B specifiques du TNP 
et activees par le LPS sont capables de stimuler les 

25 cellules T specifiques du KLH (Figures 2 C et D) quand 
des microparticules portant du KLH ou du TNP-KLH sont 
utilisees. 

Ces resultats montrent que les macrophages sont 
responsables de I'activite. de presentation de 
30 1 'antigene des cellules spleniques quand des antigenes 
particulaires sont utilises. 

Ainsi l 1 incapacity de cellules B specifiques du 
TNP a presenter 1' antigene particulaire a ete 
illustree. 



35 



WO 94/06472 



PCT/FR93/00876 



23 

EXEMPLE 2 . 

Induction d'une reponse proliferative T, CD4 + 
specifigues du lysozvme in vivo et in vitro par des 
microparticules couplees au lysozvme. 
5 1. MATER I ELS ET METHODES. 

1 . 1 Antlgenes 

Le lysozyme (LYSO) et 1 'hemocyanine de Limulus 
(LH) proviennent des Laboratoires Sigma. 

1.2 Couplage de l'antigene aux microparti- 

10 cules 

L'antigene soluble est rendu particulaire par 
couplage a des microparticules (Polysciences) de 0.2 a 
l^m de diametre. Deux methodes de couplage sont 
utilisees: 

15 1.2 a) Couplage covalent directement sans agent 
activant . 

Les billes ou microparticules de polyacroleine 
portent des groupements aldehyde capables de reagir 
spontanement avec les fonctions amines des proteines. 

20 1 ml de billes est lave 4 fols dans du PBS, et 

repris dans 1 ml d'antigene a 5 mg/ml. Apres 3 heures 
d 9 incubation a temperature ambiante, les billes sont 
lavees 3 fois dans du PBS et incubees 30 minutes dans 
1 ml de PBS-Albumine humaine 1% afin de saturer les 

25 groupements reactifs libres des billes. Puis apres 
lavage, les particules sont reprises dans 2 ml de PBS- 
albumine humaine 1%-antibiotique 1% puis conservees a 
+4 - C. 

b) Couplage covalent par le glut araldehvde . 
30 L'antigene £st couple aux billes de polystyrene 

par le glutaraldehyde, capable de former une base de 
Schiff avec les groupements amines des proteines. 

0,5 ml de billes est lave 3 fois dans du PBS et 
repris dans 0,5 ml de glutaraldehyde 8%. Apres 6 
35 heures d'incubati n a temperatur ambiante, les billes 



WO 94/06472 



PCT/FR93/00876 



24 



sont lavees 2 fois et reprises dans 1 ml d'antigene a 
400j/g/ml. Apres incubation pendant la nuit a 
temperature ambiante / les billes sont lavees et 
incubees avec 1 ml d ■ ethanolamine 0,2 M pendant 30 
5 minutes afin de bloquer les fonctions aldehyde libres 
du glutaraldehyde. 

Apres un dernier lavage, les particules sont 
reprises dans 1 ml de PBS- albumine humaine 1%- 
antibiotique 1% puis conservees a +4*C. 

10 Cette met hod e de couplage permet de determiner 

la quantite de proteines couplees sur les 
microparticules par spectrophotometrie. Les 
absorbances de la solution de proteine a 400 jug /ml et 
du surnageant obtenu apres l v incubation des billes 

15 avec cette solution de proteine sont mesurees a 280 
run. Connaissant le nombre de billes utilisees pour le 
couplage, on considere que la difference entre la 
quantite de proteine avant couplage et la quantite 
residuelle apres couplage, permet d'es timer la 

20 quantite de lysozyme couplee par particule. 

1.3 Protocole d ' immunisation . 
On a utilise des femelles BALB/c, d ' hap lo type 
H-2 d , agees de 6 a 8 semaines (elevage de l'Institut 
Pasteur) . 

25 - immunisation par voie intra-peritoneale: on 

injecte 100 ^g de lysozyme avec 1 mg d 9 alum, ou, 
differentes quantites d'antigene couple aux billes 
sans adjuvant, 

- immunisation par voie sous-cutanee: a la base 

30 de la queue, on injecte 100 vq de lysozyme en emulsion 
dans 1 'adjuvant complet de Freund, ou, differentes 
quantites d'antigene couple aux billes. 

Le serum de chaque souris est preleve 7 ou 14 
jours apres chaque injection. La teneur en anticorps 

35 des serums est mesuree par test ELISA. 



WO 94/06472 



25 



PCT/FR93/00876 



La r'ponse proliferative cellulaire est mesuree 
sur les gangli ns inguinaux et/ou sur la rate, 
preleves 7 et/ou 14 jours apres chaque injection. 
1.4 Detection des anticorps par ELISA . 
5 L'antigene (lysozyme) est incube a la 

concentration de 5/ig/ml en tampon carbonate 50 mM- 
pH=9.6, dans des microplaques (Nunc) pendant une nuit 
a 4*C. Apres lavage avec un tampon PBS-Tween 20 a 
0,01%, les differentes dilutions des serums a tester, 

10 realisees en tampon BSA 1%, sont incubees pendant 1 
heure a 37 - C. Apres lavage, on depose 100 jj! par puits 
d'un conjugue anti-Ig de souris (anti-Ig totales 
fournis par Diagnostics Pasteur et anti-Ig specif iques 
par Sigma) , marque a la peroxydase, prepare chez la 

15 chevre; qui est incube pendant 1 heure a 37 *C. Apres 
lavage, on ajoute la solution de subs tr at preparee 
extemporanement : Orthophenylenedi amine a 0,5 mg/ml 
(Sigma) en tampon acide citrique 0.1 M-phosphate 
disodique 0.2M-pH=5 auquel on ajoute H 2 0 2 au 1/2500. 

20 Une coloration jaune revel e la presence 

d' anticorps spec if iques; la reaction enzymatique est 
arretee 8 minutes plus tard, par 50 pi de H 2 S0 4 
(11/5%). 

L'absorbance de chaque puits est mesuree a 492 
25 run, par un lecteur de densite optique (Dynatech) . Le 
controle negatif est realise avec du serum au 1:100 de 
souris BALB/c non immunisees. Les resultats sont 
exprimes: soit en DOxlOOO a partir de l'absorbance 
mesuree, corrigee de l'absorbance en absence de serum; 
30 soit par le titre en anticorps calcule a partir de 
regression lineaire basee sur l'absorbance obtenue 
avec le serum de souris BALB/c non immunisees. 

Lorsque 1' ant i gene est sous forme particulaire, 
le test ELISA est realise en tubes. Les dilutions des 
35 s'rums a test r s nt incubees directement avec 



WO 94/06472 



26 



PCT/FR93/00876 



I'antigene couple aux billes (8-10 8 particules/ml) . 
Les lavages se font par centrifugatlon dans le tampon 
PBS-Tween 20 (0-01%). Lorsque la reaction enzymatique 
est terminee, 200 pi de chaque tube sont transferes en 
5 microplaque puis 1 'absorbance est mesuree. 

1*5 Inhibition de la fixation des anticorps 
anti-lvsozvme par test ELISA . 

Le test ELISA mesure la fixation des anticorps 
specifiques presents dans le serum de souris BALB/c 

10 immunisees par le lysozyme. Cette fixation est 
diminuee si le serum est preincube (avant le test 
ELISA) avec I'antigene: lysozyme soluble ou couple aux 
billes, qui se comporte alors, comme un inhibiteur. 

Le serum anti -lysozyme est preincube avec le 

15 lysozyme soluble ou couple aux billes, pendant 1 heure 
a 37 *C puis la nuit a 4*C; la reaction se faisant en 
tubes. La fixation des anticorps non-lies a 
!• inhibiteur est evaluee par test ELISA (triplicats) 
en microplaques, dont les puits ont ete recouverts par 

20 du lysozyme a 5 /ig/ml. L 1 absorbance de chaque puits 
est mesuree a 492 nm, et corrigee de 1' absorbance en 
absence de serum. Le controle negatif est realise avec 
du serum au 1:100 de souris BALB/c non immunisees. 
L' absorbance sans inhibiteur lors de la preincubation 

25 de serum, correspond a la fixation maximale 
d' anticorps anti-lysozyme. 

Les resultats sont exprimes en pourcentage 
d" inhibition de fixation des anticorps et calcule 
selon le rapport 

30 DO sans inhibiteur-DO avec inhibiteur 

DO sans inhibiteur 

La determination graphique de la concentration 
35 de lysozyme soluble ainsi que du nombre de billes 
couplees au lysozyme, necessaire pour 50%' 



WO 94/06472 



PCT/FR93/00876 



27 

d' inhibition, permet d'estimer la quantite de lysozyme 
fixee par particule. 

1.6 Stimulation d'un hvbridome T specif iaue 
5 du lvsozvme 

Un hybridome T a ete produit par immunisation 
de souris BALB/c avec du lysozyme. II reconnait 
specif iquement le peptide 108-116 du lysozyme, en 
association avec les molecules du Complexe Majeur 

10 d* Histocompatibility de classe II I-E d . 

10 s cellules d v hybridome T sont stimulees par 
des concentrations croissantes d'antigene: lysozyme ou 
billes couplees, en presence de differentes cellules 
presentatrices de 1'antigene: 5.10 5 splenocytes 

15 irradies (3000 rad) de souris BALB/c ou 10 5 cellules 
de lymphome B A20, restreintes par les molecules de 
CMH de classe II. Les cellules sont mises en culture 
(triplicats) dans un milieu complet RPMI 1640 
(SEROMED) additionne de 10% de serum de veau foetal 

20 decomplemente, 50 j/M de /3-mercaptoethanol, 2mM de 
glutamine, 100 Ul/ml de penicilline et 100;jg/Ml de 
streptomycine, en microplaque a fond plat (Corning 
25860). Le temoin positif est realise par stimulation 
de l v hybridome par le mi to gene de lymphocytes T: 

25 concanavaline A a 5 fig/ml. 

Le surnageant est pre 1 eve apres 24h de culture 
a 37 # C (7.5%C0 2 )r puis congele a - 20*C pendant 16h 
minimum. La stimulation de 1 'hybridome est mesuree par 
la teneur en IL2 du surnageant dans un test de 

30 proliferation de cellules CTL-L. Les ecarts types ne 
sont pas mentionnes, car 1'erreur est inferieure a 10% 
de la moyenne des triplicats. 

1.7 Dosage de l'IL2 et de l'IL4 

La lignee CTL-L est dependante de 
35 l'Interleukine 2 et de 1 1 Interleukine 4; elle est 



WO 94/06472 



PCT/FR93/00876 



28 



maintenue en culture en milieu complet enrichi de 20% 
de surnageant de splenocytes de rat, incubes 36h avec 
2,5 /ig/ml de concanavaline A. 

Apres decongelation, les sumageants de 
5 cultures (testes au 1/2) sont incubes en presence de 
2,25.10* cellules CTL-L, prealablement lavees trois 
fois dans le milieu RPMI1640, pendant 3 jours a 37* C 
(7,5% C0 2 ) . 

La proliferation cellulaire est mesuree par 

10 addition de thymidine tritiee d'activite specif ique 1 
Ci/mmole, a raison de 2 jiCi/xnl de culture, pendant les 
16 demieres heures de culture. 

L'ADN des cellules est recupere apres lyse des 
cellules et filtration a l'aide d'un "Skatron" . 

15 L' incorporation de radioactivite est comptee par 
scintillation a l'aide d'un compteur-beta. 

Les. resultats sont exprimes en cpm a partir de 
la moyenne des triplicats, corrigee de la 
radioactivite incorporee en l 1 absence d'antigene. 

20 1.8 Test de proliferation 

La rate et/ou les ganglions inguinaux sont 
preleves sterilement 7 ou 14 jours apres 
1 1 immunisation des souris (voir protocole 
d' immunisation) . 8.10 5 cellules sont incubes en 

25 presence de differentes concentrations d'antigene, 
soluble ou couple aux billes. Les cellules sont mises 
en culture (triplicats) dans du milieu RPMI 1640 
(SEROMED) additionne de 1.5% de serum de veau foetal 
decomplemente, 0,5% de serum normal de souris, 50 pM 

30 de p2-mercaptoethanol, 2mM de glutamine, 100 Ul/ml de 
penicilline et 100 pg/ml de streptomycine; en 
microplaques (Corning 25860) pendant 4 jours a 37 # C 
(7,5% C0 2 ) . 

La proliferation des cellules est mesuree par 
35 incorporation de thymidine tritiee, d'activite 



WO 94/06472 



PCT/FR93/00876 



specifique 25 Ci/mmole, a raison de 2 piCi/ml de 
culture, pendant les 16 demieres h ures. L'ADN des 
cellules est recupere apres lyse des cellules et 
filtration a l'aide d'un SJcatron, 1 'incorporation de 
5 radioactivite est comptee par scintillation a I'aide 
d'un compteur-be ta . 

Les resultats sont exprimes en cpm a partir de 
la moyenne des triplicats, corrigee de 1 • incorporation 
en absence d'antigene. 
10 2 - RESULTATS . 

2.1. Stimulation par le lvsozvme couple aux 
microparticules de cellules oanalionnaires de souris 
immunisees par le lvsozvme, 

Dans les essais illustres aux Figures 3 A et 3B, 
15 des souris BALB/c ont ete immunisees par injection 
sous-cutanee a la base de la queue avec du lysozyme 
soluble complements avec de 1' adjuvant de Freund 
(CFA). 

Apres 14 jours , les ganglions inguinaux ont ete 
20 preleves, et la reponse proliferative de ces cellules 
a ete testee * in vitro contre dif ferentes 
concentrations de lysozyme ou contre differentes 
concentrations de microparticules couplees au 
lysozyme. Les resultats sont exprimes en cpm corriges 
25 de la valeur obtenue sans an ti gene* 

Le lysozyme soluble induit une proliferation 
importante des cellules de souris immunisees par cet 
antigene en adjuvant de Freund (3A). La stimulation in 
vitro de ces m ernes cellules par les microparticules- 
30 lysozyme revel e que celles-ci sont capables d'induire 
une tres forte proliferation cellulaire (figure 3B) - 
Les microparticules de plus grand diametre, 0,81 et 
0,96 pirn (couplage spontane) , sont tres efficaces. 

2.2. Stimul ation par le lvsozvme couple aux 
35 billes de I'hvbridome T. 



WO 94/06472 



PCT/FR93/00876 



30 



Les figures 4A et 4B correspondent aux 
resultats de stimulati n de l'hybridome T, specif ique 
du lysozyme par le lysozyme soluble (4A) ou couple aux 
microparticules (4B) . Le degre de stimulation de 
5 l'hybridome a ete mesure par le taux d'IL-2/IL-4 
produites . 

En presence de splenocytes irradies, 
l'hybridome T est stimule fortement par le lysozyme 
soluble (figure 4A) . En presence de ces cellules, les 

10 microparticules-lysozyme de grande taille (0,81 et 
0,96 f/m) entrainent egalement une production d'IL- 
2/IL-4 importante (figure 4B), contrairement aux 
microparticules de 0,5 et 0,25 ;/m qui ne sont pas 
capables de stimuler l'hybridome T specif ique. 

15 2.3. Incapacity des cellules A2Q de lvmphome B 

a presenter le lysozyme couple aux billes a 
l'hvbridome T, specif ioue du lysozyme. 

On sait que des tumeurs cellulaires B portant 
des recepteurs la peuvent etre utilises comme cellules 

20 pre sent ant des an ti genes pour des ant i genes qui n'ont 
pas de reactivite avec le recepteur Ig mais qui sont 
fixes par les tumeurs de cellules B par des me c an is me s 
non specif iques (Walker et al. J. Immunol. (1982) 
128:2164; Glimcher et al. J. Exp. Med. (1982) 155:445; 

25 Mac Kean et al. J. Exp. Med. (1981) 154:1419; Mac Kean 
et al. J. Exp. Med. (1981) 154:1419). 
v On a done teste la capacite d'une de ces 

tumeurs cellulaires B, la lignee A20, a presenter le 
lysozyme sous forme soluble ou particulaire. 

30 La presentation du lysozyme soluble ou 

particulaire a ete comparee en utilisant deux sources 
de CPA: soit une source heterogene, les splenocytes 
totaux irradies, soit des cellules B provenant du 
lymphome A20. Lorsque I'antigene est sous forme 

35 soluble (figure 5A) , il peut stimuler l'hybridome T 



WO 94/06472 



PCT/FR93/00876 



aussi bien en presence de splenocytes que des cellul s 
B A20. Au contraire, le lysozym particulaire est 
presente uniquement par les splenocytes et non par les 
cellules B A20 (figure 5 B) . 
5 Ces resultats confirment que les splenocytes 

peuvent presenter aux cellules T un antigene, qu'il 
soit soluble ou sous forme particulaire. Par contre, 
les lymphocytes B sont incapables de presenter un 
antigene rendu particulaire par couplage a des billes 

10 d'une taille de I'ordre du micron. 

2.4 Induction de reponses T prolif eratlves par 
injection a des souris de lvsozvme couple aux 
microparticules . 

L* immunogenic! te in vivo de 1* antigene couple 

15 aux microparticules a ete analysee en immunisant des 
souris BALB/c avec du lysozyme en adjuvant complet de 
Freund ou avec cet antigene couple a des billes de 
polyacroleine . Apres 14 jours, les cellules des 
ganglions drainants de ces animaux ont ete stimulees 

20 in vitro par differentes concentrations de lysozyme 
soluble. 

En presence de lysozyme soluble, les cellules 
gangliormaires prdliferent fortement, qu'elles 
proviennent de souris immunisees avec le lysozyme 

25 soluble ou avec des microparticules-lysozyme (figure 
6A) . Ceci demontre que dans les deux cas, des cellules 
T specifiques du lysozyme ont ete sensibilisees in 
vivo. Apres injection a des souris de microparticules- 
LH represent ant le controle de specif icite, les 

30 cellules gangliormaires de ces animaux sont incapables 
de proliferer en reponse a une stimulation par le 
lysozyme soluble in vitro (figure 6B) . La reponse 
cellulaire in vitro est done specifique de I'antigene 
proteique couple aux microparticules, utilise lors de 

35 1 'immunisation des souris. 



WO 94/06472 



32 



PCT/FR93/00876 



La reponse proliferative des cellules 
sensibilisees par 10 9 microparticules-lysozyme 
(correspondant a 1 j/g de lysozyme) en absence 
d f adjuvant, est aussi elevee que celle des cellules 
5 d'animaux immunises par 100 pq de lysozyme soluble en 
adjuvant de Freund (CFA) (figure 6A) . Pour verifier et 
preciser ce resultat, les reponses prolif eratives des 
cellules ganglionnaires d'animaux ayant regu 
differentes doses de lysozyme en CFA ou differentes 
10 concentrations de microparticules couplees ont ete 
comparees, apres stimulation in vitro par le lysozyme 
soluble. 

Dans le cas des Figures 7A et 7B, des souris 
ont ete immunisees par injection sous-cutanee a la 
15 base de la queue avec du lysozyme soluble et de 
1 'adjuvant complet de Freund (CFA) (Figure 7A) ou des 
billes couplees a l'antigene sans aucun adjuvant 
(Figure 7B) . 

Apres 14 jours, les ganglions inguinaux ont ete 
20 preleves, et la reponse proliferative de ces cellules 
a ete testees in vitro contre differentes 
concentrations de lysozyme. Les resultats sont 
exprimes en cpm corriges de la valeur obtenue sans 
ant i gene . 

25 Sur la Figure 7B, il est a noter que les 

denominations 10 9 , 10 8 , 10 7 et 10 6 B-LYSO 
correspondant respect! vement a des poids de 1; 0,1; 
0,01 et 0,001 fig en lysozyme. 

Ces resultats demontrent que les cellules 

30 ganglionnaires des animaux immunises avec des 
microparticules portant du lysozyme proliferent in 
vitro apres mise en contact avec le lysozyme, 
indiquant ainsi une sensibilisation des cellules T 
specif iques de cet antigene. 

35 La comparais n des effets doses (Figure 7) 



WO 94/06472 



PCT/FR93/00876 



33 



indique que 1 pg d lysozyme couple aux billes donne 
une repons quasi -equivalente a cell de 1 fig 
d'antigene injecte en CFA. 

La figure 8 represente la repons e proliferative 
5 des cellules de souris immunisees par le lysozyme en 
adjuvant complet de Freund (CFA) ou en PBS avec des 
microparticules couplees au LH. L' addition de billes 
LH au lysozyme ne permet pas d'induire des reponses 
prolif eratives elevees ce qui indique que le lysozyme 
10 doit etre couple de fagon covalente aux 
microparticules pour induire des reponses T 
prolif eratives . 

2.5 - Induction de reponses T-prolif eratives 
par injection d' hemoglobine ou d'ovalbumine 

15 couolee a des microparticules a des souris 

Des souris ont ete immunisees par 1 'hemoglobine 
ou l'ovalbumine en adjuvant complet de Freund, ou avec 
ces proteines couplees par liaison covalente au meme 
type de particules que dans les exemples precedents 
20 (polystyrene, diametre de 1 pm) . 

Les cellules des ganglions de ces anlmaux ont 
ete restimulees in vitro par les proteines solubles et 
la proliferation cellulaire a ete mesuree. 

Les resultats obtenus pour 1 'hemoglobine (Hb) 
25 sont representes sur la Figure 9, tandis que la Figure 
10 illustre les resultats obtenus avec l'ovalbumine 
(OVA) . 

L* ensemble de ces resultats montre que ces 
proteines couplees a des microparticules sont capables 
30 de sensibiliser in vivo des lymphocytes T, CD4 + 
specif iques de ces proteines, en 1 'absence d'adjuvant. 

2.6 - Induction de reponses T-prollf eratives 
par injection de peptides svnthet ique s 

2.6.1 - Epitope T de la region C3 de la 
35 proteine VP 1 



WO 94/06472 



34 



PCT/FR93/00876 



L' epitope T de la region C3 (C3: T, 103-115) de 
la proteine du polyovirus a *t' synthetise t couple 
de fagon covalente a des billes de 1 fim. Ces billes 
ont ete injectees a des souris BALB/C • 
5 Les resultats de la Figure 11 etablissent de 

maniere claire que l f epitope T couple aux billes (B- 
C3:T) induit une forte reponse T-prolif erative pour 
des quantites de I'ordre de 10 9 billes injectees par 
souris. 

10 2.6.2 - Peptide pre-StT de l'antioene HBS 

Le peptide pre-S:T (120-132) de I'antigene HBS 
a ete synthetise et couple de maniere covalente par le 
glutaraldehyde a des billes ayant un diametre de 1 ym. 

La Figure 12 montre que I 1 injection de 10 9 
15 billes a des souris DBA/1 induit une forte reponse T- 
prolif erative superieure a celle obtenue avec le 
peptide en CFA. L* injection de billes ne contenant que 
1 'epitope B n'induit pas de reponse proliferative, ce 
qui demontre la specif icite de la reponse. 
20 EXEMPLE 3 . 

Induction de reponse anti corps par des 
microparticules portant un antigene. 

Les materiel s et methodes sont similaires a 
ceux de I'Exemple 2. 
25 1. Lvsozvme et hemocvanine de Limulus 

Pour les Figures 13A et 13B # des souris BALB/c 
ont ete immunisees par injection intra-peritoneale 
avec 100 fig de lysozyme soluble en adjuvant (alum) ou 
avec les billes couplees a I'antigene: lysozyme ou 
30 Hemocyanine de Limulus (LH) , sans aucun adjuvant. 

Les injections ont ete faites a JO, J21, J42, 
les serums ont 6te preleves a J20, J31 f J40 et J52 ; 
et testes en ELISA pour leur teneur en anticorps. Les 
resultats sont exprimes en loglO du titre en anticorps 
35 anti-lysozyme (Figure 13A) et anti-KLH (Figure 13B) . 



WO 94/06472 



35 



PCT/FR93/00876 



Trois injecti ns d'antig^ne ont et' faites i.p. 
aux jours 0, 21 et 42. Les microparticules-lysozyme 
donnent de tres bonnes reponses anticorps alors 
5 qu'aucune reponse anticorps n'est induite par les 
microparticules LH. Ces microparticules , par ailleurs, 
stimulent de fagon tres efficace les reponses T. 

Une des differences entre le LH et le lysozyme 
reside dans leurs poids moleculaire (14500 pour 
10 lysozyme et 71000 pour LH) . 

A concentrations d 1 ant i gene couple egales, la 
densite des molecules de LH sur les billes est done 
environ 5 fois plus faible. Ceci pourrait expliquer 
!• absence de stimulation des reponses anticorps si 
15 celles-ci sont dues k la stimulation directe T- 
independante par 1* ant i gene present a forte densite 
sur les microparticules. 

2 • Hemoolobine et ovalbumine 

Des souris ont ete immunisees avec l'antigene 

20 soluble en adjuvant alum ou avec le meme an ti gene sous 
forme particulaire, en 1 'absence d' adjuvant. 
L v apparition des anticorps a ete alors suivie sur 
plusieurs semaines • 

Dans le cas de 1 'hemoglobine (Hb), les souris 

25 ont ete immunisees avec 100 jig de proteine ou 10 9 
billes couplees a differentes densites avec la 
proteine (2.10 4 et 2.10 5 molecule /pm 2 ) . Les billes 
portant 1 ■ ovalbumine (OVA) ont ete testees a deux 
densites 7.10 3 et 7.10 4 molecule/^m 2 ) . 

30 Une premiere injection a ete realisee, puis 

deux autres injections ont ete faites au vingt et 
unieme jour et quarante deuxieme jour. Les serums ont 
ete preleves au vingtieme jour, au trente et unieme 
jour, au -quarante et unieme jour et au cinquante 

35 deuxieme j ur, puis ont ete testes en ELISA p ur leurs 



WO 94/06472 



36 



PCT/FR93/00876 



teneurs n anticorps IgG. Les resultats sont exprimes 
en Log du titre en anticorps. 

Les resultats de la Figure 14 montrent que 
l'hemoglobine couple aux billes n f induit pas de 
5 reponse anticorps. Pour I'ovalbumine (Figure 15) des 
anticorps sont detectables apres plusieurs injection 
si I'antigene est couple a forte densite, mais ces 
reponses restent faibles. Ces resultats indiquent que 
des proteines de poids moleculaire eleve comme 
10 l'hemoglobine sont incapables d'induire des reponses 
anticorps, meme si ces proteines sont couplees a une 
densite elevee sur des billes. 

Ces resultats similaires a ceux obtenus avec le 
lysozyme et 1 'hemocyanine limulus confirment que des 
15 billes portant des proteines de haut poids moleculaire 
induisent des reponses T-proliferatives en 1 'absence 
de toute production d 1 anticorps. 

De meme, les proteines de poids moleculaire 
faible ou moyen, ( infer ieur a 50.000) peuvent induire 
20 1' apparition d 1 anticorps si elles sont couplees a de 
fortes densites aux billes. 

3. Peptides svntheticrue s 

Les peptides pre-S:TB (120-145) et pre-S:B 
correspondant a des parties de I'antigene HBS 
25 contenant respectivement un epitope T et un epitope B 
ou seulement 1' epitope B ont ete couples de fagon 
covalente a des billes de 1 fim par le glutaraldehyde 
(B-pre-S:TB et B-pre-S:B). 

La reponse anticorps induite par ces billes a 
30 ete comparee k celle induite par 10 uq de peptide pre- 
S:TB soluble en adjuvant alum. 

Les resultats de la Figure 16 montrent que les 
billes couplees au peptide TB, comprenant un epitope T 
et un epitope B induisent de fortes reponses 
35 anticorps, ce qui conflrme que des antigenes de 



WO 94/06472 



PCT/FR93/00876 



37 



faibl s p ids moleculaires couples a des billes 
permettent 1' induction de reponse anticorps en 
1* absence de tout adjuvant. On notera que ces reponses 
sont aussi bonnes que celles obtenues avec le peptide 
5 libre en presence d 9 adjuvant alum. 
EXEMPLE 4 

Effet de la densite en Ivsozvme a la surface de 
microparticules sur leur immunocreneicite 
Les materiels et methodes utilises sont 
10 similaires a ceux de 1'Exemple 2. 

L 1 immunogenlcite des billes couplees avec du 
lysozyme et presentant un nombre de molecules 
variables a leur surface a ete testee dans les 
experiences presentees Figures 17 et 18. 
15 Pour la Figure 17A, des souris BALB/c ont ete 

immunisees par injection sous-cutanee avec 100 uq de 
lysozyme en CFA. Apres 14 jours les ganglions 
inguinaux ont ete preleves et les cellules testees in 
vitro contre les billes portant differentes densites 
20 de lysozyme (de 1100 a 950.000 molecules de lysozyme 
ramenees a des billes de 1 pm de diametre) • Les 
resultats sont exprimes en cpm corriges de la valeur 
obtenue sans antigene. 

Pour la Figure 17B, des souris BALB/c ont ete 
25 immunisees par injection sous-cutanee a la base de la 
queue avec du lysozyme soluble avec adjuvant (CFA) ou 
10 9 billes portant differentes densites de lysozyme 
sans aucun adjuvant. 

Apres 14 jours, les ganglions inguinaux ont ete 
30 preleves, et la reponse proliferative de ces cellules 
a ete testee in vitro contre differentes 
concentrations de lysozyme ou billes. Les resultats 
sont exprimes en cpm corriges de la valeur obtenue 
sans antigene. 

35 La pr liferation des cellul s ganglionnair s 



WO 94/06472 



38 



PCT/FR93/00876 



provenant d' animaux immunises par 1 lysozyme soluble 
en CFA a 'te testee apres stimulation in vitro par les 
differentes microparticules-lysozyme. La reponse 
proliferative de ces cellules etant d'autant plus 
5 forte que la densite du lysozyme en surface des 
microparticules est elevee. Aucune proliferation des 
cellules ganglionnaires n'est obtenue apres 
stimulation par les microparticules pre sent ant une 
densite de 1.100 molecules de lysozyme par 

10 microparticule (figure 17A) . 

Dans 1 'experience de la figure 17B, 
1 1 immunogenic! te de ces microparticules a ete testee 
in vivo. Des souris BALB/c ont ete immunisees par les 
differentes microparticules, sans adjuvant, et les 

15 cellules ganglionnaires de ces animaux ont ete 
stimulees in vitro par differentes concentrations de 
lysozyme soluble. 

La proliferation des cellules ganglionnaires 
provenant d' animaux immunises par les microparticules 

20 couplees au lysozyme a forte densite (950.000 et 
210.000) est elevee, et comparable a la reponse des 
cellules sensibilisees par 100 pg de lysozyme en CFA. 
Apres immunisation par les microparticules portant une 
densite moyenne de lysozyme (45.000), les cellules 

25 proliferent en reponse au lysozyme in vitro a partir 
de 10" 1 pg/ml. Les microparticules de plus faible 
densite n'ont pas sensibilise les cellules T in vivo, 
car aucune proliferation n"a ete observe e en presence 
de lysozyme meme a concentration elevee (figure 17B) . 

30 II est a noter que 10 9 microparticules couplees 

avec le lysozyme a haute densite correspondent a 23jig 
(1-950. 000-G) et 5 uq (1-210 .000-G) de lysozyme 
couple, cependant la proliferation des cellules est 
aussi elevee qu f apres injection de 100 fig de lysozyme 

35 en CFA. 



WO 94/06472 



39 



PCT/FR93/00876 



Pour la Figure 18 , des souris BALB/c ont ete 
immunisees par injection sous-cutanee de lysozyme avec 
adjuvant (CFA) ou avec 10 9 microparticules portant 
differentes densites de lysozyme (950.000; 2 10. 000 , 
5 45.000 et 1100 molecules respectivement, ramenees a 
une microparticule de 1 de diametre) . 

Apres 14 jours , les serums ont ete preleves et 
testes en ELISA pour leur teneur en anticorps anti- 
lysozyme. Les resultats sont exprimes en loglO du 

10 titre en anticorps. 

La reponse humoral e des souris immunisees par 
ces microparticules pre sent ant differentes densites de 
lysozyme a ete etudiee. L 1 injection de 100 pg de 
lysozyme en CFA induit un taux el eve d 1 anticorps anti- 

15 lysozyme (figure 18). Quatorze jours apres 
l 1 immunisation, les billes couplees a la plus forte 
densite de lysozyme (950.000) ont induit une 
production d f anticorps significative, alors que les 
billes de densite inferieure n'ont pas stimule 

20 l v induction de reponse anticorps anti-lysozyme 
significative. II faut noter, en particulier, que les 
billes de densite 210.000 qui ont induit une 
excellente proliferation specif ique du lysozyme n'ont 
pas stimule la production d 1 anticorps. 

25 Ces resultats revelent que la proliferation de 

cellules T est induite avec des densites de lysozyme 
all ant de 45.000 a 950.000 molecules de lysozyme par 
microparticule, alors que la production d 1 anticorps 
necessite une densite importante de proteine couplee 

30 aux microparticules. 

Au sens de la presents description, 
l f expression "microparticules " designe des particules 
pouvant avoir dlverses configurations geometriques et 
spatiales. Dans la pratique, il s'agit 

35 preferentiellement de microspheres u billes, telles 



WO 94/06472 PCT/FR93/00876 

40 



qu'elles sont obtenues par les techniques usu lies de 
fabrication des polymeres. 



WO 94/06472 



41 



PCI7FR93/00876 



RE VEND I CAT I ONS 

1. Utilisation de xnicroparticules n materiau 
synthetique polymer e, portant en surface une ou 
plusieurs proteines liees de maniere covalente, la ou 

5 lesdites proteines portant chacune un ou plusieurs 
epitopes, pour la fabrication d'un medicament ou d'un 
vaccin pour 1' induction d'une reponse immunitaire, les 
densites de la ou des proteines a la surface des 
microparticules etant ajustees afin d'orienter ladite 
10 reponse immunitaire, vers 1' induction d'une reponse 
humoral e et cellulaire ou vers I 1 induction d'une 
reponse majoritairement cellulaire. 

2. Utilisation selon la revendication 1, pour 
1' induction de reponses cellulaire et/ou humorale, 

15 caracterisee en ce que les microparticules pre sen tent 
une densite pour chacune des proteines portant un 
epitope . d'au minimum 10 5 molecules/jim 2 et 
preferentiellement 5.10 5 proteines /px? . 

3. Utilisation selon la revendication 1, pour 
20 1' induction d'une reponse majoritairement cellulaire, 

caracterisee en ce que les microparticules presentent 
une densite pour chacune des proteines portant un 
epitope, comprise environ entre 10 4 et 5.10* 
molecules /pm 2 • 

25 4. Utilisation selon la revendication 1 pour 

1' induction d'une reponse majoritairement cellulaire , 
caracterisee en ce que les microparticules portent en 
surface des proteines ayant des poids moleculaires 
superieurs a 50 kD. 

30 5. Utilisation selon l'une des revendications 1 

a 4, caracterisee en ce que les microparticules ont un 
diametre moyen compris entre environ 0,25 et environ 
1,5 jjm, et preferentiellement de 1pm. 

6. Utilisation selon l'une des revendications 1 

35 a 5, caracterisee en ce que la liaison est effectuee 

\ 



WO 94/06472 



42 



PCT/FR93/00876 



par reaction des fonctions NH 2 et/ou CO d s proteines 
et du materiau constituant la microparticule. 

7. Utilisation selon l'une des revendications 1 
a 5, caracterisee en ce que la liaison des proteines 

5 et du materiau constituant la microparticule est 
covalente et est effectuee avec ou sans agent pontant. 

8. Utilisation selon la revendication 7, 
caracterisee en ce que 1* agent pontant est le 
glutaraldehyde ou le carbodiimide. 

10 9. Utilisation selon l'une des revendications 1 

a 8, caracterisee en ce que ledit materiau est un 
polymere biocompatible. 

10. Utilisation selon la revendication 9, 
caracterisee en ce que ledit polymere est le 

15 polyacroleine ou le polystyrene ou des polymeres 
d'acide lactique ou des copolymeres d'acides lactique 
et glycolique. 

11. Utilisation selon l'une des revendications 
1 a 10, pour la fabrication d'un medicament pour la 

20 therapeutique humaine, caracterisee en ce que ledit 
polymere est biodegradable. 

12. Utilisation selon l'une des revendications 
1 a 11, caracterisee en ce que les microparticules 
portent en surface des molecules susceptibles 

25 d'activer le systeme immunitaire. 

13. Procede pour la fabrication d'un medicament 
ou d'un vaccin dont la reponse immunitaire est soit 
majoritairement humoral e soit majoritairement 
cellulaire, ledit procede etant caracterise en ce 

30 qu'on fixe de maniere covalente sur des 
microparticules en materiau synthetique polymere au 
moins une proteine portant un ou plusieurs epitopes ou 
des peptides contenant uniquement des epitopes T ou B 
ou une composition des deux en faisant varier la 

35 densite de la proteine fixee a la surface selon le 



WO 94/06472 



PCT/FR93/00876 



43 



type d reponse desir'e. 

14. Pr cede selon la revendication 13 , 
caracterise en ce qu'on utilise des microparticules 
comme indique a I'une quelconque des revendications 1 

5 a 12. 

15. Microparticule en un materiau synthetique 
polymere portant en surface une pu plusieurs proteines 
liees de maniere covalente au materiau constituant la 
microparticule, la ou lesdites proteines portant 

10 chacune un ou plusieurs epitopes, et etant presentes a 
des densites comprises entre 10 4 et 5. 10. 5 
proteines /prtr pour chacune des proteines. 

16. Microparticule selon la revendication 15, 
caracterisee en ce qu'elle a un diametre moyen compris 

15 entre environ 0,25 Jim et 1,5 pm, et preferentlellement 
de 1pm. 

17. Microparticule selon I'une des 
revendications 15 et 16, caracterisee en ce que la 
liaison est effectuee par reaction des fonctions NH 2 

20 et/ou CO des proteines et du materiau constituant la 
microparticule . 

18. Microparticule selon I'une des 
revendications 15 et 16, caracterisee en ce que la 
liaison des proteines et du materiau constituant la 

25 microparticule est effectuee par I'intermediaire d'un 
agent pontant. 

19. Microparticule selon la revendication 18, 
caracterisee en ce que 1' agent pontant est le 
glu tar aldehyde, ou le carbodiimide. 

30 20. Microparticule selon I'une des 

revendications 13 a 19, caracterisee en ce qu'elle est 
compos ee d'un polymere biocompatible. 

21. Microparticule selon la revendication 20, 
caracterisee en ce que ledlt polymere est la 

35 poly(acroleine) u le polystyrene, un p lynTre d'acide 



WO 94/06472 



PCT/FR93/00876 



44 

lactique ou un copolynTre d'acide lactique et 
glycolique. 

22. Microparticule selon la revendication 20, 
pour l" application en * therapeutique humaine, 

5 caracterisee en ce que ledit polymere est 
biodegradable. 

23. Microparticule selon l'une des 
revendications 15 a 22 , caracterisee en ce qu'elle 
porte en surface des molecules susceptibles d'activer 

10 le sy steme immunitaire . 

24. Microparticule selon l'une des 
revendications 15 a 23, caracterisee en ce que ladite 
proteine comprend 1' epitope B de la region pre-s 2 de 
1'antigene HBs du virus de l'hepatite virale. 

15 25. Microparticule selon l'une des 

revendications 15 a 23, caracterisee en ce que ladite 
proteine comprend 1' epitope B de la proteine VP1 du 
virus de la poliomyelite. 

26. Microparticule selon l f une des 
20 revendications 15 a 23, caracterisee en ce que ladite 

proteine comprend !• epitope B de la proteine gp 120 du 
virus HIV-1. 

27. Medicament ou vaccin, caracterise en ce 
qu'il comprend des microparticules selon I'une des 

25 revendications 15 a 26. 

28. Composition pharmaceutique caracterisee en 
ce qu'elle comprend des microparticules selon l'une 
des revendications 15 a 26 en association avec des 
diluants et adjuvants pharmaceutiquement compatibles. 



WO 94/06472 



1/14 



PCT/FR93/00876 




WO 94/06472 



2/14 



PCT/FR93/00876 




WO 94/06472 



3/14 



PCT/FR93/00876 



FI6.3A 



SOOOOn 




lysozyme jjg/ml 



FIG.3B 



40000n 




1:16000 %m t 1.-1000 1:230 

dilution des billes 



0,25 _ LYSO 
*— 0.81 -LYSO 
0,96 _ LYSO 



WO 94/06472 



4/14 



PCT/FR93/00876 



FIG.4A 

100000 1 
80000 
60000 
40000 
20000H 
0 



e 

CL 
U 



FIG.4B 



10- 4 i(r 3 io -2 10- 1 io° 10 1 io 2 

lysozyme jjq/ml 



E 

CL 

u 




132000 



1:8000 



1:2000 1:500 

dilution des billes 



0.25..LYSO 
-°— 0.S0.LYSO 

0.81.LYSO 
■a— 0.96. LYSO 



WO 94/06472 



5/14 



PCT/FR93/00876 



FIG.5A 

80000- 



60000- 



e 40000 ^ 

cx 
u 



20000- 



04 
0 




10 -4 icr 3 io- 2 icr 1 io° 10 1 io 2 

lysozyme pq/ml 




FIG.5B 

20000-1 
15000- 



|_ 10000-1 



5000-1 
0 





10 billes/ml 



WO 94/06472 



6/14 



PCT/FR93/00876 



FIG. 6 A 

1S00O0-| 
100000- 



£ 
o. 



50000 




10r 3 10- 2 IQr 1 10° 



100jjql_YS0+ACF 
K) 9 B-LYSO 



10 1 10 2 
lysozyme yq/ml 



FIG.6B 

60000 n 



40000 



E 

Q. 
U 



20000- 




-*- 10 3 B.LYS0 
-o— 10 6 B.LYS0 
tf B_KLH 
10 & B. KLH 



10 1 10 2 
lysozyme jjq/ml 



WO 94/06472 



7/14 



PCT/FR93/00876 



FI6.7A 

125000 1 



e 

u 




100|jqLYSO + CFA 
10jjgLYS0+CFA 
1 pgLYSO+CFA 
O.lpgLYSO+CFA 
0,01 jjg LYSO+CFA 



10 1 10* 

lysozyme pg/ml 



FIG.7B 



100000-1 




— 10* B- LYSO 
*— 10 7 B- LYSO 
+ — 1# B- LYSO 



WO 94/06472 



8/14 



PCT/FR93/00876 



t)0pgLYS0+PBS 
+ B.KLH 

10pgLYS0 + PBS 
+ B.KLH 

IpgLYSO + PBS 
+B.KLH 



0,1pgLYSO +PBS | 
+ B.KLH 



100pgLYSO +CFA ^ 



5S 



555 



553 



0 20000 40000 60000 80000 100000 120000 

cpm 



FIG. 8 



WO 94/06472 



9/14 



PCI7FR93/00876 



R^3 



30000-1 



20000 



& 



10000- 




20T lO^/ml .Hb 



30000 n 




lOOjlgOVA+CFA 
B-OVA 



T , 1 

0 10- 4 10" 3 lCT 2 lOr 1 10° 10 1 10 2 //g/ml ovalbumine 



WO 94/06472 



10/14 



PCT/FR93/00876 



300001 



20000" 



10000 




10>igC3:T + CFA 
"°~ 109B-C3:T 
" D ~~ IOSB-CSiT 

10 7 B-C3:T 



0 1(H 10 -3 10 -2 io-I ioO iQl fig/mipaiTB (93-116) 



Fi»« 



20000 n 



10000- 




10 PreS:TB+alum 

B-Pres:TB 

B-Pres:B 



Hg/m) p(l20-145) 



WO 94/06472 



PCI7FR93/00876 



11/14 




*— 100yqLYS0+olum 
*- 10 9 B.LYSO 
*- 10* B.LYSO 
— - 10 9 B.LH 



5- 



I 4 " 

CP 

3 

3- 



2^ 



10 



f 



20 30 40 SO 60 jours 



t 




WO 94/06472 



PCT/FR93/00876 



12/14 




100 \ig Hb + alum 
B-Hb 20.000 
B-Hb 200.000 



60 jours 




WO 94/06472 



13/14 



PCT/FR93/00876 



nam 



120000n 




— *— 3 .10 5 molecules /urn* 
-o— 0,7.10 s " 

1,5.10* " 

0,4.10* " 



120000 n 




+— 100 uq LYSO+CFA 
*— 1-950000-G 
o— 1-210000-G 
%45000-G 
■<^- 1-1100-G 



WO 94/06472 



PCT/FR93/00876 



6n 



14/14 




10ugPrcS:rB+a]um 
B-PrcS:TB 

B-PrcS:B 



60 jours 



3.10 s molec./pm 2 ||| 
0.7.10 s molec./pm 2 
1,5.10* molec./pm 2 

0,C10 3 molec./pm 2 
100 pqLYSO+CFA 




* 5 

Log titre onHcorps onH-lysozyme 



. INTERNATIONAL SEARCH REPORT 


Intern .al Application No 

PCT/FR 93/00876 


A. CLASSIFICATION OF SUBJECT MATTER 

IPC 5 A61K39/385 A61K47/48 C07K17/08 




According to International Patent Classification (IPC) or to both national classification and IPC 




B. FIELDS SEARCHED 


Minimum documentation searched (classification system followed by classification symbols) 

IPC 5 C07K A61K 



Documentation searched other than minimum documentation to the extent that such documents are included in the fields searched 



Electronic data base consulted during the international search (name of data base and, where practical, search terms used) 



Category* 


G tali on of document, with indication, where appropriate, of the relevant passages 


Relevant to claim No. 


X 


JOURNAL OF IMMUNOLOGICAL METHODS 
vol. 52, no. 3 , 1982 
pages 341 - 351 

A. REMBAUM ET AL. 'CELL LABELING AND 

MAGNETIC SEPARATION BY MEANS OF 

IMMUNOREAGENTS BASED ON P0LYACR0LEIN 

MICROSPHERES 1 

cited in the application 

see page 342, line 30 - page 343, line 31 


15 




-/~ 





13 



Further documents are listed in the continuation of box C. 



m 



Patent family members arc listed in annex. 



* Special categories of cited documents : 

*A* document defining the general state of the art which is not 

considered to be of particular relevance 
"E* earlier document but published on or after the international 

filing date 

'V document which may throw doubts on priority daim(s) or 
which is cited to establish the publication date of another 
citation or other special reason (as specified) 

*0* document referring to an oral disclosure, use, exhibition or 
other means 

*P" document published prior to the international filing date but 



T* later document published after the international filing date 
or priority date and not in conflict with the application but 
cited to understand the principle or theory underlying the 
invention 

"X* document of particular relevance; the claimed invention 
cannot be considered novel or cannot be considered to 
involve an inventive step when the document is taken alone 

*Y* document of particular relevance; the daimed invention 
cannot be considered to involve an inventive step when the 
document is combined with one or more other such docu- 
ments* such fgrnhinfltioy being obvious to a person skilled 
in the art. 

document member of the same patent family 



Date of the actual completion of the international search 

18 November 1993 


Date of »**flfr*g of the international search report 

^ j -k- £33 


Name and mailing address of the ISA 

European Patent Office, P.B. 5818 Patentlaan 2 

NL-ttSOHVRijswijk 

Tel. (+31-70) 340-2040, Tx. 31 651 cpo nl. 

Fax: (+31-70) 340-3016 


Authorized officer 

REMPP, G 



Form PCT/ISA/U0 (ncms ibttt) (July 19W) 



page 1 of 2 



INTERNATIONAL SEARCH REPORT 



Intern; J AppUcalion No 

PCT/FR 93/00876 



C(Continuation) DOCUMENTS CONSIDERED TO BE RELEVANT 



Category * I Citation of document, with indication, where appropriate, of the relevant passages 



Relevant to claim No. 



EUROPEAN JOURNAL OF IMMUNOLOGY 
vol. 17 , September 1987 
pages 1287 - 1296 

H. KIRK ZIEGLER ET AL. 'DIFFERENTIAL 
REQUIREMENTS FOR THE PROCESSING AND 
PRESENTATION OF SOLUBLE AND PARTICULATE 
BACTERIAL ANTIGENS BY MACROPHAGES.' 
cited in the application 
the whole article 



15-17, 
20-23 



EP,A,0 465 081 (THE REGENTS OF THE 
UNIVERSITY OF CALIFORNIA) 8 January 



1992 



FR,A,2 304 326 (KREUTER J0RG ET AL) 15 
October 1976 



Form PCT/1SA/31 0 (rootioustioo of second sheet) (July IMS) 



page 2 of 2 



INTERNATIONAL SEARCH REPORT 

bi*_fxnatian on patent family members 



Intemati * Application No 

PCT/hR 93/00876 



Patent document 
cited in search report 



Publication 
date 



Patent family 
member(s) 



Publication 
date 



EP-A-0465081 




IIC-A- 
Uj A 




15-06-93 




MC-A— 


CI 70QQO 


12-01-93 






Alt-Q— 




08-07-93 






All— A— 


7Q9inQi 


02-01-92 






PA-A- 

On AV 


?nA5?04 

CUtJLVt 


23-12-91 


FR"A-Z3U43Zo 


ID 1U /O 


PU-A- 


614856 


28-12-79 




ru-A- 


618352 


31-07-80 






All-R- 




27-09-79 






All— A* 


1P70876 


22-09-77 






RP-A- 
Du A 




20-09-76 






nF-A r 


?61 1 143 


14-10-76 






GB-A- 


1544107 


11-04-79 






jp-c- 




v/ OO 






JP-A- 


51118823 


19-10-76 






JP-B- 


62059088 


09-12-87 






NL-A- 


7602717 


22-09-76 






US-A- 


4269821 


26-05-81 






US-A- 


4225581 


30-09-80 



Form PCT/ISA/210 (pHtnl (kmiiy mm) (Jury 1993) 



RAPPORT DE RECHERCHE INTERNATIONALE 



Dema Internationale No 

PCT/FR 93/00876 



A. CLASSEMENT DE L'OBJET DE LA DEMANDE 

CIB 5 A61K39/385 A61K47/48 C07K17/08 



Scion la classification international e des brevets (CIB) ou a la fois sdon la classification nationale et la CIB 



B. DOMAINES SUR LESQUELS LA RECHERCHE A PORTE 



Documentation minimale consultee (systeme dc classification suivi des symbol cs de cLasscment) 

CIB 5 C07K A61K 



Documentation consultee autre que la documentation minimale dans la roesure ou ces documents rclcvent des domaines sur lesquels a portc la recherche 



Base de donates elcctronique consultee au 
utilises) 



coun de la recherche intemationalc (nom de la base de donnees, et n cela est realisable, tcrxnes de recherche 



C DOCUMENTS CONSIDERES COM ME PERTINENTS 



Categoric * Identification des documents cites, avtc, le cas echcant, Hndication des passages pertinents 



no. des revendications vista 



JOURNAL OF IMMUNOLOGICAL METHODS 
vol. 52, no. 3 , 1982 
pages 341 - 351 

A. REMBAUM ET AL. 'CELL LABELING AND 

MAGNETIC SEPARATION BY MEANS OF 

IMMUNOREAGENTS BASED ON POLYACR0LEIN 

MICROSPHERES' 

cite dans la demande 

voir page 342, ligne 30 - page 343, ligne 
31 

-/~ 



15 



[3 



suite du cadre C pour la fin de la bste des documents 



0 



Les documents de families de brevets sont indiqucs en annexe 



* Categories special es de documents cites: 

*A* document definissant I'etat general de la technique, non 

considere comme paraculierement pertinent 
# E* document anterieur, mats pvtriie a la date de depot international 

ou aprescctte date 
*L" document pouvant jeter un doute sur une revendi cation dc 

priori te ou cite pour determiner la date de publication a" une 

autre citation ou pour une raison sped ale (telle qu'indiquec) 
"O" document se referent a une divulgation oralc t aim usage, a 

une exposition ou tous autrcs moyera 
*p* document publie avant la date de depot international, mais 

posterieurcment a la date de priority rcvendiquee 



T document ultcricur publie apres la date de depot inlemational ou la 
date de priori te et n'appartencnant pas a I'etat de la 
technique pertinent, mais cite pour comprendre le principe 
ou la tneorie coastituant la base de l'invention 

"X" document parti eulierement pertinent; l'invention revendiauee ne peut 
ttre cons am e camme nouvdle ou comme impli quant une activite 
inventive par rapport au document considere tsolcment 

*Y' document particulierement pertinent; l'invention rcvendiquee 
ne peut £tre eonsidfcrte comme imp ti quant une activite inventive 
larsaue le document est associc A un ou plurieura autrcs 
documents de meme nature, cette comninmson etant cvidentc 
pour une pcrsonne du metier 

*&* document qui fait partie de la meme famille dc brevets 



Date a laquelle la recherche Internationale a etc eflccuvement achevec 

18 Novembre 1993 



Date <f expedition du present rapport dc recherche intern artonalc 



1 0 -12- 



1993 



Noro et 



postale de l'administration chargee de la recherche Internationale 

Office Europeen da Brevets, P.B. 58) 8 Patent] a&n 2 

NL - 2280 HV Rijswijk 

Td. (+31-70) 340-2040, Tx. 31 651 epo nl, 

Fax (+31.70) 340-3016 



Fonctiosnaire autorisft 



REMPP, G 



Ffiimolalra PCT/ISA/210 (deoxttmt ttnW») (Millet 1993) 



page 1 de 2 



RAPPORT DE RECHERCHE INTERNATIONALE 



Dona jtternationalc No 

PCT/FR 93/00876 



C(suite) DOCUMENTS CONSIDERE5 COM ME PERTINENTS 



Outgone ' Idcntiflcation des documents cites* ftvcc, le cas echeant, I'indication des passages pertinents 



no. des re vcndi cations viseei 



EUROPEAN JOURNAL OF IMMUNOLOGY 
vol. 17 , Septembre 1987 
pages 1287 - 1296 

H. KIRK ZIEGLER ET AL. 'DIFFERENTIAL 
REQUIREMENTS FOR THE PROCESSING AND 
PRESENTATION OF SOLUBLE AND PARTICULATE 
BACTERIAL ANTIGENS BY MACROPHAGES . ' 
cite dans la demande 
L'article en entier. 

EP.A.O 465 081 (THE REGENTS OF THE 
UNIVERSITY OF CALIFORNIA) 8 Janvier 1992 

FR,A,2 304 326 (KREUTER J6RG ET AL) 15 
Octobre 1976 



15-17, 
20-23 



FsnmWn PCT/ISA/UO (nttU dlla daiaita* (MBit) (jsBItt 1»2) 



page 2 de 2 



RAPPORT DE RECHERCHE INTERNATIONALE 



Remdgnements relatifs aux mcrabrcs de families de farevets 



Demi nternationale No 

PCT/FR 93/00876 



Document brevet cite 
au rapport de recherche 



Date de 
publication 



Mcmbrt(s) de la 
famille de brevets) 



Date de 
publication 



EP-A-0465081 



08-01-92 



FR-A-2304326 



15-10-76 



US-A- 
US-A- 
AU-B- 
AU-A- 
CA-A- 



CH-A- 

CH-A- 

AU-B- 

AU-A- 

BE-A- 

0E-A.C 

GB-A- 

JP-C- 

JP-A- 

JP-B- 

NL-A- 

US-A- 

US-A- 



5219577 
5178882 
638841 
7921091 
2045204 



614856 
618352 
503982 
1220876 
839748 
2611143 
1544107 
1451720 
51118823 
62059088 
7602717 
4269821 
4225581 



15-06-93 
12-01-93 
08-07-93 
02-01-92 
23-12-91 



28-12-79 
31-07-80 
27-09-79 
22-09-77 
20-09-76 
14-10-76 
11-04-79 

25- 07-88 
19-10-76 
09-12-87 
22-09-76 

26- 05-81 
30-09-80 



Fonnulato PCT/ISA/310 (uam fanlUcs de brrvcti) (JufUet 1993}